(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_15

ID   PENCW_15; SV 1; linear; genomic DNA; GRV; FUN; 1591038 BP.
XX
AC   AM920433_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 20)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c18, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920433.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1591038
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        join(424..681,746..1142,1204..5036)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184458" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941208"
FT                   /orf_name="Pc18g00010"
FT                   /product="Pc12g16490 protein"
FT                   /protein_id="CAP94225.1"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI0001830C2C"
FT                   /db_xref="UniProtKB/TrEMBL:B6GZ19"
FT                   /transl_table=1
FT                   /translation="MAFLFKSKKNQQSQQPAALPPATRNVHTSEGTPSTGSIMANGVKG
FT                   DGTTSQTPTPSGSFSNSLHSATSPASPDAVRPRQRAESESQMQRPQQLPNGIPPPSPNS
FT                   SLYPWSQRRLNFSSPQTNPFPRYGAAINSVASKEGDIYMMGGLIDGSTVKGDLWMIESS
FT                   GGGLNCLQVATVSEGPGPRVGHASLLVGNAFIVFGGDTKIDENDSLDDTLYLLNTSSRQ
FT                   WSRAIPPGSRPSGRYGHTLNILGSKLYVFGGQVEGFFFNDLIAFDLNQLQNPANKWEVL
FT                   IQNSHEGGPPPGQIPPARTNHTIVSFNEKLFLFGGTNGVQWFNDVWSYDHITNIWTEID
FT                   CVGFIPAPREGHASALVNDVMYVFGGRTDEGVDLGDLSAFRISTRRWYSFQNMGPAPSP
FT                   RSGHSMTAFGKQIIVMAGEPSSAPRDPAELSMSYILDTSKIRYPNDSQPGGRLPDPATR
FT                   KTSIDKPGISSGRSSREAQNAVPEQQMRRGPTPSRESMMQGTAANRPGEFGPNPNLGPG
FT                   SRLPRASIAQAPAGPPPPGQAPSPGPRGNGPPAGANPRSKTPTKNDRGYTPTADNRVAN
FT                   DERGEESPIMKEGPQDSQGPPSAGRRTPTQHQKPSAKAMEAGEAAPLISAPGRQRSLRS
FT                   HRQRGSVDSGEESILGRQASIEGSMESRSFRNSKTLGDEPRSPRLTPHQEALIKELEVT
FT                   KARNAWYASELALARKCGYVPNATSSPALDDRANEALSDEDRPLVEAFLAMRADLSKMQ
FT                   ATVDRQAAIASKRVAEVEHQRDMAINEAAYSRAKLAAHGGSQRGTPQPDAPRDGDDERP
FT                   TDMGRRLALALASLSELKAKLDAQTTELSQERQAKELAEETNEATRKHLAELEMQSNTL
FT                   EAENLRAELHRAEALSREEAFLRAEAEASLRQLTLDKEELLAQIEDSSTRLKDFDSSFG
FT                   GLREAVSASAAKTALVEKQFQEERERREGLERKLLQLRSEHEERTTELENITRRLRDAE
FT                   ELAEIHAKEAETHKIAFVSGLERASSTDLDNPFRSRADQRVAALEAQIERSTTLAKANQ
FT                   AAANAASDKLRRAEERIAGLEAYQEQASREGLQLRRQLQTAMKESQSAATNNRDLKTQL
FT                   EAHQREAGALAVQHAALKDLLGERGMNSESRRSPRLESPGSRFGTPEQSRLRELEQQLS
FT                   ASIKAHDDLKNGFESREQEADRAFREKLEQLENDYQSAVHYVKGTEKMLKRMKDELSRY
FT                   KTQNAKMQSELDVAQKSLENSGSQASSSAEWDAERSRLELSMSELQSRTSSSISGLESQ
FT                   ITQLKQDLDQATTEKELSRSEHERLKQELLAAAEKSRSELDQLKQENTHLETRASDAER
FT                   KVNMLLEQVQTSVGHYRRQSHLVQGSNGISRTHSNASSNTISRGNGRARADSNVSQDST
FT                   FPDNRGSMALDSLANELDALRTHWESTNRNYRLSSQLDLDRTPTKDASEGPALMSDSLA
FT                   EWRRRLDDDDRAGFDVQTKPLSTGAAHPEHSNVI"
FT   CDS_pept        join(6859..6923,7019..8060)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182055" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941209"
FT                   /orf_name="Pc18g00020"
FT                   /product="Pc18g00020 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP94226.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831722"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBJ1"
FT                   /transl_table=1
FT                   /translation="MIVNKTSEPRVVLTLPPGFASRNSLLLGTNIISGEEIAIKLESVK
FT                   AKHPQLEYEARVYKSLAGGVGIPFVRWFGTECDYNAMVINLLGPSLEDLFNFCNRKFSL
FT                   KTVLLLADQLISRIEYIHAKSFIHRDIKPDNFLMGIGKRGNQVNVIDFGLAKKYRDPKT
FT                   HFHIPYRENKNLTGTARYASINTHLGVEQSRRDDMESLGYVMLYFCRGSLPWQGLKAAT
FT                   KKQKYDRIMEKKMTTPTEVLCRGFPNEFAIYLNYTRSLRFDDKPDYSYLRKIFRDLFVR
FT                   ESFQYDYVFDWTVYKYQKNAAMIVDASKKDKDAEDQQRRQALPAGGQMGAGGAAKPGAI
FT                   NSQRRKVVERGTLDTPDTNRAVGGSDRM"
FT   CDS_pept        join(9641..9754,9804..10057,10140..10671)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000184447" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670001"
FT                   /orf_name="Pc18g00030"
FT                   /product="Pc12g16510 protein"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAP94227.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="InterPro:IPR023167"
FT                   /db_xref="UniParc:UPI0001830C2E"
FT                   /db_xref="UniProtKB/TrEMBL:B6GZ21"
FT                   /transl_table=1
FT                   /translation="MDYSFYDPRSQPSSFSLYGLPTPDQPHTQTQPDTFAPLKNYQNLP
FT                   GFDPSFPVDPSFVPPPHTPPESVKHSASSDAANNQYTRPTSFDGDEAQFADPTLGRSSS
FT                   EEKESAPAQSKRKAQNRAAQRAFRERKEQHVRDLEDKVNNLEQASNTLQADNERLKREL
FT                   ARYTTENEILRATALHTDHGHASANHTPEPTVTGPMKFSPTDFHTTFMPDGPGTPRSPQ
FT                   HRLTVCPITGEKLLDARATWDLIQKHELFERGQLDIGDVTERLKGMSQCDGQGPAFKES
FT                   QVRQAIEESAAAGRDELI"
FT   CDS_pept        join(complement(12070..12107),complement(11804..11986),
FT                   complement(11378..11733),complement(11187..11320))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184445" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822772"
FT                   /orf_name="Pc18g00040"
FT                   /product="Pc12g16520 protein"
FT                   /protein_id="CAP94228.1"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0001830C2F"
FT                   /db_xref="UniProtKB/TrEMBL:B6GZ22"
FT                   /transl_table=1
FT                   /translation="MQVEVDPKEDTEWNDILRQHGIIPEKPKDPEPLIQEALIAAQHRA
FT                   HENRLEDKDLDELDALEEDEDEEFLESYRQKRLAELSTLQKTSLFNQVFPLQKVDYARE
FT                   VTEASNSAYVLVNLTSMGGNVESRVLTELWRQLAAKFGDIKFCEIRADMCIEGYPEKNT
FT                   PTILAYKDTEIKKQLITLQQLKGPRTKLEDLEGLLVEIGALKESDVRLKKRDDEDDYKK
FT                   DDDLNVEDYDDDWD"
FT   CDS_pept        join(12529..12604,12681..12991,13051..14365,14415..15233,
FT                   15295..15527)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184434" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127024"
FT                   /orf_name="Pc18g00050"
FT                   /product="Pc12g16530 protein"
FT                   /function="binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="COPI vesicle coat"
FT                   /protein_id="CAP94229.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030126"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013040"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR014863"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017106"
FT                   /db_xref="UniParc:UPI0001830C30"
FT                   /db_xref="UniProtKB/TrEMBL:B6GZ23"
FT                   /transl_table=1
FT                   /translation="MSYMKKNEDEDQVMIKLDRTSVFQDARLFNSSPISPRTCRTLLTK
FT                   IAVLMFTGEQFPTNEATTLFFGISKLFQNKDPSLRQMVYLILKELAGTAEDVIMSTSII
FT                   MKDTAVGSDVLYRANAIRALCRIIDGSTVQGIERLIKTAIVDKTPSVSSAALVSSYHLL
FT                   PIARDVVRRWQSETQEAASSSKSSTGFLGFSSSSQSHAISNSNFMTQYHAIGLLYQMRS
FT                   HDRMSLVKMVQQYGAAGVVKSPAALVLLVRLAAKLAEEDQGLRKPMMQMLDGWLRHKHE
FT                   MVNFEAAKAICDMRDVTDAEATQAVHVLQLFLSSPRSITKFAAIRILHNFASFKPHVVN
FT                   VCNPDMESLISNSNRSIATFAITTLLKTGNEASVDRLMKQISGFMADITDEFKVTIVEA
FT                   IRTLCLKFPSKQAGMLVFLSGILRDEGGYEFKRTVVESMFDLIKFVPESKEDALAHLCE
FT                   FIEDCEFTKLSVRILHLLGSEGPKTTHPTKYIRYIYNRVVLENAIVRAAAVTALAKFGV
FT                   GQKDPEVKSSVHVLLTRCLDDTDDEVRDRAALNLRLMAAEDECASAFIKNDSMYSLSTF
FT                   EHQLVMYVTSGDKETFAAAFDVATIPVVSHEQALAEERTKKLTSATPTLKAPSAGPPKG
FT                   AAAGGMAEAASASATQKYAEQLLQYPDIKAYGTLLKSSAPVELSESETEYVVTAVKHIF
FT                   KEHIVVQYDIKNTLPDTVLENVTVVATPDEEDVLEDDFIIPAPKLATDQPGVVYVAFKK
FT                   LAGENSVPVTSFTNVLRFTSKEIDPASGEPEDSGYDDEYQVEDLELTGSDYVIPTFAGS
FT                   FDHVWEQTGANGEEESETLQLSNMKSINDATEQLISALSLQPLEGTDVALNSSTHTLKL
FT                   FGKTVSGGRVASLIKMAYSSKAGVTTKITVRAEEEGVAAAVIASVS"
FT   CDS_pept        join(complement(16693..17685),complement(15947..16624))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226032" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941210"
FT                   /orf_name="Pc18g00060"
FT                   /product="Pc12g16540 protein"
FT                   /function="ATP binding"
FT                   /function="aspartate-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="aspartyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP94230.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004815"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006422"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI0001830C31"
FT                   /db_xref="UniProtKB/TrEMBL:B6GZ24"
FT                   /transl_table=1
FT                   /translation="MADSELPHRPKPEAQDASAPAAEGETKNASKNALKKAAKDKAKAE
FT                   KAAARAAQEKAQAAAQDANDTAKDLYGPLPETEDVVPSTRFSEFSEDHYEKEVTVVARV
FT                   DNARVQSAKLAFLMLRQQGQKVQAVIAAAEPISRQMIKYTGGLNVNSIVQVTGIVKKPE
FT                   IPISSASISHLEIHIRKVYMISEAAQMLPMQVKDAERPPPENTEEGAQVDAEGAPIVTL
FT                   KTRLDNRVLDLQTETSQAITWISSGVSELFAEYMIKSGSRWIFTPKLVGAATEGGSGVF
FT                   EVKYFKRNAYLAQSPQLYKQMCIAGDMENVFEIAPVFRAEDSNTHRHLTEFSGLDFEKT
FT                   FRNHYHEVLEFAENLLVFILTQLKERYATQIATIQKSYPKAGDFKLPKDGKALRLNYMD
FT                   GVALLKEAGVDVSEQESFENDFTTAMEKQLGQIIRDKYDTDFYVLDKFPMAVRPFYTKA
FT                   DPNDKRFSNSYDFFMRGEEIMSGAQRIHDIKELEESMRAKGLEPNQEGFEDYLNAFRQG
FT                   CPPHAGGGLGLNRIVMFFLGLPNVRLASLFPRDPQRLRP"
FT   CDS_pept        join(complement(19283..19413),complement(18929..19231),
FT                   complement(18093..18870))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184411" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670002"
FT                   /orf_name="Pc18g00070"
FT                   /product="Pc12g16550 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP94231.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR006353"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001830C32"
FT                   /db_xref="UniProtKB/TrEMBL:B6GZ25"
FT                   /transl_table=1
FT                   /translation="MRSQTLWRSFGLLQRHTLSPRKNISRAIHAPSSRPVPNFAFAFDI
FT                   DGVLLRASKPIPGAADSLALLKEQGIPFLLLTNGGGKHETERVAEISEKLGIPLDATDI
FT                   VQSHSPFAELVKGWDETSALEHKCVLVAGGDGDNCRRVAEQYGFKNVVTPADILMANPT
FT                   VWPFSKNFGDYYRTFARPLPSPINLNDPSKTLKIDAIFVFNDPRDWALDTQVIMDLLLS
FT                   SQGRMGTLSEKNGRIDLPNHGYQQDGQPHLYFSNPDLWWAAAYPLPRLGQGAFREALEG
FT                   VWAATTGGPSKGIELKKTVIGKPHQPTYEFAERQLLRNRLRTFGSSAENTPLERVYMVG
FT                   DNPESDIRGANSYRSEIGSSWHSILVRTGVYSGGEPTWIPQTIADNVHKGVQWALKSSN
FT                   WPAP"
FT   CDS_pept        join(complement(20762..21147),complement(19930..20701))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184413" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822773"
FT                   /orf_name="Pc18g00080"
FT                   /product="Pc12g16560 protein"
FT                   /protein_id="CAP94232.1"
FT                   /db_xref="UniParc:UPI0001830C33"
FT                   /db_xref="UniProtKB/TrEMBL:B6GZ26"
FT                   /transl_table=1
FT                   /translation="MTSRQYVHLPTEVLILIAKFIFDDWPTEYPRSQVTLQRFCLVSRQ
FT                   WYSVGIEFLYYRPQLGGGNSFSLFTNTVCPPIRSRKRNVDLGSLVHDLDLSVLVHHSSN
FT                   SLTARLLGRVKKNLKSFAAPRISFSINSLAPLAKCKELSYLYLGLVAEPIPFDALKKAI
FT                   TSLDKLEILELSPSMFITDDGSSEDWPSSLKYLRVGGRFDVEKMSSFRWPPNLVGLTFR
FT                   GCEDLNTSVVEEILMNEQLRTTLTELTFHRLNRKMFEDGPSEILSALIALKYLRIPVDL
FT                   LDDLCILPSFYQAPPMSIRELELTAPYDENFSTEIDTDGLCEVLKTNLSRACYLGISPA
FT                   CLNIIPETSHAKIDKWVWKNIDKCPEEELDSLFDMGLNVMDQEPL"
FT   CDS_pept        join(21734..21760,21880..22023,22139..22438)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975986"
FT                   /orf_name="Pc18g00090"
FT                   /product="Putative uncharacterized protein Pc12g16570 "
FT                   /protein_id="CAP94233.1"
FT                   /db_xref="UniParc:UPI0001830C34"
FT                   /db_xref="UniProtKB/TrEMBL:B6GZC1"
FT                   /transl_table=1
FT                   /translation="MPLNPTPQLAVHHGTKLSRSSSAKQPCSSLIVPASFISAKCRYTL
FT                   NAVCPAPSALSEGRTITLTIQSLNCIAHALALVDGEPVSYRPLERAAKSSEKFLGKFSE
FT                   DSRVEGMSRAKNESSKPIIVGKFRCVAVSDQVRDRQCRQHQHASDPPLTQAE"
FT   CDS_pept        22993..24654
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159128" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127025"
FT                   /orf_name="Pc18g00100"
FT                   /product="Pc12g16580 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94234.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001830C35"
FT                   /db_xref="UniProtKB/TrEMBL:B6GZC2"
FT                   /transl_table=1
FT                   /translation="MSTNKRKRARKACNPCHQRKRKCDGGHPCGMCSTYQYQCRYDDDI
FT                   TGTSGPPVAKRAVLEGRNMQIRPPVENESSPSTGKSAGIFEEHKSRYTGASAAMAFPHV
FT                   LGLALGSDNPPKINSTAYNFGIRPEEASNTYGLLGSLISEDNLAFYSDVYFSAMGSIGD
FT                   VIDPRIYAQRCREYYHGPGSPPVAFGAIAAGVAAVGSFLSPVRYSRESDLLQYAKAILD
FT                   DPASMRMLSVDHIIAWGMRLFYLRATTRPSSAWVASCTLMHLCEVVGLHKEENIQRIAS
FT                   VAGAAALGYDADRLRRIFWILWAAHQMLSYECDRSAVTFEAVTTQAIITIPGSVADQFV
FT                   QIIQIIPSPNSPFQLDSQPPSPREELSERLTALSKLHFTHPFLVATKADLAFCFYRRIY
FT                   QLKAGITDETIKVVIDSGRDGLEAAEQLASQGRLLWNVIGSVFQYACILLAIDTPASSA
FT                   HIPTAFKRLENLARATDTALTRQALSIARHLLGLNIAKKRKELLQLEAVEAGYEAFQTP
FT                   LEPEPNTAVPDLVGWGVDWDQFLVEPYLSMFPDIQM"
FT   CDS_pept        join(25018..25083,25138..26082)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183783" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822774"
FT                   /orf_name="Pc18g00110"
FT                   /product="Pc18g00110 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP94235.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018317FA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBM6"
FT                   /transl_table=1
FT                   /translation="MSYAKDQPAGITNTIGKVAIVGAGGTVGSFLAAALLKTGKHTVTA
FT                   LSRKDSSNKLPEGVIVAPVDYSDEASIVDALKGQQFFIITVAPTAPRDTHSKLVQAAAK
FT                   AGVPYIMPNGYAGDIEHVKFGQDVMLGPVAQANRDEIEKLGMKWITVCCGFWYDYSLAG
FT                   GSARFGFDFDKKELTIYGDGNTKTSVSTLAQVGRAVATMLSLKVFPDDENDKSLTLSSW
FT                   LNKPVYLKSFVVSQNEMFESVKRVTGTTDADWTVTQEDAHKRYIDGLGMVKTGNMAGFA
FT                   KLLYARAFFPEDAGNHSDKAQNELLGLPEEKLDEATQVGVDMVKALQSRAERMAS"
FT   CDS_pept        join(26790..26989,27101..27819,27973..28237,28488..29594,
FT                   29659..29710)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076712" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670003"
FT                   /orf_name="Pc18g00120"
FT                   /product="Pc18g00120 protein"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAP94236.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI00018317FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBM7"
FT                   /transl_table=1
FT                   /translation="MPNPSSKRPRISYDEDDNGESSTASYERPRQDPLYGQKSAFPGLD
FT                   DGGDELQYDDPEDGLEYLRMVRSEASSLPVLFSATTPTTDPSNMVSNTQRDLKPLGPNN
FT                   PPLPAGFYEDEAYIAPVEDLNKGKAADSPSKLDELYPDAQRSYNNLLRHRFILLRSTLR
FT                   CSPPAGAIDTLDNDHPISLPRRASSAHKTWRRLLVTVDPRMVQLASMDMESVLEVLEIL
FT                   ARLISDVVRGDDTQRVRRIGAWAWGLLGKCREVGQLSTQEVGVVRGLAKRAAKILRKVQ
FT                   ELEDDDYEEDVDDSVTDTPKGEVKQIRSEEESKPEELPEAAEAHGSSMAGASLEESDLE
FT                   AAKARLQARLQNNSDSVETPAISNDIDESDWSIQTHALLDMIITVVGEFFGQRDLFISI
FT                   LTKMAPTVEITIPNTTLSNTSPPYTVYHITLRLPLRSFTVPKRYSDFSTFHSTLISQTN
FT                   APPPAPLPSKTWFSKTVSNERLREDRRRGLENYLRAINESDDGRWRTSPAWRAFLNLPT
FT                   AVASTGTGSTTTSTRLHAAITDPAATNAPITDPTLWLDYYRDMKNHLHDARLQLSRRDQ
FT                   ETTPQKQHESSAHAKGSLVRAGTMIATLDDGLKNLGRGDKSSESQASSSLGGGEIRRRK
FT                   DLLINARKEKDGLEDLLHAMATKSRLDHTVASMQDKGALINGNGAGDASSGRRTPARTG
FT                   RVLGKETEQTRELDNDGVLQLQRQMMQSQDDNVDELRKIIIRQRELGTQINEELEVQND
FT                   MLRLADEEADILKSKMDIGRKRIGKIS"
FT   CDS_pept        join(complement(33038..33209),complement(32960..32979),
FT                   complement(32868..32904),complement(32751..32818),
FT                   complement(31824..32701))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160555" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127026"
FT                   /orf_name="Pc18g00130"
FT                   /product="Pc18g00130 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94237.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI00018317FC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBM8"
FT                   /transl_table=1
FT                   /translation="MVHPRMRTCGALDAYAHVDASHALGREYPDVQLSEIIADDSKIKD
FT                   MAITGKTMGANDXNTASERGVVVLRRQDIEIQELKYLVQRMGELTGKPDEGKLHVNPIH
FT                   PEVNVCLGNDHVLSDPEVYVVSSEHNRDKFDDYLNTKHKQFASRGWHADTSYENIPSDY
FT                   IAMKMVKTPRTGGDTLFASCYGAYDRLSEPWQRLADSLSCTSIDICKRKKANSQHNEAT
FT                   HHEPDIMPLADKGIKLWLGPRGHPDNVGGSFQARHPLVVTNPVTGWKALWGFSPISMRA
FT                   KGKIDGVTDYEHELMKAYFLKLITDNHDLQYRHRWEPDDVVIWDKYAISGTIHFFDQRL
FT                   TETYTVGLSSTLALSMFDLPA"
FT   CDS_pept        join(complement(35533..35821),complement(35294..35449),
FT                   complement(34914..35236),complement(34766..34835),
FT                   complement(34568..34701))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000219459" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127027"
FT                   /orf_name="Pc18g00140"
FT                   /product="Pc18g00140 protein"
FT                   /protein_id="CAP94238.1"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="UniParc:UPI00018317FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBM9"
FT                   /transl_table=1
FT                   /translation="MAQSPFDTPFDELPNPKQVWLGKPGSYEEGLGKLAILTPEVVAAA
FT                   SASEIRCGRRVTMGWEMTKLDFPNLNRQPCHHQIVPLLGGVAFDDIYTMNPQQSSQWDG
FT                   LRHFSQTVPGQTERVFYGGTTSEEINDRQNDRIGLQHWAREGIAGRGVLIDYATWAEKK
FT                   GIKYTTFSTHQVRFADILEIAEENNITFKKGDILFVRVGVTKEWDTSMTDAEKQAYSDN
FT                   PSPEHAGVEATTEVLRWLWDTGFAAIASDAISWEVYPPQSPDIFLHEYVLAGWGMPIGE
FT                   LFDLEALARTCQELQRWSFFVASVPLNMPGGVSSPPNVMAIF"
FT   CDS_pept        join(36425..36496,36551..36825,36876..37422,37472..37559,
FT                   37617..37815,37874..37974,38025..38123,38190..38425)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941211"
FT                   /orf_name="Pc18g00150"
FT                   /product="Pc18g00150 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94239.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018317FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBN0"
FT                   /transl_table=1
FT                   /translation="MGRFGSQTSSYNRLVIVFVAIGSMTYGYCSSIISSTIGQPGWYAY
FT                   FGLPAEGEPGYASTTTPAISTANGVFSAGGAVGTLFIMWSCDFFGRKANIQFGAFFSLF
FT                   GGALQAGSNSLAMFQAGRFICGLGIGILVTVCPMYLSEMSSALRRGWLVGHHAIFLVFG
FT                   YMLSGWVGYACYYATGPLSGFGWRFPLALQCLPALVLLLGSPWLPRSPRWLISKGKFDE
FT                   AQHVLERLRESPDDPNNLVAKEEFFQTKEQIKLEAERLATYGSVWKAVFTRKTYRKRMA
FT                   IGFLTQWGAEFGGPLIINNYAVLLYTNLGMEGGMPLLLSAVWLTTAGVIYNPLGAWLHD
FT                   KVNSRRAMYIIGFVGIIISTSCLAAMTSEYAGTTNKVGNGFGIFFIYLYLAFQGTFCDT
FT                   TMYLYVSEIFPTEIRPIGMGFSLFGQFASTLILLQTAPMGFGNVGWKYYLVIICWSAFF
FT                   IPVIYLFFPETAGLTLEEIAQNFGEEVAVNLTGATDEEKARLDQQLATGGNLQSSVSSE
FT                   LENGTKRSSTNEAEQNVPKAG"
FT   sig_peptide     join(36425..36496,36551..36559)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBN0 "
FT   mat_peptide     join(36560..36825,36876..37422,37472..37559,37617..37815,
FT                   37874..37974,38025..38123,38190..38422)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBN0 "
FT   CDS_pept        join(38734..38898,39065..39409,39464..39607)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076713" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941212"
FT                   /orf_name="Pc18g00160"
FT                   /product="Pc18g00160 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP94240.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI00018317FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBN1"
FT                   /transl_table=1
FT                   /translation="MGPSSKVTLFPWDPNSDLHLKRLVSQRVECSWHQEEVEPKWKKQQ
FT                   LKGEKCIYWIEDEMLQDTATTINAVPRQPTKESFIPIGHISLDSKNPDAEHIELDLPAE
FT                   NVFWIKSFYVRQSIQGQGIGRAAMDEVEAMAVREPLLAKTLMLDTVQKDDQKREEFANA
FT                   TYGGVPKSTNEEWYARRGYQLIKTVQNYYHVEDKNGKVWDTKTVFMRKDIAGGQ"
FT   CDS_pept        join(40114..40178,40247..40315,40368..40989,41050..41092,
FT                   41150..41573,41635..41917,41975..42337)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198263" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822775"
FT                   /orf_name="Pc18g00170"
FT                   /product="Pc18g00170 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94241.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831800"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBN2"
FT                   /transl_table=1
FT                   /translation="MALYSRVNRVEDPNSDVTMTGRRRPSDSVNPAIVSSRLTSQSTSN
FT                   ASSLSSGLLGNGCLFAPLEPPSALPGYLGSTSYSAVLTEHRSEISFEAEESTDSSTGLV
FT                   VEPDRLQSGVDVLRFLYNLTVFDMLIARYYVRTLNVIVPKIVMDELLRSVRQIFAGFSG
FT                   DPTAQLQELANQTFQNTSRPMRTHKSMSVEEYCSSFTGRNLRWEALGSIFALCGMQLVI
FT                   TPDNDPDVMQSSDDPRTKDQLLEQVTVISTYNDTMLRTQQYGDSSYQAWRRLGDLVSTI
FT                   YAAGLHLETNGAENCPFFLRQWRRRCFIGAFYMDKMIATFVGRPPLMNGRFCTLAAPLD
FT                   LSDEVLVAGGDVLSKAISALDSAGWNSEGKLHPVTSPRLRYHLAIIREETLEVVLGTRE
FT                   QHNLIQKSEEIQAKSRAIWQSAPDQLRYDRRSNPHLNDGCFTIVYFYLDYLYTCFLLYR
FT                   AVAKHTNTGQAELCDISRRVLAIVIQVNSFRTPMVDLDRHFSWIVLTYGVPSASVLLLE
FT                   LLRQSHEPAPHAVPLPRAELIRNLSVFISFLSWVAGPGHGNHHTCKEAEKKLSRILDQL
FT                   LDPEPVQQHVVDDVTTGLDNFLNWSNYNTIWDFNTDYMPLTEGFAA"
FT   CDS_pept        join(complement(42999..43090),complement(42669..42845),
FT                   complement(42434..42641))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198274" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941213"
FT                   /orf_name="Pc18g00180"
FT                   /product="Pc18g00180 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP94242.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0001831801"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBN3"
FT                   /transl_table=1
FT                   /translation="MAEDTKLKKNHMAIVLGIGLGVVLLIVLSLILTILVNRRDRRSFL
FT                   GSKKNSSERLRKLDKVSPTCTLEKWWTATKGNLGLSEAVDGQFVCAVANLLLSAVCLEQ
FT                   VDRTQEIRELRCLHVFHRECLEKWFLGDHFNCPLCHRAYYVADTPPRNDYLWMV"
FT   CDS_pept        join(45731..45903,45972..46083,46136..47551)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000198252" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941214"
FT                   /orf_name="Pc18g00190"
FT                   /product="Pc18g00190 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94243.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniParc:UPI0001831802"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBN4"
FT                   /transl_table=1
FT                   /translation="MSDPEPSVAISSSPSLPATDSNPLNYAFLVHSQKTLTQNLPPRVD
FT                   NKLLARQKRRRTSPEDHAVLESEYQQNSKPDKAARTSIVNRVSLGEKEVQIWFQNRRQN
FT                   DRRKSKPLQPHELLAPRSGMLDSSGQPSSDDNASTEPGSSSGAEQFDIHDHREEMASKP
FT                   WHGGLLQFSDDSDPVTEDKDEHELPQSTQTSVATEAAGETPPTTQEEFSQMSNGHSEDS
FT                   LLQVPKRKRSVSDIRGEGEYEKQAATTQNIQVTPTKSPPSLRLSMSFDGKALVRKEGEL
FT                   TPSPPKGRNALRIAMSSDGKAVIRGENEPSPSKNRVAMFSVRRTKMSSLRRSSSAVFPA
FT                   TPRAGVAEKDRAFGRSRDPRNWESFCDTDARSALSTPTSGPNGSPGLFQSRSQRSLPRS
FT                   ASGRHSLAVHGDPNTPISQSMGEKRRKLARAVSSLGRLETGRNKANMNPSKLSKPLFSK
FT                   SGKPDLEQDPGDSDKENWVPGTRSTNIRRRNTSHIPRPVLRDANRNRGLGISTNSKRNR
FT                   PLQAGSQGKAPPELSAEVSAFMAGGSGDTQEDDLDCVQGLLSLSQGAWR"
FT   CDS_pept        join(complement(49749..49874),complement(49655..49692),
FT                   complement(49203..49594),complement(48176..49140))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198241" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941215"
FT                   /orf_name="Pc18g00200"
FT                   /product="Pc18g00200 protein"
FT                   /protein_id="CAP94244.1"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI0001831803"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBN5"
FT                   /transl_table=1
FT                   /translation="MAPSPHIGIVGAGISGLRCADILIQNGARVTILEARDRIGGRVHQ
FT                   STVGDHVVDLGPNWIHGAGENPISTIAEETGTVIYDPEGGRHVTYSRDGHPITDEVGTK
FT                   VQDLVWTTIAEAFKYSSDHGESIPVERSLFDFFHERIQQTNFSDEEKQLCLDACRLWGA
FT                   YVGDQVDRQSLKFFRLEECVDGSNFIVASTYKRILEHIAKPATTKANICLNEPVTSIKA
FT                   PPRNNQSQTKHQVTVTTATGTDYVFDEVVITCPLGWLKQNTTAFSPSLPPRLEQAIQNI
FT                   SYGRLEKVYVSFPRAFWHTNTTSTSPKTRIRNTVFAQFLEPSYTPHPNIEWNQECLSLA
FT                   SLPEPHAHPTLLFYTYGDGGAEIINRLSGMAPSSLEYRESLIQTLQPFYSRLPGYSVEN
FT                   PDCVPVALLATQWQKDVFAGNGSYCNFQVGVQEADVDVEVIRSGDGVGPDRGLWFAGEH
FT                   TAPFVALGTTTGAFWSGERVARLVCRGVGIGDGGVEVKDDSLPSEEVS"
FT   CDS_pept        complement(50589..51461)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198230" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941216"
FT                   /orf_name="Pc18g00210"
FT                   /product="Pc18g00210 protein"
FT                   /protein_id="CAP94245.1"
FT                   /db_xref="UniParc:UPI0001831804"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBN6"
FT                   /transl_table=1
FT                   /translation="MESREEMRPHETEPNGVAPEGKEDVMIAFSPAPPRTRSPLARSHL
FT                   RSRSLAGIPGMPSMTRAYSSPGLDSQGRYIFVNGRGAPVDAKRYPLQMRSDDYIDRMGS
FT                   LNISETISENAELETTRKSPSQPTSSPILMPQTFPRIGRLRPTSPLPFQAPASPSLHSS
FT                   PILGSKYNESYPSHSGSVSSISVPSTPTSLRSRSPSISSLETIPDIPDAENEALEEDRI
FT                   AELKAAADAADAATIASRRRGASDAPNSFTTMRGGSGGYAARSDKRKRWSVCGAERRQD
FT                   LDLETIWED"
FT   CDS_pept        join(complement(54219..54344),complement(52330..54168))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166180" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127028"
FT                   /orf_name="Pc18g00220"
FT                   /product="Pc18g00220 protein"
FT                   /protein_id="CAP94246.1"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="UniParc:UPI0001831805"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBN7"
FT                   /transl_table=1
FT                   /translation="MAYGYEHQGPSAAPKQFVLCFDGTGNKFAGDESDSNVLKIFRMLD
FT                   RSKSHQYHYYQPGIGTYVTSKSLSSHGRIQRIKSAYQKAKDSAVGSSFDEHVMGGYKFL
FT                   MRYYSPGDEIFFIGFSRGSYIARFLAEMLDYIGLLEAGNEELVRFAWKTFAKWQQRSYD
FT                   SEEDRIEKEKLFAYMKAFRETFSRPISRIRFMGLFDTVNSVPRFESAWMQRTKFPYTAR
FT                   SSAKVIRHAVGIDERRAKFRQDLISEVRPKEKKRHHHHRPHIPKNHLHLFHHDNKEKPQ
FT                   DDLPDNVPAIQVNGTPEEEQHEGEKAEPESDVPTHGPSTGETYYHTGRRASHQASQPTS
FT                   RASSENRRVPRDTYRARSPRRRLAVPDDSRSVRSAESCHSMHSNTLSVQIPVMEADSSD
FT                   EDEDDQDIHEVWFPGCHADIGGGWKLSDGETWALSHAPLVWMTQEAQKAGLELDERKMK
FT                   QFQCLEEFDGDYTPIREEINIRRPSRCVEPHADNDDAFRSMPDDKERSAASRDFWHALH
FT                   TSSTKGLIHDCLMFNQGIPAMSVITWRIMEWLPFRRMDLQPDGSWKPISWPLPRGEVRD
FT                   VPDNAEIHVSAIRRMQADPKYRPGNVIVGGGGRGIRVAPEECGMGDWVVLKHEGDLVRE
FT                   TYVRKKISKCKEGEEKTKP"
FT   CDS_pept        join(54457..54581,54739..54812,54878..55069,55144..55217)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127029"
FT                   /orf_name="Pc18g00230"
FT                   /product="Putative uncharacterized protein Pc18g00230 "
FT                   /protein_id="CAP94247.1"
FT                   /db_xref="UniParc:UPI0001831806"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBN8"
FT                   /transl_table=1
FT                   /translation="MTLPCSWTQLVLHESALYAGPDTEGGWQDDNKQSTPLVDHCRKPY
FT                   FVLTGVYNIFYPMKPYFVPTGGLNLTRELLHEGGGLRGPDLGSVNLEFSQDGAEQRPKR
FT                   DVRIFTTPYTSYHWPYEDLKGEDARWWGVPTERVLRRIGSVLSDRIYIWR"
FT   CDS_pept        join(57109..57614,57674..57915,57975..60583)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190920" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941217"
FT                   /orf_name="Pc18g00240"
FT                   /product="Pc18g00240 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /function="peroxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="CAP94248.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002007"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019791"
FT                   /db_xref="UniParc:UPI00018318DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBN9"
FT                   /transl_table=1
FT                   /translation="MLKRFSTQFKRSKDSKDPKESNGDAEPKSTDKSSKRASKVSPSPK
FT                   STHKEENHVVKRSEVVAVFDKYAQAIHASQEPLPNQTSDGAYLKHDKSSGLINDIKALG
FT                   FRDVGTVKDLIASKASGGIIDDKTYLMERIIQMVADLPGNSKNRTDLTGLFLDDLWNSI
FT                   PHPPLSYMGDDYKYRSADGSNNNPTLPWLGAANTPYCRTIAPLTIQPSGLPDAGLIFDT
FT                   LYARQEFTPHPNKVSSVFFDWASLIIHDIFQTDYSQQHLNQTSAYLDLSILYGDVKEQQ
FT                   DKIRSHENGKLKPDCFSEGRLQALPPACGVLLVMLNRFHNHIVTQLAAINENGRFSAPR
FT                   PGLSEEETKAAWAKRDEDLFQTGRLITCGLYINITLYDYLRTIVNLNRTNSTWCLDPRA
FT                   QAEKADATPSGLGNQCSVEFNLAYRWHSTISQGDEKWIEQIYYDLMGKPAEQVSMPELL
FT                   MGMKKVKGMLEADPAKRTFGHLQRNADGYFDDGELVNILTRATEDVASSFGPRNVPKAM
FT                   RSIEILGIEASRRWNVGSLNEFRKHFGLKPYETFEDVNSNPEIANTLRHLYEHPDYIEL
FT                   YPGIVSEEAKEPMIPGVGIAPTYTISRAVLSDAVALVRGDRHYTIDYNPRNLTNWGYNE
FT                   CRYDLNINQGCIFYKLATRAFPNHYKPDSIYAHYPMTIPSENRNIMKDLGREQDYSWDK
FT                   PAFMEPRVNLTSHQNAKLLLENQKDFRPSWARSMSELFGKGEFDTKQREAIGKALNTEE
FT                   FPKLVKTFYEDITERLIAEKGGQLGKINQIDITRDVGNLAHVHFASTIFGVPLKTEDNP
FT                   RGLFTEHEMYMILSTIFSALFFDVDAPRSYALNRAASAVSNQLGQVVEATVKADTNSGL
FT                   FAGIMDNFRPHDNALREFGTEAIRRMKEAGSSASDITWSAIVPTIVGLVPNQAQVFTQI
FT                   IEFYTAPENKAHLAEINRFAKTDSAESDEKLYRYCLEAVRLNGTFGAFREAKETVTVEE
FT                   DGKTYTVQPGQQVFASFDQANHDPSVFPEPNEVNLDRPLDSYINHGQGPTTGFGEQVTK
FT                   IALIAMLRVVGRLQGLRRAPGAQGQLKKIPQEGGYQVYLRGDGTAYCPFPMSLKLHWDG
FT                   PFEQKKKVTSS"
FT   CDS_pept        complement(61013..61846)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127030"
FT                   /orf_name="Pc18g00250"
FT                   /product="Pc18g00250 protein"
FT                   /protein_id="CAP94249.1"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniParc:UPI00018318DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBP0"
FT                   /transl_table=1
FT                   /translation="MSDQIEDVEIRTQQALTAYNQSDKPNLAKLAREFGITRGRLRSRV
FT                   AGHQPHTTRIQPNKALNPMQEKALVSWVYALRDSHTLNTPELIERSANRLLKDAGSDRQ
FT                   VGRNWVYRFIKRLPPDIPFVSLKPAEKARLESESEGAPPRIFTPSPPPDISSSATNSPP
FT                   DTVARVNKLNAKLIKDLENLENLNQQVKQHIQRSMDANSYLSQQIDLVKESLKKSQFHE
FT                   EARNEPRNRKSILGASNSVLSPTRANRMITKRRDIDSKKRQRQQAKHAKELDDEA"
FT   CDS_pept        join(62050..62091,62188..62760)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198229" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941218"
FT                   /orf_name="Pc18g00260"
FT                   /product="Pc18g00260 protein"
FT                   /function="transferase activity"
FT                   /protein_id="CAP94250.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniParc:UPI00018318DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBP1"
FT                   /transl_table=1
FT                   /translation="MPPPKTAKGEYIETDTGNKISRRSQIHGTQHIILGGKTVIQAEAV
FT                   IRGDLFRTATLPTDPNNASAAAAPNPSTPSVAITVGRYSYISKSAILRPPSRLHRGIHS
FT                   FYPLKIGDHVFVGEGAVVEAASLGNHVHVGKGAAVGSMAIIKDYAYVLDGAVVPPGMVV
FT                   PSWCIVGGRPARIVGEVGEGYGVEGAEGGMARERYRVVGRT"
FT   CDS_pept        join(complement(65211..65315),complement(64736..65148),
FT                   complement(64405..64680),complement(63881..64345),
FT                   complement(63711..63820),complement(62944..63659))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198208" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670004"
FT                   /orf_name="Pc18g00270"
FT                   /product="Pc18g00270 protein"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP94251.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI00018318DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBP2"
FT                   /transl_table=1
FT                   /translation="MPGEEHSFERHASVTQQRRLSLQYERNAWIGPPSDSIYAGISSDF
FT                   QDHFTPTIAIAIRDATYLLDFIEKQFPNKVSAEEATDFVISELQKYSENHLEKIVGISM
FT                   PEHVAKHCPRLCPRLWAELDIVPLVLSNVTLIDRVSVEQPTEDSASKSGGWDEKTIDEQ
FT                   AESMARKGVRLFGPENTPLLQVGFLGLVEVDTAYHVRLADLSDFQSTVSDRTWSASQHY
FT                   ATDLKERNVKIAFFSATPQGGGVALMRHALLRFSNCLGTNIKWYVPKPRPEVFRVTKTN
FT                   HNILQGVARPDERLTPENKKLLQEWIEENARRYWSRPGGPLLAPSEGGADVVVVDDPQM
FT                   PGLIPIAKKLAPDRPVIFRSHIHIRSDLVAIPKSPQAEAWEYLWDNIKYADLFISHPVS
FT                   AFVPRNVPPEIVGYMPAATDWLDGLNKSMRDWDIAHYGRIFNSGCRNADMPTIQWPEDS
FT                   YIVQIARFDPSKGIEDVLVSYEKFHNKLMAEAPNTVPPKLLICGHGSVDDPDGGHIYDE
FT                   IIEYLETKVPHIRHLICAMRVRPSDQVLNAILSKATIALQLSTSEGFEVKVSEAIHKGK
FT                   PVIATRAGGIPLQVTHGKNGFLVDIGDTDAVAQRLFELWTDHDLYARMSEYGIHNVSDE
FT                   VSTVGNALDWLYLASKLSRSEPVRPNERWIDDMAFEELGVPNKEDELRLKRAVKVEQMG
FT                   "
FT   CDS_pept        join(66128..66221,66280..66585,66641..66753,66817..66858)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163691" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941219"
FT                   /orf_name="Pc18g00280"
FT                   /product="Pc18g00280 protein"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP94252.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006688"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI00018318DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBP3"
FT                   /transl_table=1
FT                   /translation="MGVQVSKMMGKIFGTKEMRILMLGLDAAGKTTILYKLKLSNQDVT
FT                   TIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVVDSSDTARVEEA
FT                   RSELHKIINDREMKDALLLVFANKQDIPGHLSPEEITQQLQLTKLKDKLWYVAPSVATD
FT                   GTGIFEGLAWLSNNVKTQPQK"
FT   CDS_pept        join(67571..67619,67685..67842)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198197" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127031"
FT                   /orf_name="Pc18g00290"
FT                   /product="Pc18g00290 protein"
FT                   /protein_id="CAP94253.1"
FT                   /db_xref="InterPro:IPR021331"
FT                   /db_xref="UniParc:UPI00018318DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBP4"
FT                   /transl_table=1
FT                   /translation="MFRYKEGDKVKYTPVGGPESRTSRSVGVVRDCMGGRNSIDDEPRY
FT                   KVENIHTHKASSVKEGNIEGPAE"
FT   CDS_pept        68437..68868
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670005"
FT                   /orf_name="Pc18g00300"
FT                   /product="Putative uncharacterized protein Pc18g00300 "
FT                   /protein_id="CAP94254.1"
FT                   /db_xref="UniParc:UPI00018318E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBP5"
FT                   /transl_table=1
FT                   /translation="MKPPAENPHLYLYLVQEEQSPGEPNHWALFLADENEPEYGYVYQV
FT                   TGDAENMKYDPSTDKINIVDTGLTSNVYCLAVVSEDQARAAKLVKWAAEQEPPPQAENR
FT                   KSVTENCQGWTVRVIARLVKEKIVMAQKLEVAKSLMQAV"
FT   CDS_pept        join(complement(70290..70509),complement(69826..70242),
FT                   complement(69195..69766))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000267327" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941220"
FT                   /orf_name="Pc18g00310"
FT                   /product="Pc18g00310 protein"
FT                   /function="5-methyltetrahydropteroyltriglutamate-
FT                   homocysteine S-methyltransferase activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /protein_id="CAP94255.1"
FT                   /db_xref="GO:0003871"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="UniParc:UPI00018318E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBP6"
FT                   /transl_table=1
FT                   /translation="MTPQLHQRPPFRAEHLGSLLRPDQLLETKFAFEAGKIPESQLTAS
FT                   EDKEINAIVETQKKIGYAAMSDGEYRRHMFWGTFFPGLDGFEEVNNVDVDDFRPYAPDI
FT                   AAFLEAGHKPGESVICTGKIKHVGSTYINQFKYLASQVPANEVGNLKITLAAPNWYHLR
FT                   YREGKAYPKSVYTNDEDYFGDIAKAYQAELQILYEAGCRNVQFDDPNLAYFCSDKFLTG
FT                   FKQDPLNVYSADTMFEKYIKQYNDCFADLPADMHVGVHLCRGNFVGSRHFSEGGYDRIA
FT                   IKLFQELNVHTYYLEYDTPRAGGFEPLKFLPTHKNVILGVVTSKFANLEDKEEMKKRVI
FT                   DAAKFIAEGNNISLDAALNQVGVSPQCGFASHREGNAIDWDGMINKLQLVRDIANDIWP
FT                   NQA"
FT   CDS_pept        join(71410..72475,72751..73022,73081..73851)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234547" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941221"
FT                   /orf_name="Pc18g00320"
FT                   /product="Pc18g00320 protein"
FT                   /protein_id="CAP94256.1"
FT                   /db_xref="UniParc:UPI00018318E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBP7"
FT                   /transl_table=1
FT                   /translation="MSVPASPLELLPNELLDQIISYLSTEPPSFGQLHHAPSLQLTQSP
FT                   TKDLKHLQLCSRRLFQLVRPQLFTHVRLNLHDEPDFYSFMVKSDLSPYVTSLVAIADQT
FT                   PDGQVDPFWWRRVLRYLDPRRVLVIGPPVFIGNTLDTPINDGHHWAFDMPLQILLLERE
FT                   CKPRNPSELPDLETCTSLLASRPWTSMTFNESSSLKAYNHYEYFLSCVPSVLADWGTNG
FT                   IRGSTRTLQRPIDLPALLRRLTYFSYTAVFPFYNHSQLVLDAVVRMRRLQRLDVQLAPT
FT                   QDNHITELEQRGSMDPNDPWMELATSYSLVGYTVNNLPCLKEFRCGDLHVEPMRQDLLA
FT                   ILDEAIGNAGWVHNGHEASCTEMARASNVYSAEPAFPVLADSLLRQTESTENAAPHSND
FT                   TKNHWDLKNDWKQGIQSSNEAVFRCGVVLGISRLRMRTNESNEYIGQIPRYLLINQLRS
FT                   IHPSSEPSAFIIHPRSFEAFAPRILLEELQSSSHDQPGLSRDDAIRKLDCVQLLPVHNF
FT                   TNAAQAIGKVSEALHEIQENREQQIKPTEASPSIRNPIVLIVAGLDTLTEGVIRASNPA
FT                   RGAAVLTATLRTLTRLSRVHASHLSIILVNTNGLGTTNPEWDKNQSLTGNTTTHGHGAA
FT                   RQPLEDGIHSIFHSDIPSLFPTLLMKTLDQAIDTHLLLSDLRGAQIVEVIKDRVGTSLG
FT                   KWGIWNEQ"
FT   CDS_pept        join(complement(75180..76767),complement(74166..75124))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198160" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941222"
FT                   /orf_name="Pc18g00330"
FT                   /product="Pc18g00330 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP94257.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI00018318E3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBP8"
FT                   /transl_table=1
FT                   /translation="MAEMEATASANHVNGSAGTKSTTNPYETNPDRIPSDDPFLSQSAQ
FT                   YGRYTPRVDDFTPRFMNWYRSDPAVNEFWEKVAQQYCTPEYSLNLSGPREAFAAGSIII
FT                   RVDRELADGAAAERYSSANANELLAAQKAEDPLREIGVAVPVVYFCGTIEGRNVTIESR
FT                   IAGVSLEVAWRYLDTEQIEVFKNQCRQILQRLGTIDPPPDEPSYVCREFNSQNPPSVEP
FT                   RERDILFTDKTKQELLSLTHNNFIPKNIIVQDNRVVGLAGWRQCGYFGTIRAKKVHRLF
FT                   RDLEPAPQDGVASSGKSVTWTDLYDDAYDRSKGPPLVANQDTPLPSVKTEPTSSTLDRF
FT                   PASDDLDTNSLGLDGTGDYATSKTVANLKHGLTSRASSSDRSSPANSIKPANKKPATST
FT                   AKKGAAKKPAAKKRKVNDPDADSVDGRRSNTPVSRASKTPAKKQNSASIAGSPPPEEKK
FT                   KPQKKKKAPKQTTAQENDDSDSFDENALFCICRRPDNHTWMIGCDGDCDDWYHGKCVNI
FT                   DPRDADLIERYICPNCASEGKGCTTWKPMCRLLECRKPARVKTKPPSKYCCDDHGREFM
FT                   RRQTRQLKQRAGQRNGLFEDLGSMGGILTAGDLKAAIMGVTSTQEFRKLGDRIISPPPQ
FT                   VDEKEKAGVKIESKPQSGRWLEVDVHANGMKYSPDEIARIEKLRTQRDELLHRKEMLAA
FT                   RTTFVSLLKPRAKGVVEKLKQHEPKGGWKDICGFDSRLSWSDEEFDEWRLSDAGKKALA
FT                   EGTAEALAVGSSADTDADGDTAMNGDGDDDIAYWTRGVCTKKRCERHKQWVKVQQQDIL
FT                   FEEETAEQDLAKCEEEARSVVERGVMRQWVETDNQP"
FT   CDS_pept        join(complement(80926..81058),complement(80718..80859),
FT                   complement(78530..80666))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127032"
FT                   /orf_name="Pc18g00340"
FT                   /product="Pc18g00340 protein"
FT                   /function="binding"
FT                   /protein_id="CAP94258.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00018318E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBS6"
FT                   /transl_table=1
FT                   /translation="MSRVPITQHISGVNAESGGKVFAGYMDNSNNSEYYGGTHYHQHPE
FT                   PRPKPLSTVPFPHDPDFVSRDDLLAQIHERSSTPGSRIVLVGLGGVGKSRLAIEYCHRV
FT                   RLQSPDTWVFWVHASNAARCEESLRSLADRAKIPGRQDRNSNIFQLFGNWLQDGKIGKW
FT                   ILVLDNVDDDELLRKPLTTRIEAQANTPGHAPTQPPLRYLFESSNGSIIITSRNRGVAL
FT                   QLAGHKKHLIDIQPMNTAEALDLIRKKLDDCAEGEELVQLVEELEFMPLAIVQAASYIA
FT                   HRAPRCSALQYLEKLRQGDREARKLLNHEGKHIHRDWEAKNSILLTWQISFDHIRRIRQ
FT                   SAADLLSLMSFFDWQGIPEGLLSIDKNHEPLDFPQDVGNRSSDEDTDYSSEPDVDDDFE
FT                   SDIAILRDYSFITSGEDSMVFTMHRLVQLTVRTWLKIYGQEEEWKERFIKNLYDEFPTG
FT                   QYENWERCRSLFPHVRSAMSHRPKSQDSLRNWATLLYKGAWYATECGSIGVAEDMAAMS
FT                   RKQRMKIGGAEDEDTLDSTVMLGEAYVLEGRWEEAEQLFTQVIETSKTKLGADHPSTLT
FT                   SMAHLASTLREQGRWEEAEQLELQVVETSKTKLGADHPNTLTSIANLASTLREQGRWEE
FT                   AEQLFTHVIETSKTKLGADHPYTLTMIANLASTLWDQGRLEEAEKLELQVMETRKTKLG
FT                   ADHPSTLTMIANLASTLWDQGRLEEAEKLELQVMETRKTKLGADHPDTLTSIANLAFAW
FT                   ESIGQHAKAIDLLRTCVVNQQRVLGPSHPHTVSNGNMLLEWETAHLTMKA"
FT   CDS_pept        join(81990..82423,82485..82980)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670006"
FT                   /orf_name="Pc18g00350"
FT                   /product="Putative uncharacterized protein Pc18g00350 "
FT                   /protein_id="CAP94259.1"
FT                   /db_xref="UniParc:UPI00018318E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBS7"
FT                   /transl_table=1
FT                   /translation="MATLGVVAGSIGIASATTHSIHKLIQTIDAIKSAPTEIANLKDEL
FT                   LATEQVLLSLEDANRSSQLELLPSNSRQTLQRTNILCKDACDKFKDKLEGWTKRSDDGV
FT                   SMHWRDRIGFGILRQRSVKSLCEQLERYKSNVNSAVAITTMTSTLALRSTTNAIQKDFQ
FT                   AWENEISRQIVEIEQQNAVVQMDLDDPTEVSLSDDQEHTLLIDQLNYQRATLEASQELM
FT                   KDLLAQASQVRRGQRITGVEISEDGKAFVGKSGFENSEGDFYQEIHDVKATTGGKGIVG
FT                   AVKGLDINEFFKDSEYSPKDRRSERPLN"
FT   sig_peptide     81990..82037
FT                   /db_xref="UniProtKB/TrEMBL:B6HBS7 "
FT   mat_peptide     join(82038..82423,82485..82977)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBS7 "
FT   CDS_pept        86036..88019
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127033"
FT                   /orf_name="Pc18g00360"
FT                   /product="Pc18g00360 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94260.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018318E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBS8"
FT                   /transl_table=1
FT                   /translation="MAPYGADTTATQLVNDYADLIKDKVVLATGISPGSLGGYFIQSIA
FT                   KAGPSCLILAARNPDKAQQTANELSAAQPNVKTRILQLDLGSFKNVRQAAADVNSWDDV
FT                   PVIDVLVNNAGIMAPEYKVTDDGFESQLATNHLGPFLFTNLIMKKILASESPRVVMVSS
FT                   DGHRLNPFRFDDYNFDDGKSYNKWYAYGQSKTANMLMSISLAEKLGIKHNLLAFSLHPG
FT                   VIWTNIANHLDIETDFGGLLKNARSRCGDSRLRSVWSGSEWXSEFLFDGLNSKLRTSIA
FT                   HNGAYLIDCRIGNPLADTIKSWATSSLEAKRLWHLSEKLVGQEFAY"
FT   CDS_pept        join(88198..88305,88392..88477,88546..88567,88641..88757)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941223"
FT                   /orf_name="Pc18g00370"
FT                   /product="Putative uncharacterized protein Pc18g00370 "
FT                   /protein_id="CAP94261.1"
FT                   /db_xref="UniParc:UPI00018318E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBS9"
FT                   /transl_table=1
FT                   /translation="MQKIIIMNIAGLVPGETGSSVRLFPSRHVGTCPGPWFFPTVGLLD
FT                   LIESLLVWYSYSVPKDEALLWSVHLMPKFAAHCAFQGDDALNPKVLGKRALSHANGLSG
FT                   AKLNYM"
FT   CDS_pept        89193..93023
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175116" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822776"
FT                   /orf_name="Pc18g00380"
FT                   /product="Pc18g00380 protein"
FT                   /function="L-aminoadipate-semialdehyde dehydrogenase
FT                   activity"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="phosphopantetheine binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94262.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0004043"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI00018319AE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBT0"
FT                   /transl_table=1
FT                   /translation="MAVLDITKDLPTLFRRQVQATPDAIALEDETTTYTYTQLDQEVET
FT                   LASRLRTYGVSRDTLVGVLLPRSAHYVIACLAALRAGGAFLVLELAYPADLLADVIDDA
FT                   SPAVIITHQSEADKIKAPVPVIALDAPVAETNGHTKEPSPLPADDDLDRLAFVSYSSGT
FT                   TGKPKGIANPHRAPVLSYDLRFAVQDVQPGDRVACNVFFIWEMLRPLLRGATVVIVPDE
FT                   TSYDPAALVDLLSAKKVTETLMTPTLLATVLSRYPRFGTRVPDLRIIWLNGEVVTTDLA
FT                   HKAIKILPNARLLNCYSACETHEIACGDIRDVIDDDSIYCPVGPSLVPTHTYVLNEDGQ
FT                   EVETGTSGELFIGGPLLAREYINLPETTAKAFAPNPFDSTPGARMYRTGDLARKLPSGF
FT                   LEITGRVGAMIKLRGYSVVPAKVESDICQYLAVNQCVVTAYGDGLDRQLVAYVVPDKES
FT                   SSDRPPVVINESGHSPSARRALENHLAQYMIPALWVALDQLLTSDVSGKVDIKNLPSPR
FT                   GSSPSGSEHSAGKDPIGLSDIAAIWETVLKVSKNLIKAEDSFFDLGGHSLSLADLSSKL
FT                   SRRFGFRVPIPRLAENTTLSGHLETVRAVRDGHAEEVQANLPAVLLSDATLDEDIKPTN
FT                   TAITSITSADTVLLTGVTGFLGAFLLNDLIENTSAKIICLVRFSAPEQDDQAGGVARIR
FT                   RNLLDMGLWRDSILERLEILPGNLARPHLGLGPDEFDNIAARVQVIVHAAATVNLVYPY
FT                   AALRGANVGGTREILRLAAKGGATVQYISTNGVLPPSGENGWPETTMLDIEDVPKKLVD
FT                   GYGQTKWVAEQLVLKAGERGLPVKIHRCGTISGHSVTGSANAWDLLTALIVESIQLGYA
FT                   PDVEGWRAEMTPVNFVSKSIVHLATQTQKDQTMFHLGDPTPVNTRSVFEDLKELGYETQ
FT                   PLPWDEWVALWFEKRGSAKGGDGSFTVDILRSGMPTFEFLRDIVVLDNALTRPFRAVIE
FT                   RPKVDSLLLETYTRHWFARGWLPRPPSRRNALDRSTEVAVKGPLSGQVAVVTGASSGIG
FT                   AAVAAALAKQGCAVALGARRLDALESTKRKVEAHGVKCILRSTDVTSKTQMEALVQAAS
FT                   EELGPVDILVACAGVMYFTMMANTQMDEWERTVDVNCKGLLHALSSTVPGMLSRGRGHV
FT                   VAISSDAGRKVFPGLGVYSASKFFVEATLQALRLETAGAGLRVTSIQPGNTSTDLLGMS
FT                   TDTEAVKKFGEPSGAKILDPSDVANSIVHALTQPEHVSVNEILVEPRDEPI"
FT   CDS_pept        join(complement(95596..95770),complement(95335..95537),
FT                   complement(95203..95283),complement(94040..95152))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127034"
FT                   /orf_name="Pc18g00390"
FT                   /product="Pc18g00390 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94263.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018319AF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBT1"
FT                   /transl_table=1
FT                   /translation="MTFYLVTFCCAFAALGSFLFGYDSGMISSSIEQEAFLRRFGSPTP
FT                   SDAAVRGVISSYIGGAIVGSVLASYVSDYYGRRMVLFIGGLLVILGAGLQGGAVTIAML
FT                   IAGRCIAGLAIGQMSATIPVYCSEVAPPRIRGMLAGMQQWMIGSGFVVAQWVGYGCTLR
FT                   GGAFSWRFPLSFQAVPAIILVCGVWFLPESPRWLIEKGREGQGRSVLARLHLNRTATNN
FT                   HLLEHELFQIKESLASEKPAAIRSWRHLILSPRWRHRILLACGLQVFTQCAGTSVISSY
FT                   GPRLFSTLGLTTSTSLIVIGLWGALAQFWNTVFMLFIDKVGRRKLLIPSLLGMGAAVCI
FT                   EATLARYIDFSDTNANPHTLRAAIAMFFVFSFFFTALGMIAWVYQTEIFLTPIRARGSS
FT                   MATATNWSVSLIFSQCSPIALTDIGSNYLYCFVAFNWVAMVVVWAFYPETAHCSLEEVE
FT                   EAFVTQFAGEPSEHSFVDENAPVAITPRSQIRHKGLHPLSMHPTDTVSIGSSHSGSENG
FT                   MEPKEV"
FT   mat_peptide     join(complement(95596..95707),complement(95335..95537),
FT                   complement(95203..95283),complement(94043..95152))
FT                   /db_xref="UniProtKB/TrEMBL:B6HBT1 "
FT   sig_peptide     complement(95708..95770)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBT1 "
FT   CDS_pept        join(97407..97653,97726..98482,98539..99150,99207..99591,
FT                   99642..100685)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198138" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127035"
FT                   /orf_name="Pc18g00400"
FT                   /product="Pc18g00400 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94264.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018319B0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBT2"
FT                   /transl_table=1
FT                   /translation="MATTTSPLTGENEEDPAPMNDLKYSHDDDHHDTPTQDASTTDSKT
FT                   LPAQKRRRVGRACDECRRKKIKCDGKQPCTHCTVYSYECSYDQPSNRRRNPAPQYVEAL
FT                   ENRLQKAEALLRIVLPNVDLDDPQLDVHATEQKFKAAQKSKQATEDVKPSAAQDTAQEG
FT                   ADEGLLETMVDNSGCLDRDDQGHWDYHGHTSGLLFVRRLRKQLGATDIMGPMARSRSSI
FT                   TAHMLDSPKSMSESPQDTTLPPTHDLPPRAVARRLCHNAIDHACSLMKFVHIPSFFASL
FT                   ERIYDTPPEQFTNQENTFLPLLYIVIAVGCLFSDDESGEGTLDLSGYEGAIGQGFQFFK
FT                   AGRQLLEITDCRDLVSLQAICFMVLFLQSSAKLSTCYSYVGIALRSALRLGLHRSVAAD
FT                   FNPLERELRKRIFWVVRKMDIYVSTLLGLPQMLSDDDIDQEYPMEVDGDYITSEGITQP
FT                   PSNYTPLMAGCNAHTRLSNIILKVVKYIYPVKNARYRSKSDQRYMVSHSKIREIERDLQ
FT                   TWMEELPPALRPGTEVSPQLERVRQLLRISYAHVQMVMYRPFLHYVSGGSQARGVDKRS
FT                   YACAAACVSVSRNIVHITTGMQKRGLLNGSFWFTMYTTYFAILSLIFFVLENPDSPTAK
FT                   DGVLKDAMEGKNTLAGLAKKSLAADRCSQSLNCLFKTLPEMLKNRQSSKTPVNLKRPAP
FT                   SNTAEPEPKPTFEKTLPHRSSTFPVQMMSQPAVTDDQSRRQRSLDNVQPVSNRSTDINH
FT                   QSTWTTTPELLTETMTTPEHISSSGMTPSMPNQEPSSLAWAQQFTNPSNLPDLMPMMFP
FT                   SDDPFAYPTQPMSTLEDDHFRHDPAAMPSQYPFDSAPGMGPSTPGDPSSAGVSTPTFDF
FT                   TNMPNFPVANPAGIKSSVPSHLRPSHSRTSSRVHSPISQSQTPAEAISSPDLVSIPNQN
FT                   FVWQGYNFQPNNPNDMATESAPQQPEIPGPNGLPNFSMGMDENMGMNMDLGISFDDLFG
FT                   NSAAYQPSNGASAEDWAQWMNSNSI"
FT   CDS_pept        join(101599..101930,102045..102624)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198127" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941224"
FT                   /orf_name="Pc18g00410"
FT                   /product="Pc18g00410 protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94265.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI00018319B1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBT3"
FT                   /transl_table=1
FT                   /translation="MASLPKLSTVFTWAIYFIPVYIFILDPLVRGYFPGLLAPPRDSDD
FT                   IFDESSAPGPGINLTDDSFISPEDGVPFSCPNAEGYRVHLLSHEPLIIYIENFVSETEA
FT                   NHILDMSVNKYSPSIVYDGQTERIDPTKRLSDRALLDRDDTVRCLEDRARAFQGWRPDL
FT                   YIERMWAQRYNASGHYRHHYDWAGSLARGGDRFSTFMVYLDADCEGGGTNFPRLRMPDG
FT                   EGWCRFLDCEQDGKGNGKGKGEMGITFKPIKGNAVFWENLRQDGTGYPETWHAAFPVTK
FT                   GTKVGLNVWSWYQPKRRNRSGR"
FT   CDS_pept        join(103869..104096,104153..105856)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198116" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822777"
FT                   /gene_name="pacC"
FT                   /orf_name="Pc18g00420"
FT                   /product="Transcription factor pacC-Penicillium chrysogenum"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP94266.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00018319B2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBT4"
FT                   /transl_table=1
FT                   /translation="MTENHTPSTTQPTLPAPVAEAAPIQANPAPSASVTATAAAATAAV
FT                   NNAPSMNGAGEQLPCQWVGCTEKSPTAESLYEHVCERHVGRKSTNNLNLTCQWGTCNTT
FT                   TVKRDHITSHIRVHVPLKPHKCDFCGKAFKRPQDLKKHVKTHADDSEIRSPEPGMKHPD
FT                   MMFPQNPKGYAAATHYFESPINGINGQYSHAPPPQYYQPHPPPQAPNPHSYGNVYYALS
FT                   QGQEGGHPYDRKRGYDALNEFFGDLKRRQFDPNSYAAVGQRLLGLQALQLPFLSGPAPE
FT                   YQQMPAPVAVGGGGGGYGGGAPQPPGYHLPPMSNVRTKNDLINIDQFLEQMQNTIYESD
FT                   ENVAAAGVAQPGAHYVHGGMNYRTTHSPPTQLPPSHVTATTSAPMAAATAHSPSVGTPA
FT                   LTPPSSAQSYTSNRSPISLHHAHRVSPPHESGPGMYPRLPSATVADSMTAGYPTASGAA
FT                   PPSTLSGAYDHDDRRRYTGGTLQRARPAERAATEDRMDISQDSKHDGERTPKAMHISAS
FT                   LIDPALSGTSSDPEQESAKRTAQAATEVAERDVNVAWVEKVRLLENLRRLVSGLLEAGS
FT                   LTPEYGVQTSSASPTPGLDAMEGVETASVRAASEQAREEPKSESEGVFYPTLRGVDEDE
FT                   DGDSKMPE"
FT   CDS_pept        join(107262..107375,107457..109432,109497..109563)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941225"
FT                   /orf_name="Pc18g00430"
FT                   /product="Pc18g00430 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94267.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniParc:UPI00018319B3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBT5"
FT                   /transl_table=1
FT                   /translation="MPLTNRRRARRKEIQLQETSDAEAPDSSPSRPSAKKRKVDRHTSP
FT                   PPNVKHESGDEAEDSAGEHEPPTNQDLVDLVISYLNTPREELRVSRDHSNTKTENTQRI
FT                   QAYAKIAGRNWTYYVKTLHVNIGREPDREQRAVEQSSPVTIAARALPDVHVDLGPSKFV
FT                   SRLHAEIFYDGEETPAWHIRVNGRNGVRLNNGIVKRGTDAILSCGDIIEVANTQMMFVT
FT                   PGDEANIQPSFIERAQRIASGQEPDPASVSWDASHHAHPQQSQNSEARPSSSGGPSLAP
FT                   APKFIKRQVTPPPRSPDTAGQRTAKQSPLYNRGMMMESTEEIDYSHDSSKDLKPPYSYA
FT                   TLIAQAIFSSEEEKLTLNSIYNWIKDKYAFYRHSQSGWQNSIRHNLSLNKAFQKVPRRT
FT                   DEPGKGMKWQIAEEYREEYRKKQTRKGGTQSSAPSSPATKEPPSSARGTHVSKLDTSFS
FT                   ATAKKSPPISSPGFSSFPVAPVEAYTPERGSRLGRGLGSDHPLRHMNPREYDEPSPLPS
FT                   RSHNHHSSISTQVQNSSNNLARAYGMSDNVAGSPPVLSSSYYNEEPSSMITPAPQRQQP
FT                   RLPPPSTAQIPSKFMPMSSPAQFWKFADIGSTPARPPPDMSPLKGEVEDRIIGGFPSSS
FT                   PPPPNLVSPSKPGTSNGLGSSRTLPPLQSDSRDMAPNGQSNARNEEREEDEDDNGSGFD
FT                   LARGFEPIGSYHRQLGNAARAAAT"
FT   CDS_pept        join(complement(110745..111099),complement(109999..110429))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822778"
FT                   /orf_name="Pc18g00440"
FT                   /product="Pc18g00440 protein"
FT                   /protein_id="CAP94268.1"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniParc:UPI00018319B4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBT6"
FT                   /transl_table=1
FT                   /translation="MTSRGPLTAYLLSSTPNALKRATNHPFLASAGRGTLPKAQLSQWL
FT                   SQDRLYAQSYIRFIGLLLSKIRLPTQNPTTATPQTQSPEQNAITVLIDALVNIRTELSF
FT                   FEKTAADYSLDLTARGVRGDERCGTLFFCANRTTRAYIDMFMSAGSSGVSVLEGLAVLW
FT                   ATEVCYLRAWRFAAGCMREDGEKDYKKDADGGALRERFIQNWASVEFEEFVDRIGDVVD
FT                   EMAGQIKGAEELEITRGRCLEWWRQIVWLEENFWPSVAE"
FT   CDS_pept        join(complement(113022..113566),complement(111595..112963))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941226"
FT                   /orf_name="Pc18g00450"
FT                   /product="Pc18g00450 protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP94269.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI00018319B5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBT7"
FT                   /transl_table=1
FT                   /translation="MHARERLKMLLEGDEGLKDLNTHLYQAEAVQPAPGADEADPVADK
FT                   AKQGVSGYALPVDFKPEEGMEYPEGGQFPLSYIRTHVVGTLSESEDKLLTIKQGRRPQR
FT                   CTPKLRLDLSGLPKYDHGDGPDIDSDEELVTAIPVSRSFTPAVTMARYPFKYLQGDDAK
FT                   RVNERFYEGDKFWNRTWHLYYLSVPRVISDTPFLLIPTFQAQALLDEINSALNLNLTLT
FT                   GVGKEGLVIDVGDEQLPRPVYLGRSSTRDQKAKLESKVPRPLENWGSWAQLAEPGVVED
FT                   FQRKVNQSLATIKIRKNNSKQAAQEARKEARTKKLQECLARVQAYFGLRPALQPNVTQP
FT                   SFANGQIEAIDVLKPVKWAFQDAPIFISVDVEWMDRYGILTEVGISTLDMLDLEGVVPG
FT                   DYGHMWMKQIRTRHLRVREYRNWINETYTIGCPDSFRFGKSEIIPSADIGDAVDAAFRP
FT                   PYMVPSKGEKIAPHKNQKRTVILVGLDLHGDIVQLQRAGSQVFLSLNESYSVVRETIDV
FT                   AELYRINYQENQTRGLQALLGLLNILSSDLHNAGNDAHYTLQALVRLMLRVAGEKPWGY
FT                   EPAQVSDKEYVQPDDDRKDMSNVTVEPQEQRKERIARAHARLMAMCEQEDGSTKEGPVW
FT                   SH"
FT   CDS_pept        join(complement(116445..116580),complement(114832..116399))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127036"
FT                   /orf_name="Pc18g00460"
FT                   /product="Pc18g00460 protein"
FT                   /protein_id="CAP94270.1"
FT                   /db_xref="UniParc:UPI00018319B6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBT8"
FT                   /transl_table=1
FT                   /translation="MGTRGLEIVRFRGRYYIRYHQFDTYFEGLGAKIVASIPADPEEYH
FT                   EWLKSMRKEYAAKESALERHVYEIRDGFEPNYSEFSEFTTLPSELPRLDEYDFVEYIYI
FT                   INLDHEVLTMNHGIHWKLGNIPRQDGLWLRAIADSIYGLPTISLDICPEEYMASPALEY
FT                   PEAKWGFDYDFRPVTPRTDIAEAPKAFLTHVLAGTLIEYKDDIITCGREWSPDSFPFRE
FT                   LTFALVSIASGQAKFHSFPAQLCSPRKCGRWNCESKHLHRTPGWVNEVWAGDSAPLLEF
FT                   GSPSHRPGEPPGASPMDTMYWLEDVLVSLALVVDGEAITKAATWGIEQGRANFQIVILS
FT                   LFEVAFAEVSFDGEVGPFIKVSYAANLSPLRPDFCSSTHPRERPVLKPEMQAQRRRGEL
FT                   IMNSNCTGTTRRLRSQFPGLAALVNFFEVAASRRAASKSQGILPTELYDRIVDFVDYDT
FT                   WKACLLVSSVVRACCLRKYRLDDRMRIAAGPFKRLQENYEEPLMSFNFENMQTGKILPM
FT                   RHVPHCYSREECNWMPVIGSDRKALMLDVIIQFEPVGAGPVEPDSDDECA"
FT   CDS_pept        join(117184..119073,119133..119273)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198072" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941227"
FT                   /orf_name="Pc18g00470"
FT                   /product="Pc18g00470 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP94271.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI00018319B7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBT9"
FT                   /transl_table=1
FT                   /translation="MPMTDDTDDSGGVILDGPFDPDAQATVTDFIDYTEYLPADLIRSL
FT                   TLIRGLDDRYLDSAQAVHQLTQVYGQLPDLPSDKRPGAIALRKDISSQVDRAINARESA
FT                   YAEACRLYDVVDRHFDRLGCIRQKLEALPKPASEEPSPPPEPTRKRARGGNKTNKDATT
FT                   RITLRLDNNRNRRDKNRRRVLGADGTFDPDSPLASTEQSDLESDPIKSAPKPARPPKKE
FT                   KARRLSLGNGQSTAQALAQLKPPPADAKLGSDDLPWLRLTEWEMTRLRKKMKKNAVWQP
FT                   SEVMIHRELALANRGWEAYRAAKALAEETGAEFIDCDNIEETRRGEAAKDLEETKLSNR
FT                   GMKLNEAKKLKREQLAREQALMEGEGGVLLRPLPSPAQAPPVANRSSRKRKREEANAEA
FT                   TELVAPEPEMPVAAPVAAPAPVPVGPSRAGPSRRRSSRGAVPATETNNDLILPIKTHMS
FT                   PAVEAKLSPPLPSPTGSGSNRSLVQHVTTPTPPVTRPSSRRSAAAASIEGGALSSIPTA
FT                   IAASGRDRRIKSTTPAHKTPIRESSHAPSVPGPTRRRKRPAPGPISTGQDGGAAVSYGR
FT                   RKAKPGKKRLSIRDSQDVRVDEDGVLEQIDANEPRYCLCGDVSFGTMICCENQDCDREW
FT                   FHLDCVGLTEVPSRTAKWYCPQCRVKLHKGEDGIIKGGSRR"
FT   CDS_pept        complement(120040..121002)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235084" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670007"
FT                   /orf_name="Pc18g00480"
FT                   /product="Pc18g00480 protein"
FT                   /protein_id="CAP94272.1"
FT                   /db_xref="UniParc:UPI0001831A88"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBU0"
FT                   /transl_table=1
FT                   /translation="MRRKDVYTNITPIPSSVPRQLALDILHSHSEIITLNPLVLSHQPI
FT                   RAPRDAIADEYYSTWYEITERVQYVPGLGKMGSGKISFKGCFHNVAWGLETHMYAPMGI
FT                   DLRSKWRIAGNQHGEPPEPADRCADGVPQTGLYLREDIEIECNRTLISFVKSQLKAASK
FT                   VLVDRLIKKAELLDAGVLQAMMEDGKLTTYNPADRSSRIMRELSYSSRRQSDQMSRSSS
FT                   SRGPRSPTDSVQLGSMASGYALPSQYGHEHSKSFAVELPADFYHPQSGSDRYQELPDTS
FT                   RHSKSSRLDKGYNELSTMEETSEERSEVVSPHNPYRQKG"
FT   CDS_pept        join(complement(122741..122764),complement(122528..122690),
FT                   complement(121776..122474),complement(121623..121713),
FT                   complement(121289..121553))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670008"
FT                   /orf_name="Pc18g00490"
FT                   /product="Pc18g00490 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP94273.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831A89"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBU1"
FT                   /transl_table=1
FT                   /translation="MAPPSVLMVGTGEYTTGFVGGGASGSDKKVGVVGLSLFDLRRRGK
FT                   VGDLSMVGVSGKKFPGIRDHLHRNISQVYNNLDTSFTSFPADDQTDPDAYIAAIDALPK
FT                   GSAITIFTPDSTHYPIALYAIERGIHVLITKPATQRLEHHLALVEAARKHGVFVFIEHH
FT                   KRFDPAYSDARAKAKTLGDFNYFYSYMSQPKSQLETFKAWAGRDSDISYYLNSHHIDIC
FT                   ESMVPEYKPVRVTATASQGTAAELGCVPETEDTITLLVEWRRRDNPAKIATGVYTASWT
FT                   APQNAGVHSNQYFHYMAANGEIRVNQAKRGYEVTGDDQGLIHFNPFYMRYAPDEEGNFS
FT                   GQTGYGYISFEKFIDAVTAVNEGRVTLDQLDARPLPTLRNTIATTAILDAGRKSLDERR
FT                   AVDIVSEGDKWELK"
FT   CDS_pept        123398..124363
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173607" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941228"
FT                   /orf_name="Pc18g00500"
FT                   /product="Pc18g00500 protein"
FT                   /function="lyase activity"
FT                   /protein_id="CAP94274.1"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001831A8A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBU2"
FT                   /transl_table=1
FT                   /translation="MTFFDAQTEELDIASIRRHAVRLAKAGLVGLVTMGSNGEAVHLSR
FT                   EERMTVTRETRSALDEAGFSNVPVIAGASENSIRGTIDLCKEVAASGGEYALIVPPSYY
FT                   RAAVGNDETLYEYFTAVADGSPVPLILYNYPGAVAGIDMDSDLIIRISEHPNIVGTKFT
FT                   CANTGKLTRVATALGAITPSSPLAPAERTPTVSKPNAKHPYVAFGGIADFSLQTLVSGG
FT                   SAILAGGANVLPRLCVRIFTLWSEGRLTEAMEAQQQLSAADWVLTKAAIPGTKGAIQSY
FT                   YGYGGFPRRPLSRLTDAQYQTIADKIKPAMDVELTLPDVA"
FT   CDS_pept        124843..125481
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234460" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975987"
FT                   /orf_name="Pc18g00510"
FT                   /product="Pc18g00510 protein"
FT                   /protein_id="CAP94275.1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI0001831A8B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBU3"
FT                   /transl_table=1
FT                   /translation="MTSVVHLVRHAESTHNVSKDVSQLDPGLTSLGFEQATRLTQTFPH
FT                   APQVGVILTSPLRRSIQTTLAAFSHILDKRYFDQVSEDGIENGATLILDPDLQERSALP
FT                   CDTGSTSPALEKAFPGLGVKDLAEGWQVKEGIYAPEEEAVKERAKRVRSRVSELSDQLK
FT                   DEERNHIVIITHGVFMKFLSGDSDIDLPKAGWRSYTLEKHSSGIVLREK"
FT   CDS_pept        join(125642..125783,125814..126657,126708..126984,
FT                   127057..127170,127408..127496,127581..127653)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941229"
FT                   /orf_name="Pc18g00520"
FT                   /product="Putative uncharacterized protein Pc18g00520 "
FT                   /protein_id="CAP94276.1"
FT                   /db_xref="UniParc:UPI0001831A8C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBU4"
FT                   /transl_table=1
FT                   /translation="MYFPNSTAEDVHWHTSRVFKEPGSWLGLSLNQQSPVYLHLVFVLL
FT                   KYTTGYSNSSCAILPYILIVQLLCLGQSTKMDDTPVNIIPQAWCFIWRCERLEQILISM
FT                   KEMTTSFIPQQRLQVLRIDLNHLDIATGITSPSVTRYFMPRTNTPRIEKIREDPSWDWF
FT                   LSQRGSFGKGTYRANYLLRRVFMDYQDSSITEFWPRELHEAESEGKENNQDSTAQESSG
FT                   QLDNTGGDKESDEDDKPHDKEVNKGKEINSDKAKEGEIIGPKKTDESDEDGDKIEESGG
FT                   DNCNPSDESQKKSEKRDKKADVDHEMVIPKALDRDIRNYRTNDWSVYWLTFLPRHQRLY
FT                   DLDLPDNVHGISIARSMELNHPHKCHAWALVDVILCGHERPSTAELIALASWGLRGMFR
FT                   QLESLANGIKPEGVHMLSEVFPTMIIVFDQRCCARVLYGYFDGRLQVQFTPVLNFKEFT
FT                   EGAFGLDLWGNFSVYLDLTKAFVRDVPPTEFKYDVYSLFDSEYSIYHTHVMPKP"
FT   CDS_pept        join(128266..128340,128404..128431,128485..128544,
FT                   128699..129576)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941230"
FT                   /orf_name="Pc18g00530"
FT                   /product="Pc18g00530 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94277.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831A8D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBU5"
FT                   /transl_table=1
FT                   /translation="MPYPDEAEGFQVDGPNSYTEFHKRHFKLKPFGDYDVDVKIEACGI
FT                   CGSDVHTISEIVGRAIRVGPKVTLIKEGERVGVGAQSYSCGKCKQCRNDNETYCQVEPM
FT                   DTYGSKWADSGIVSQGGYSSHVRTHEHWVFPIPDALETNSVAPMLCAGLTAYSPLVRNG
FT                   AGPGKKVGIVGLGGIGHFGIMFSKALGAETWAISRSRAKEADARKLGADGYIATAEEGW
FT                   EKDHLCSFDLIINCANSSEGFDLARYLSMMDVHGRWISVGLPEEEGQVIKAQNLISNGV
FT                   LIGASHLGSRREMLDMLQLAADRGLKGWVEEIAIGEEGLKEAMLRMKKGDVHYRFTLIG
FT                   YEKIFK"
FT   CDS_pept        join(130507..131290,131350..131692,131743..132724)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198049" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941231"
FT                   /orf_name="Pc18g00540"
FT                   /product="Pc18g00540 protein"
FT                   /protein_id="CAP94278.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0001831A8E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBU6"
FT                   /transl_table=1
FT                   /translation="MSPRETNATSTRRRASLSFRSRPRTVGHAAPMSKELALDTWEEPY
FT                   LMEICQDHHAPVVEEIDPFPNAAPRRRGAKSFSSLRHPVDGLVALGRRLSVSLRSKPSR
FT                   QSIPVTEDIKLVDDNEVGYDHHISRHANHKRMASGSWDTRSTKTHWHQGYSVNRRPSLN
FT                   SVSALHSFYAPTASIPVPIPGRGQAPPVLPNHMSAGAAARAAAAAQNEQMEAARIAKVE
FT                   LENKMLDLKVPQDSESGICIDLRDRSDVSDTDLLTMMRLDPVALLPAEITAHIFSYLDP
FT                   DSLMDAELVSSAWFRASSSYVWRHVFRNAYGRRPASETASKLKLSSGLGKSIPNQDWKK
FT                   KFLVRRALDQRWAEGKAAAIYLQGHQDSVYCSQFDENKIITGSRDRTVRVWDAHYPWSC
FT                   QKIIGPPAARTFRRGPVNNPTAQATGKAPFMTITPPLPTPGEMTEITAPLEEESIYHSA
FT                   SILCLQFDEEIMVTGSSDFTCIVYDIKDDYRPIHRLSGHHAGVLDVCFDDRYIVSCSKD
FT                   TTICVWDRNTGELLRRLNGHEGPVNAVQLRGDLIVSASGDGVAKMWNVISGQCVKEFTS
FT                   KDRGLACVEFSEDGRTILTGGNDRIIYQFDANTGELVNELHGHSGLIRSLHLDSANKRI
FT                   ISGSYDMSIKVFDRDTGEQSINFPGWTTSWMLSVQSDYRRIVATSQDSRAVIMDFGYGL
FT                   DGIDLLEE"
FT   CDS_pept        join(133536..133549,133626..133697,133805..133839,
FT                   133947..134024,134090..134571,134635..134697)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822779"
FT                   /orf_name="Pc18g00550"
FT                   /product="Pc18g00550 protein"
FT                   /function="microtubule binding"
FT                   /protein_id="CAP94279.1"
FT                   /db_xref="GO:0008017"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR004953"
FT                   /db_xref="UniParc:UPI0001831A8F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBU7"
FT                   /transl_table=1
FT                   /translation="MGESRQELLAWLNNLLQLNLTKIEQCGTGAALCQIFDSIFMDVPM
FT                   SRVKFNVNTEYAYLQNFKILQNVFARHQVNKPIPVQSLTKCRMQDNLEFIQWVKKYWDQ
FT                   HYPGGEYDAVGRRKASGAPASVGGPTSRAPSAGSARRGVTPTGGAVRPRVGGAASGAAT
FT                   AALQQEISTQKEAIAGLEKERDFYFAKLRDIELLLQSAIEADPELEKEEDTLVKHIQGI
FT                   LYSTEDGFEIPAEGEELPADELETF"
FT   CDS_pept        136252..137883
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941232"
FT                   /orf_name="Pc18g00560"
FT                   /product="Pc18g00560 protein"
FT                   /protein_id="CAP94280.1"
FT                   /db_xref="UniParc:UPI0001831A90"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBU8"
FT                   /transl_table=1
FT                   /translation="MAHGHFRHSRIGNLISARRRREAELDGQDAGSDLLEDDTFQSPIL
FT                   PATGMPPEENCDSSKTSMRLEHGMNGFDSMLEKRDEAASPDPTSIETVLQIVDASSQTP
FT                   LQSTTTDFPMTASDSTYATDTLPSSDSLPASATASATTTATATESASASVDLGLLTSPT
FT                   ASPLSETSLTNTTNVAQTSSTTNAVTQLPSPLRSPSAAVISSPAWSSTRLVTSSISTPS
FT                   LTTTSSQVHNHSSYSGTGSDSSSSSTSTSSTSSSYTTSSSNVYGGSESAGSPTGTGTAP
FT                   TTSETQGSGQGSTSNPATPKIVGGVVGSVAGVALILFLLFYYLRRRGFFMGKMGRPTML
FT                   GDAAAGAGAGARSREVVERRESNDPLFTASYLAPAFMKRWRQSTATTRSGSTVDSAPSE
FT                   RGFQKISGRKLPPVFTHGGDGYGGGLDGDSPTITGFPATSPASGPIGSPSFYAPPPAQP
FT                   YGMPLDSNYTREVEEHTPPAQPNPVHLPISNAVSVATPITVTPAQPIAQPQSAVPFAPP
FT                   RPDGLGRSLHSFDGSRSSRFTEVMDQ"
FT   CDS_pept        join(139955..140032,140104..141010,141058..141466,
FT                   141525..141670,141732..143154,143218..144007)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000265623" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941233"
FT                   /orf_name="Pc18g00570"
FT                   /product="Pc18g00570 protein"
FT                   /EC_number="3.6.3.8"
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94281.1"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001831A91"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBU9"
FT                   /transl_table=1
FT                   /translation="MSSPNDSSHQGSLLSPVIVTDFSGRERSISTASSAWSGPTDLNHS
FT                   PTSPVSPDMAWNQPDPGRLMVQDASHRPSPSIDGDTLRPRADSFASSADTVVRSRANSE
FT                   VDPNSKAVYDDVSLSDALRPDPRNESDFQVEDNRFAFSPGQLNKMQNPKSLAAFHALGG
FT                   LQGLERGLRTDLNAGLSIDEGRLEGTVEFKDVAPSQDTSTTSPPKYDAAAPAPVSSGSG
FT                   SPFEDRVRVFSQNKLPARKSTGFFKLFWAAYNDKIIILLTVAAVISLSLGIYETVDEGT
FT                   GVDWVEGVAICVAILIVTIVTAVNDWQKERQFAKLNKRASLPPANPEITRSGKTNMVSV
FT                   YDIMVGDILHLEAGDSIPADGILVSGYGVKCDESSATGESDQMKKTNGHEVWQQIIDGK
FT                   ATKKLDPFLISGSKVLEGVGTYVVTSVGPYSTYGRILLSLQTPNDPTPLQVKLGRLADW
FT                   IGYLGTGAAGILFFVLLFRFVANLPNHPEMTGAMKGKEFVDILIVAVTVIVVAIPEGLP
FT                   LAVTLALAFATTRMVKENNLVRVLRACETMGNATVICSDKTGTLTQNKMTVVAGTWGSD
FT                   QDFSQRTEDADVEGSTTISAVSQKLSAPVKDLIIKSIALNSTAFEQEKDGSIDFVGSKT
FT                   EVAMLQLARDYMGMDLVSERGSAEIVQLIPFDSARKCMGVVYRVPGVGHRLLVKGASEL
FT                   MVGTCTSKIINIDTAKERPDVEDLSESQKKGILDIIDNYAHKSLRTIGMVYKDFASWPP
FT                   REAKHSEDSAANFEDFFHSMTWVGVVGIQDPLRPEVPSAIRKCHSAGVQVKMVTGDNVA
FT                   TATAIATSCGIKTEDGLVMEGPKFRQLTNEEMDEVVPRLQVLARSSPEDKRILVERLKV
FT                   LGETVAVTGDGTNDGPALRTADVGFSMGIAGTEVAKEASSIILLDDNFSSIITAISWGR
FT                   AVNDAVAKFLQFQITVNITAVILTFVSSVYSSDNTSVLTAVQLLWVNLIMDTFAALALA
FT                   TDAPTEKILDRKPVPKHVSLFTLTMWKMILGQAVYQLAVTFMLYFAGDKLLDAHLSTEP
FT                   EMREKQLSTVVFNTFVWMQIFNEFNNRRLDNKFNIFEGMFRNYWFLGINTVMVAGQVMI
FT                   VYVGGQAFSVTRLSSTLWGVCIVCAIACLPWAIVLRLIPDRHFGIVFNAVVGGMSFVLR
FT                   PISKGFKAIGRGIRSFFRPVKRFTGRALKKQDSDDVAELNPQPIKSDDLEQAPEKLVSK
FT                   PEPSPERPSTPPPVVVPPITITTSP"
FT   CDS_pept        join(144642..145000,145083..145305)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941234"
FT                   /orf_name="Pc18g00580"
FT                   /product="Pc18g00580 protein"
FT                   /biological_process="regulation of actin filament
FT                   polymerization"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="CAP94282.1"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0030833"
FT                   /db_xref="InterPro:IPR006789"
FT                   /db_xref="UniParc:UPI0001831A92"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBV0"
FT                   /transl_table=1
FT                   /translation="MSQINYRTINVDALDPESSANFPMESLLPATLPQAASASDAASAA
FT                   AQVRQMLRGGDPEGALRTVLDTAPLGGDDRAKEVHLATVIDVLQGIRQGEMTRILEGVC
FT                   SGDGGAERADCLMKYLYKGMSSAAPGSGTQTPKKPVSPQDTGFSQIQARNLGEGGGGQQ
FT                   MSVLLSWHERLVEIAGTGSIVRVMTDRRTV"
FT   CDS_pept        join(complement(146945..147172),complement(146008..146850))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000265011" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941235"
FT                   /orf_name="Pc18g00590"
FT                   /product="Pc18g00590 protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAP94283.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI0001831A93"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBV1"
FT                   /transl_table=1
FT                   /translation="MIPLQTFRVGLSRRCFAPTITVRKYASQTPGNPMLEVFNRKVKHL
FT                   QKDRAARNVEESRKVDYLKDEVAMRLCERLLDIKRDFPNVLDLGANSCNIARALTSPNI
FT                   DSVMPEGTITPPLSNKISKLTCVETSHALLHRDENEQFNKEIDIQRDVIPDLETLPYAP
FT                   NSFDAVLSSLSIHWINDLPALLEQVNTILKPDAPFIAAMFGGDTLYELRGSLQLADMER
FT                   RGGVSPHVSPLADVKDVGSLLTRTGFKMLTVDVEDIVVEFPDTFALMQDLQAMGEGNAI
FT                   MNRDLAPLSRDVLLANEAIYRSLHMEEGARGIPATFRLIYMIGWKEGKGQAQPLQRGSG
FT                   DVNLKDILEGGDFSKP"
FT   CDS_pept        join(147684..148066,148130..149642)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197216" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670009"
FT                   /orf_name="Pc18g00600"
FT                   /product="Pc18g00600 protein"
FT                   /protein_id="CAP94284.1"
FT                   /db_xref="InterPro:IPR008603"
FT                   /db_xref="UniParc:UPI0001831A94"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBV2"
FT                   /transl_table=1
FT                   /translation="MSRPFPYTYISCPCADTPVPDPARKRRSRESPQKSPQKPPPERAN
FT                   TDQDKKLSAKEEEQGEDEDEEQTFDPRSPRSNFSLYPPEQLLYCEECHQIKCPRCITEE
FT                   IVSWYCPSCLFETPSSMVRSDGNRCGRNCFNCPVCTAPLAVSTIENATGNAPQQGPWVL
FT                   SCGYCLWTTLDIGIKFDKPTNIRSQLQKMTDSTPPAALDRSRQASRTFEDLKHPLSSYA
FT                   SIDEQSNARERDGEQAAPKEDQGAPPMGMDARFAALKNFYRTQISETSNSPNDHLSSEF
FT                   GFSSPGALNRLMSLYASSSRLSGLYGGSKKPKSKPPVMREALTASEGLQVASENSETDM
FT                   IARLQSPECGWDGMASIDQRATQSPDARFIDDLLPLPVLLRTKRAKRCKSCKHILVKPE
FT                   SKPQSTRFRIRLIALSYIPLPTLRPLAPSSSSALPAMAPTSDLNSLPPLRPIHILLTLK
FT                   NHMFDPVRITLATPPVTPGRVATKVTVLSPQFEIGANSDVWDEALQGASAPLTSDSRSA
FT                   ALRGVPEAGKVWDKGRNWTTVVLEVVPGTLPGSSAEGGDGNPNTETNDEDVLAVAASRQ
FT                   DEDVLEIPVFVHMDWDADAQLDQQNVGKGSKPDDKVTRELAYWMVLGVGRIQPSL"
FT   CDS_pept        join(complement(151094..151249),complement(150710..150792),
FT                   complement(150256..150619))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975988"
FT                   /orf_name="Pc18g00610"
FT                   /product="Pc18g00610 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP94285.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000554"
FT                   /db_xref="UniParc:UPI0001831A95"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBV3"
FT                   /transl_table=1
FT                   /translation="MAAINKIAPNSPSRQNPSELETAIAGALFDLESNTQDLKASLRPL
FT                   QFVSAREVEVGHGKKAIIVFVPVPLLANFHKIQQRLTRELEKKFSDRHVLFVAQRRILP
FT                   RPKRSVNSRTTQTQKRPRSRTLTAVHDSILSDLVYPVEIVGKRTRTKEDGSKTLKVILD
FT                   EKERGGVDHRLDAYGEVYRRLTGRSVAFEFPQSGAEF"
FT   CDS_pept        join(complement(152702..152785),complement(152571..152634),
FT                   complement(151747..152384))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941236"
FT                   /orf_name="Pc18g00620"
FT                   /product="Pc18g00620 protein"
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="CAP94286.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015599"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI0001831A96"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBV4"
FT                   /transl_table=1
FT                   /translation="MSEAASANAPKPSSSVKLVLLGEAAVGKSSLVLRFVNNDFQENKE
FT                   PTIGAAFLTQKCSLPTRTIKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPSSLT
FT                   KAKHWVAELQRQASPGIVIALVGNKLDLTNDGGDVSEAAGAAQDESESAQNGEEGAGEE
FT                   DEVQDAVSGDARKVSTREATGYAEEEGLLFFETSAKTGTNVVDVFTAIANAIPESSLKT
FT                   GRGTGAGTGQTSLGNRSAEDSRVNLGDRNAATAKEGCAC"
FT   CDS_pept        join(153004..153287,153512..153658,154546..154649,
FT                   154690..154739,154960..155069,155150..155312)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941237"
FT                   /orf_name="Pc18g00630"
FT                   /product="Putative uncharacterized protein Pc18g00630 "
FT                   /protein_id="CAP94287.1"
FT                   /db_xref="UniParc:UPI0001831B5E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBV5"
FT                   /transl_table=1
FT                   /translation="MRNAKRSIDVTETRVIDPEVGERRRWMMMMGASIGLSAVVSHQSR
FT                   EARPRLKYTTGILSICIAHTSIEASFTSPYLFKETDIRAKFDVQGSSPALKDPGQAREI
FT                   SADAPARPHQQSGCRSCLGISRQANLPDASATAVGQVQAKNAGLLHSSRVVSSSSHVES
FT                   RKVPEDHIKVCGGSHENRRVLCECANGRVRNENHHWDNAGSNRIVGQECDEIGPTNEEK
FT                   VSLGKSKMDSESIKNRDPNQENGQKGYDQDGKGAKEKVLRNWLRSIRTKFKSTYRKGEG
FT                   RKGG"
FT   CDS_pept        join(complement(157514..157585),complement(157340..157423),
FT                   complement(157048..157066),complement(156921..156960),
FT                   complement(156692..156826),complement(156452..156667),
FT                   complement(156182..156242))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941238"
FT                   /orf_name="Pc18g00640"
FT                   /product="Putative uncharacterized protein Pc18g00640 "
FT                   /protein_id="CAP94288.1"
FT                   /db_xref="UniParc:UPI0001831B5F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBY1"
FT                   /transl_table=1
FT                   /translation="MDGGLHSMDPVSGRLRRSGNEWKPILNPLGSDGIPNKEKGGERNP
FT                   RAIKVDYDDRQYGKQCNRASHSARMYRFSADGKGNFSFLGWGWTRAETRLRSPFTSLEA
FT                   RNVNPVRKWGIRGVANNKKADADTLNYLGSFNGVEKSPGLWGWVRIFPDVMILYGTKVL
FT                   YCIPYAFTQFPGKEKERLEDEENVHTTGIDPKTSETRSEATGLNR"
FT   CDS_pept        join(complement(161229..161605),complement(160833..161147),
FT                   complement(160704..160766),complement(160566..160638),
FT                   complement(159992..160477))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000288398" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822780"
FT                   /orf_name="Pc18g00650"
FT                   /product="Pc18g00650 protein"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, carboxyl group as
FT                   acceptor"
FT                   /biological_process="organic acid metabolic process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP94289.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006082"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016774"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="UniParc:UPI0001831B60"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBY2"
FT                   /transl_table=1
FT                   /translation="MPKSILAVNAGSSSVKITFYTFDNPPRTIVDAAISGITAPPSTLK
FT                   YQAGGRKHKEELKEKLSTAQDAFKYLLQRCFSDPELSEVASADDVEYICHRVVHGGDYR
FT                   DAVEINDETLGHLKGLEDLAPLHNFSALEIVRLCRSELPKVRSITFFDSSFHQTIPEAV
FT                   RTYPINQEIAKANGLRKYGFHGISYSFILRSVAQFLNKPVEKTNLIVMHIGSGASICAI
FT                   KDGKSVDTSMGLTPLAGLPGATRSGSIDPSLVFHYTNEAGKLSPASTSEMHISTAEDIL
FT                   NKQSGWKALTGTTDFAQIAVPNPPSEAHKLAFDIFVDRIQGYIGSYYVKLNGELDGVVF
FT                   AGGIGEKSALLRRTLVDKCQCLGLAIDDVANDKGPGDEETVKDISKGSGKGPRVLICQT
FT                   NEQVCGLKYWVLLTVTFALTSRGGVGFGYRLFLYTWIY"
FT   CDS_pept        join(161906..162068,162120..162194,162253..162487,
FT                   162538..162690,162741..163671,163731..164556,1
FT                   64613..164698)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000236450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941239"
FT                   /orf_name="Pc18g00660"
FT                   /product="Pc18g00660 protein"
FT                   /function="aldehyde-lyase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP94290.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016832"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="UniParc:UPI0001831B61"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBY3"
FT                   /transl_table=1
FT                   /translation="MPAEVISEPNPQALPSHLPDYLEKLSVSLEREKLDEKTYDALIKF
FT                   RRAACYIAAAMIFLQENTLLKSELTFQHVKPRLLGHWGTCPGLIFVYSHLNYLIRTMNL
FT                   DMLYVVGPGHGAPAILAALWLEGSLEKFYPHYSRDEKGLHRLISTFSTTGGFPSHINSE
FT                   TPGAIHEGGELGYALAVSFGAVMDNPDLIVTCIVGDGEAESGPTATSWHAIKYIDPKES
FT                   GAVLPILHLNGFKISERTIFGCMDHKELLTLFSGYGYQVRFVEDNNDIDADLHTSMIWA
FT                   VNEIQKIQKAARSGKPIMKPRWPMLILRTSKGWTGPKQLHGKFLEGSYHSHQVPLPKAK
FT                   TDKEQLDLLQNWLSSYKPEELFTSNGDVIDEIKSVIPTEDKKKLGQRIEVYNSYTPPNL
FT                   PDWKPFCADKGSQESAMKAAGTFINQTFKDNPNSVRLFSPDELESNKLDAVFEYTNRNF
FT                   QWDEFANARGGRVIEVLSEHMCQGFMQGYTLTGRIGIFPSYESFLGIIHTMMVQYAKFI
FT                   KMGLETTWHSGVSSVNYIESSTWARQEHNGFSHQNPSFIGAVLKLKPSAARVYLPPDAN
FT                   TFLTTIHHCLKSKNYINLMVGSKQPTPVYLTPKEAESHCRAGASIWKFCSTDDGINPDV
FT                   VLVGIGVEVMFEVIAAAALLRKLIPELRVCVINVTDLMILDNEGAHPHALSTEAFDGLF
FT                   TSDRPIHFNYHGYPTELQGLLFGRPRLDRVSVAGYIEEGSTTTPFDMMLVNRVSRFHVA
FT                   QHAIRGAAKVNEKVRVYQQELNAQLEASMVSTRKYIVENRDDPDGIYDMPQFHSFHKPA
FT                   ESETFWNIAQ"
FT   CDS_pept        join(complement(166859..166888),complement(166324..166722),
FT                   complement(165887..166240),complement(165312..165832),
FT                   complement(164992..165154))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670010"
FT                   /orf_name="Pc18g00670"
FT                   /product="Pc18g00670 protein"
FT                   /protein_id="CAP94291.1"
FT                   /db_xref="UniParc:UPI0001831B62"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBY4"
FT                   /transl_table=1
FT                   /translation="MERIRLAVPSRKKPKSSLRRKTALDKKYEEEPVTSLSTNNKRRRQ
FT                   KAVEKGREVLDLEGTPESSNTALPRADRTRKPPSYYSDIEHGRGRNHRATTPSSPNLLV
FT                   HGGKENEGEDSQGRPIGVGDLEPQNDETYWTEEEDDDDDLLPLEDGWFKRLAQRFRPSR
FT                   TESLRQLETTSYTWQDVRAGRTPRSLYLFRRKLLSVLIQPGWDPVTGPTEKKEIQDQGG
FT                   LGYPTNDRPFYHRRTLLPESEIEQARHWLQANSVLLGDLRDLFVEDVVDMPPTKLLIHR
FT                   IPTLPNVVPKAARLIRYTLEEEKWQLENLPKMEAAGVITRCISPWSAKTKWVPKPGPPP
FT                   IRLRMVHQYIPLNSVTVKMNYHMKRIEPILNMVGQTKWKVFFKADAANGYCPGIMPRPC
FT                   SIDDANILISLRESEASTNKQNTPDSEELDRRMKWNYAVLGGCTSSGSIHIPYSQILSL
FT                   HQNKPRKLIEDVSSGLFSGLFSGLFRCLVI"
FT   CDS_pept        join(complement(168807..169002),complement(168656..168748),
FT                   complement(168037..168602))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941240"
FT                   /orf_name="Pc18g00680"
FT                   /product="Pc18g00680 protein"
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94292.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI0001831B63"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBY5"
FT                   /transl_table=1
FT                   /translation="MDDRIRLQYGCPAYIEGVGTSYGYVPSLGAGIAFCALFGLSMIVH
FT                   TVQFTWKRQWWASVFSVGCLVEVIGWAGRTWSAKCPYNTTAFLMQISTLIIAPTFFTAG
FT                   IYILLGRFIQVLGRESSFLKPNLYLWIFCTCDVVSLVVQAVGGGMASGEADKIDGDTAT
FT                   GTHIMVAGIVFQLFSITIFVVCAVDFIRRTMRNRLLQSVTGSVIPLYAAMVLSIMCIYV
FT                   RSIYRAVELSQGWEGYLITHEVYFIALDGAMMVVSVAVFNFLHPGWILPRGKPDSYKTE
FT                   VPR"
FT   CDS_pept        170764..171252
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(171373..171608,171711..171891)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670011"
FT                   /orf_name="Pc18g00700"
FT                   /product="Putative uncharacterized protein Pc18g00700 "
FT                   /protein_id="CAP94294.1"
FT                   /db_xref="UniParc:UPI0001831B64"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBY6"
FT                   /transl_table=1
FT                   /translation="MSLSTISRSRFPPHPPFLGTELKKKKQRKYRTNLIVDTLALIIRL
FT                   VQNHGVLKAADTVQYGHHQRLSSSNAVLMRGISSSLKVMIITSRTTSSQWGCRATDPDD
FT                   YEKPKRFGNEEDKLKFYDGYSVEDRNLDSPDGHS"
FT   CDS_pept        join(complement(173100..173406),complement(172271..172998))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197238" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941241"
FT                   /orf_name="Pc18g00710"
FT                   /product="Pc18g00710 protein"
FT                   /protein_id="CAP94295.1"
FT                   /db_xref="UniParc:UPI0001831B65"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBY7"
FT                   /transl_table=1
FT                   /translation="MPAKTPKKRTVSWTDNTRPAREFARTATAQTSRLACIPSPARFIL
FT                   VVLSSLIASSVLFTLTSTLTVGDLGPISKHLEEWWEVGGLIAWRAVEVGLAWVLGFDGR
FT                   DVASFLFLTHLPTYSLLSFFYGIRPTSALIAYGVTIVSTALPFALLRRPSSVHDLSRAP
FT                   ADAVANRNILQDKTITIFTTLLATSVFSVVLYASYATWLPTQLVIHFEGLPDISAAHAG
FT                   PAGLPVLFLTLLPAGWAARDFLFVSSTGYSSTPGESASCCEGEYLASAICRNTWGKLTP
FT                   KTRVLVSRSIILALGVLLNTIVQVAGTISDVSIEGAATWGAVWAFATLTAGATFGWIEA
FT                   VDGV"
FT   CDS_pept        join(complement(175337..175617),complement(174914..175279),
FT                   complement(174619..174860),complement(174220..174560),
FT                   complement(173705..174145))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197249" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941242"
FT                   /orf_name="Pc18g00720"
FT                   /product="Pc18g00720 protein"
FT                   /protein_id="CAP94296.1"
FT                   /db_xref="UniParc:UPI0001831B66"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBY8"
FT                   /transl_table=1
FT                   /translation="MLWSRLAQPARSYARQGLPRPLRINSRVVMHTPKRFNSNPQSTGQ
FT                   MTPDPTDQNDSDEGRGRGRDGDSDPNLKSTILKMLETAATTAASIAILGAAGYWYHQYY
FT                   KYLILDKMDNAFNPGDPALEVAGVVSGKHKYRHEEHWVVRNEQPKIDDIVAGKQSGHYY
FT                   LMIGEKGTGKTSMLLEAMRKINGNSCALFEAHADLEIFRIRLGKALDFEFHEDYVGSLF
FT                   SIRGPRDTTALLDIERAFNKLEKVALNRRKIGSTPLILIINSTHLVRDDHDGQDLLEMI
FT                   QQRAEQWAASGLVTTILNSDDYWVYERLKRYATRMEVIPVTDLPKDKAMSALKRYRQQF
FT                   HNETLPSAVLEQVYDKVGGRLSFLNRVAKSQDVTKTCDEICQAEKTWFLNKCWILGREM
FT                   DDDVMDQQKYASAAMVLAKALVDKEKEMESIYHHEQGHILPEIPLHEAREIMTRADFIQ
FT                   SYDHDNIFTIDSRAMVRADSVPMQRAFEEICAIENFDNHLEGTLERIGDIESLGRTREL
FT                   TIKDLWDNGKYRVVVRDNHGRESGTVEFAVAEREGEDQD"
FT   CDS_pept        join(177617..177719,177775..177830,177895..181458)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076715" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941243"
FT                   /orf_name="Pc18g00730"
FT                   /product="Pc18g00730 protein"
FT                   /function="binding"
FT                   /protein_id="CAP94297.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001831B67"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBY9"
FT                   /transl_table=1
FT                   /translation="MQGTRANGGTEAPQASQEIANGTAPEGTEEDNAGGLFQISVKLPH
FT                   APHKIQVMVSSQEQVQDVRQSIVELPGTFQYTCFHLEFNGNRINDFVELSEVPDLQADS
FT                   EIVLVEDPYTEKEARMHVVRIRELIGASGDRVDNLHGISAGLSLHDAITADAIKASESE
FT                   KEHSLSKYDLTGVSPLQTILPTAEAPLPKTVKSISLSAWNPVPYNLRQKGHLLYLVVAT
FT                   NEGEQFQITAHVSGFFVNKCSSVRFDPFPKQTHPKKGSAHSLLTLISQLSPSFNASFEA
FT                   LQEYNNEKDLLTTFPFQNAIPNSPWLIAPSNSSLNAHQPDITRSQENYLISGVDNAETL
FT                   RDWNEEFQTTRELPRESVQDRVFRERLTSKLFADYNEAAARGAVLVARGEVAPLNPTEA
FT                   RDAQIFVYNNIFYSFGADGVGTFTSEGGDEAARVAVGKDVLGIKAVNQLDIDGLFTPGT
FT                   VVVDYLGKRIVGQSIVPGIFKQREPGEHQIDYGGVEGKEVVATHADFVPVFEKLSKALR
FT                   VKQHPVWDKENQRHDLEGSVETKGLLGTDGRKYVLDLYRIAPLDAEWQEEEGSDVYPHR
FT                   MSVLRLELVESYWRHKMSQYVKAEVESRKAASAEAAKEGKTEEEGADQERVDISGFNLA
FT                   LNPDVFSGQVPQTQEEKEQWAKDEQEVRDACDHLRSKVIPDLLKDLHDGDVGFPMDGQS
FT                   LTQLLHKRGINIRYLGKLAQQSAEKGPRLQALSILLVQEMITRAFKHVANRYLNNVPAP
FT                   FVASCLSHLLNCLLGSDVNATPKAEIDESLRAIFPEGDFSFEKVTPESLRAELEKQVTI
FT                   RFRFSLEKDWANSLRHLQLLRDISVKLGLQIGAREFAFTKDQVKEQVVVPATNGSTHEE
FT                   PKKKGKKKGGDNKSPARTAPAPAKPAVTFTTDDILNVVPLVRDAAPRSALAEEALEAGR
FT                   ISLMQNQKQLGQELILESLSLHEQIYGILHPEVAKLYHQLSMLYYQTDEKEAAVELARK
FT                   AVIVTERTMGVDSADTILSYLNLSLFEHASGNTKTALVYIKHAMDVWKIIYGPNHPDSI
FT                   TTMNNAAVMLQHLKQYNDSRKWFEASLSICEELFGKDSINTATILFQLAQALALDQDSK
FT                   AAVGKMREAYNIFLAQLGPEDRNTKEAENWLEQLTQNAVSIAKHAKDIQARRLRRNPLN
FT                   PRVSSMGTRVQPQVGQTAPEISAPADPSGLDSRSIDELLKFIEGTDTSSSRSKQKKRAA
FT                   TSNPKLRGSKQSNKA"
FT   CDS_pept        182217..184970
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197260" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670012"
FT                   /orf_name="Pc18g00740"
FT                   /product="Pc18g00740 protein"
FT                   /protein_id="CAP94298.1"
FT                   /db_xref="UniParc:UPI0001831B68"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBZ0"
FT                   /transl_table=1
FT                   /translation="MEDAQATAKWANRVLRPLTSICRRIAKHQETLSMIAIESKPQDTT
FT                   EGNDVPASATDHKPESRHNCSGSDADPDENDPAWIPGKKPERRRPRHKYSSKTEETGGK
FT                   KRNRLSIHSPEASRTLPGAIEVATPLITGRRWEMPPSAQSERPEGRVNPNIQSSQPQVF
FT                   RDRYSLHKSPWQELLDQSGDSGFADIAHNLDRVFQNFLCNTVISKQEVKPSSESSRRGA
FT                   RSLLSMVARSLPDFIASEQEAHDELDEDGDEDMCDAYFTELEAFYAPYGTGWKPLREAV
FT                   RAQGIYLVSTLIQNRWITDSIACALIEKCRSFAPEESDSLLSTLLSTRKNYPYPQALRP
FT                   VVEHDPSDPIRLLRKYAHHGVANRSYIFDELAKLLLRGVLPPEWMGTKLWTSWMTRATI
FT                   SLSKEDQDCPAATRLIEAVILSASDARPITAAQKPTLKPALKGKTVPPRATRAASTTPW
FT                   EISNLARPCPLQVEDALSNHVISLMAALCGMHISRSRAFDDTDCVAETKARYITSCLHI
FT                   SLQRELESSSAAQRAGNTPHQLLRRGCILLATSLVQCNDKILLDNNHYAMASTASVDEC
FT                   AEIIASHSDIVRELALFVHQAFRCLRKTAEDETERTSGEIRDMVSQLARLADTSALSAL
FT                   LGRVAAEAAMEFAEATADPDDHMWAVDVQQAAVAKQRQEETAQRSLEGPEQSSQSTGLF
FT                   RWEDSIGEWVACTPTTKEKPIIVQKAQRPMRMLSSPVPCIASSTDTDSSSPGSDLFDDS
FT                   VSSLTSSPVPTATKRTIEDAEVSSIRPRKRQRPTPVVVVDRGGNSPQIRPPTPTRYSST
FT                   VEPVTRRGILRERSANLTRRTTPAAQQARKVEVVIINHKESSPRQPIVRPTLERAAKQV
FT                   HRTVERRRSTRPSVSTMRPIVEPPRTRQTVIPCHQDDDSDDELSFL"
FT   CDS_pept        join(complement(186826..186860),complement(186553..186777),
FT                   complement(186337..186470),complement(186063..186235),
FT                   complement(185810..185980))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941244"
FT                   /orf_name="Pc18g00750"
FT                   /product="Putative uncharacterized protein Pc18g00750 "
FT                   /protein_id="CAP94299.1"
FT                   /db_xref="UniParc:UPI0001831B69"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBZ1"
FT                   /transl_table=1
FT                   /translation="MLHVKCLGPKLGGNLDIWAVPTGGSEDIVEKDSERNNPRLLGQTT
FT                   EARIEGIRVFRVFCWVAGVSRKGPAYIECIEIRGKAWNKSRLLLSTGNERNASDPVTVK
FT                   NGLKEEKNDHDDTMKIVSKTKGKGMRQRSGPTGPICRIQAGLSTFSTARIMWNPLSILI
FT                   SGTFLNFLERGGVLALGPRSVQGISPTLTEDGPGTCDRSSPSCRKVAGIPMKGYDWPVL
FT                   FDSETASEQAEFDKDQQPPHKPT"
FT   CDS_pept        186874..188664
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185907" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941245"
FT                   /orf_name="Pc18g00760"
FT                   /product="Pc18g00760 protein"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94300.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI0001831B6A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBZ2"
FT                   /transl_table=1
FT                   /translation="MHSFLLAMSLAGLTSATDIEYIEKRHGYNPYYEAVNDDLARYTIL
FT                   ALGLAAAAYYIWQLAFRFSRHLRRLASFTDDRQRYFVSTHNTFAWIKEHIIYAALFRSR
FT                   HNRELQLSSAINMGTLPSRFHAFLVTGVIAMNITLCCVTTPYGSDSDTLAGVIRNRTGV
FT                   MATVNLIPLVLMAGRNNPLIAMLHVPFDTWNLLHRWLGRIVVLESLAHVFAWAIPKANE
FT                   KGWEIVGMALGNSTFLLTGLVAACAFTALLLHSPSPIRHAFYETFLHLHIAIAAVSMGF
FT                   LWVHLNDLPAQTYLLASIILWALERATRFFIIVYRNCGRECTTAVIEAMHGDAMRITLR
FT                   MARPWTFRPGQHIYLYIPSVGLWTSHPFSVGWSETEDSNSDEKSLPLTSKDILNVPQKE
FT                   TISLLVRRRTGMTDKLFQRAANSPTSQITLRAFAEGPYGNIHTMDSYGTVMLFAGGVGI
FT                   THHVPFVRHLVAGFANGTVAARRVTLVWIIQSPEHLEWIRPWMTSILAMDRRREVLRIM
FT                   LFVTRPRNTKEIQSPSATVQMFPGRPNIDTLVGMEVENQIGAMGVLVCGNGGLSDDVRR
FT                   VCRKRQTQTSVDYVEESFSW"
FT   sig_peptide     186874..186921
FT                   /db_xref="UniProtKB/TrEMBL:B6HBZ2 "
FT   mat_peptide     186922..188661
FT                   /db_xref="UniProtKB/TrEMBL:B6HBZ2 "
FT   CDS_pept        join(complement(189397..190637),complement(189019..189342))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941246"
FT                   /orf_name="Pc18g00770"
FT                   /product="Pc18g00770 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94301.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831C3E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBZ3"
FT                   /transl_table=1
FT                   /translation="MGTKFDVTPEKQASVPRFVYNXLTVKPVTVQGVSLAGKTALVTGS
FT                   NTGVGLETSRQLLELGLSKLIIAVRSEERGXTAKERLSAGQNLSDVSIGVWELDQSDYD
FT                   SIVAFAERTKSLSWLDIVVLNIGIVNATRVFNPKTDQEEMTVNYLS"
FT   CDS_pept        join(complement(191907..192072),complement(191169..191829))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127037"
FT                   /orf_name="Pc18g00780"
FT                   /product="Pc18g00780 protein"
FT                   /protein_id="CAP94302.1"
FT                   /db_xref="UniParc:UPI0001831C3F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBZ4"
FT                   /transl_table=1
FT                   /translation="MVGSATVRGGPSSKEPDESWIPTQPIPGRDAKWSTVVVEVGVSES
FT                   YQKLKADAEWWLTDSRGNVNLAIIVAINRETPNIVETVCLDVSSLRRQRPRYVPTIRQS
FT                   ITTSRDPKRPDATITVSPPVPLTIQFAELFCRQPILPEHNIDLSPDQFREISGQVWDHQ
FT                   VF"
FT   CDS_pept        join(193507..193586,193636..193689,193750..194374)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000125752" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941247"
FT                   /orf_name="Pc18g00790"
FT                   /product="Pc18g00790 protein"
FT                   /protein_id="CAP94303.1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI0001831C40"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBZ5"
FT                   /transl_table=1
FT                   /translation="MSQPNITLYTTQTPNGIKISIALEELGLPYKVEKIDISKNTQKED
FT                   WFLKINPNGRIPALTDTFSDGQKIRIFESGSILEYLTEQYDTDYKISFPKGTREYYEMK
FT                   NWLFFQNAGLGPMQGQANHFSRYAPERIEYGVNRYVNESRRLYGVLDKHLAESKSGYIV
FT                   GDHVSIADITHWGWVAAAGWAGIDIDEFPNVKAWEELMAKRPGVEKGRHVPAPHTIKDL
FT                   IKDKAAVDKAAAEARSWIQQGMQADAKGKV"
FT   CDS_pept        join(195072..195240,195310..195520,195575..195792,
FT                   195987..196210,196267..196375,196437..196642,1
FT                   96697..197317)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197271" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941248"
FT                   /orf_name="Pc18g00800"
FT                   /product="Pc18g00800 protein"
FT                   /function="RNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP94304.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI0001831C41"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBZ6"
FT                   /transl_table=1
FT                   /translation="MAWRNQGITGSNNIPLGRRRMGGEDGDEESRTATPSSMPSSSMGP
FT                   DGPKRGRSPVRAPADGDGKRRKKRNRWGDQQENKAAGLMGLPTMIMANFTSEQLEAYTL
FT                   HLRIEEISQKLRINDVVPADGDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEK
FT                   AIKTIPNYNPPSDYRRPTKTQEKVYVPVNDYPEINFIGLLIGPRGNTLKKMETESGAKI
FT                   AIRGKGSVKEGKGRSDAAHGSNQEEDLHCLIMADTEEKVNKAKKLVHNVIETAASIPEG
FT                   QNELKRNQLRELAALNGTLRDDENQACQNCGQIGHRKYDCPEQRNFTANIICRVCGNAG
FT                   HMARDCPDRQRGSDWRNAGADRRGDRAVGTGDAVDREMEQLMNELSGGAPGEYEPRRIE
FT                   AGPGGGSPDDRDVKPWQQRGPPAQSDVAPWQQRREPRPRDDYGSRDNYGSRDNYGSRDD
FT                   YGSRNQGGPAPWAAQSQHQTRDYGYGSQGGYAAPGTAPSAAPWQQPAPPGGQQPAYGGY
FT                   GAYGGYAAYPPGMGAPGAAPPGMGAPPPPPGMAPMYPGAGSPPPPPPPGDAPPPPPPSD
FT                   LPPPPPPPQ"
FT   CDS_pept        join(complement(198718..198881),complement(198637..198653),
FT                   complement(198299..198585))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216740" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670013"
FT                   /orf_name="Pc18g00810"
FT                   /product="Pc18g00810 protein"
FT                   /protein_id="CAP94305.1"
FT                   /db_xref="UniParc:UPI0001831C42"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBZ7"
FT                   /transl_table=1
FT                   /translation="MVERVIRAGQHDWIWYMDFDILITNTSTSLTNLIHENLENATMPD
FT                   AIDFLVTDDCNGLNDVRAFHDREKEQSGRSLGDQESMDLFLKSNAPLTQHVMRIPQWTI
FT                   NAFPEEIGCYDTHKMKWAKGMFVVHFAGAWAHVIGEDPTGHLMRKYEPEIL"
FT   CDS_pept        join(202665..202975,203052..203200,203251..203338,
FT                   203389..203885,203940..204823)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197283" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941249"
FT                   /orf_name="Pc18g00820"
FT                   /product="Pc18g00820 protein"
FT                   /function="inorganic anion exchanger activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94306.1"
FT                   /db_xref="GO:0005452"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="UniParc:UPI0001831C43"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBZ8"
FT                   /transl_table=1
FT                   /translation="MQASTSAQLKTPRQSQRLSSVRSARSSRSDHGAARRQDGAQENSQ
FT                   RRASTTASVPSAQEKWWHVYLFRGMINDVKRRAPYYWSDWTDAWDYRVIPATVYMYFAN
FT                   ILPALAFSLDMFEKTSQSYGVNEVLLASVLGAIVFSLFAAQPLVIVGVTGPITVFNYTV
FT                   YDIMAPRGTPYLAFMCWIGIWSLIMHWVLAITNSCNALTYVTRFSCDIFGFYVACIYIQ
FT                   KGIQVLTRQWGSVGETSAYLSIMVALLVLMCAWICGELGNSHLFKRFIRKFLEDYGTPL
FT                   TIIFFTGFVYIGQMRDVDIATLPTSKAFFPTTDRSWLVRFWDISTGDIFLAIPFALLLT
FT                   TLFYFDHNVSSLIAQGTEFPLRKPAGFHWDIWLLGLTTFVAGILGVPFPNGLIPQAPFH
FT                   TAALCVTRQVTDEDDTNKGKAIRVTDHVVEQRFSNFAQGLLTLGTMTGPLLIVLHLIPQ
FT                   GVMAGLFFVMGVQALQGNGITQKLIFLAEDKKFTSASNPLKRIERRSAIWAFVALELFG
FT                   FGATFAITQTIAAIGFPVIILLLIPVRSFLLPKWFTREELAALDGPTASPFTMESVGGN
FT                   HGMEDYDEAVASGARDEYLSGRDGVLRSRSSTSPESAVEDDDLERGEAYELASRVSRRR
FT                   STVSRVD"
FT   CDS_pept        join(205072..205574,205642..206701)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268802" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127038"
FT                   /orf_name="Pc18g00830"
FT                   /product="Pc18g00830 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP94307.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001831C44"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBZ9"
FT                   /transl_table=1
FT                   /translation="MAPPITENPEFEDSDVSDNSDVEQPDVDDRAPKRRRLSESSNDSY
FT                   VAPAPLPTLSRIKKKGEVEKEPESKEEEPVLISDAIELGKQSGLSTFAELDVAPWLVSS
FT                   LATMAIKRPTAIQKACIPEILKGKDCIGGSRTGSGKTMAFAVPIMQQWARNPFGIYALV
FT                   LTPTRELALQIYEQFRAVSAPQNMKPILVVGGMDMRQQAIELASRPHVVIATPGRLADH
FT                   IKTSGEDTVAGLRRVKMVVLDEADRLLASGPGSMLPDVETCLGALPPSAERQTLLFTAT
FT                   MTAEVRALKSMPAAGNKPPIFMTEIGTENQGKIPPTLKQTYLKVPMTHREAFLHALLST
FT                   EVNVTKPVIVFCNHTKTCDLLERTLRRLGHRITSLHSILPQSERTANLARFRATAARVL
FT                   VATDVASRGLDIPSVELVINYEVPRNPDDYVHRVGRTARAGRSGEATTLIGQRDVELVL
FT                   AIEERVGRQMEEFAQEGVNIESRVVRTGLLKEVGSAKREAAGEIDEGRDILGRKRNKLK
FT                   KVR"
FT   CDS_pept        join(complement(207962..208273),complement(207726..207884),
FT                   complement(207115..207660))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197294" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975989"
FT                   /orf_name="Pc18g00840"
FT                   /product="Pc18g00840 protein"
FT                   /protein_id="CAP94308.1"
FT                   /db_xref="UniParc:UPI0001831C45"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC00"
FT                   /transl_table=1
FT                   /translation="MNSTSVQFSPIKDGRRILGEKDSNACLSPATHAKPSFPAIGTPVK
FT                   RMSIATSPKKLLPSPIFAGQKRTRDQVDEMEDHLGHVQARESSPQPGVQSPLNDDMQSQ
FT                   INQTPTPQNSQPECDQTQDLMDTDQSFNVPSTPEQETRSVISDPETRKMFIQQKATLLR
FT                   SRLQSAMRNVTDHQFDRRLSELEAHSRKCPRLSLSVLSTPPLSSRKHFTPFSSFSSSHM
FT                   KTPRIGCAGFTSTPSHSTPDLPGRPSPLSSSVVQQRTKSHAQRTPPRGLGSPMQLSSPP
FT                   ATVIRREADRETSMGPRAELGMNDVDAMSPSQRGDAVDGLLKLMSTAGNQSSDSWTG"
FT   CDS_pept        join(209786..210054,210120..210519,210573..211581,
FT                   211645..211775,211831..212457)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194581" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822781"
FT                   /orf_name="Pc18g00850"
FT                   /product="Pc18g00850 protein"
FT                   /protein_id="CAP94309.1"
FT                   /db_xref="InterPro:IPR014870"
FT                   /db_xref="UniParc:UPI0001831C46"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC01"
FT                   /transl_table=1
FT                   /translation="MQLSLVVLAAVFQAAVSIASTLTPPVIPLVVRNPYLSTWLANARD
FT                   APWSKWPMFYTGEEVGLSLMAHLPSQKTVYPLLGKPHESLDDKSDYKTKFPKYLGLNYD
FT                   ASTTNLTYHIDTGTGNPLGITVSFLSPITPTSTLRQSIPASYVTIDVQGDVDVSIYMDV
FT                   DGRWVSGDTGSKIKWEIGNLETEQEGLALKRWQVQRENELLLSEIRDRAEWGTLHFTGP
FT                   CDAKFQSGYATDVRRGFASSGTLRNANDKKFRPIRDREPVFAFSKSFHLGHSSKVYDDS
FT                   VTFTLAFIQVPVVQYASSRGLTMMRPLWEAWYPTTEELLSFHYTDYAAASSLASNYSQQ
FT                   VADDAYLSGADDYVDIVALSARQVMGATTFSGTPDDPILFLKEISSNGNFQTIDVIFPA
FT                   FPFFLYTNPRWLAYLLEPLIEHMLSGQYPNKYAMHDLGTHFPNATGHPDGRDEYMPVEE
FT                   CGNILIMGLAIVNSLRYEDPTAASSIWSTQGLPSSSSKGETSGLFPLRDLQVVSGIAHQ
FT                   DSKWGGGSKGQHQAEKWVKRSYSLWKQWTGYLVEFSLEPANQLSTDDFAGWLALQTNLA
FT                   LKGIVGINAMSKIAEVAGHDADAAYFKKVASDYIAKWEEFGMSRDGSHAKLAYDWYGSW
FT                   TTIYNLYADAQLCFHLENTDTDSPGFVPRRIYQKQSLWYHYVRQKYGLPLDSRHMYTKT
FT                   DWEFFSMAVASKPVRSEILESVALWVNETTTDRPFTDLHNTEGDGGFPGPNFFARPVIG
FT                   GHFAFLALERACGGKAMPGLSFLDDVDNETLAVWAQSAESAAKEFTMSGRNRHGEGEL"
FT   sig_peptide     209786..209842
FT                   /db_xref="UniProtKB/TrEMBL:B6HC01 "
FT   mat_peptide     join(209843..210054,210120..210519,210573..211581,
FT                   211645..211775,211831..212454)
FT                   /db_xref="UniProtKB/TrEMBL:B6HC01 "
FT   CDS_pept        join(complement(214588..214608),complement(214428..214446),
FT                   complement(214126..214293),complement(213949..214069),
FT                   complement(213212..213827))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197305" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941250"
FT                   /orf_name="Pc18g00860"
FT                   /product="Pc18g00860 protein"
FT                   /protein_id="CAP94310.1"
FT                   /db_xref="InterPro:IPR019084"
FT                   /db_xref="UniParc:UPI0001831C47"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC02"
FT                   /transl_table=1
FT                   /translation="MADVRSKNLYELLGNDPELDPSRPAPPPTKAIDRPVDRSGKRDAP
FT                   KEQPARHTEANARRGGRVTGGNEAAYRDRNAGRNHNREKPTDEAAQPARRGRGGRNDRQ
FT                   SRTGQTDTRKQVQQGWGAESGEKTLDDERQGEKLAKKEESEPQTPAEAEEQEEPDNSKS
FT                   FADYLAEKAQRETLAAKPERTANEGSKLDKKWAAAKELTKEEEAAYIQPTHEKTKREKQ
FT                   RKEKNFLDVDLRYVEPPRSGPAPRGRGDRAPRGDRPARGGERSERGRGGPRGGDRAPRG
FT                   DRPARGGAAPRGNARGPAGPTVDEKNFPSLGGN"
FT   CDS_pept        complement(215350..216246)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142393" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941251"
FT                   /orf_name="Pc18g00870"
FT                   /product="Pc18g00870 protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAP94311.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831C48"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC03"
FT                   /transl_table=1
FT                   /translation="MHVFVTGATGFIGRAVVNELITTGHTVTGLARSDEGAAALTAKGV
FT                   RVLRGSFRDPEIIKQGASEADGVINLAFDHDFSKYAQNCLDEKKTIETIGSVLKGTNKP
FT                   LVTTSGTLGLTKGKVSTEDEVIDYEDPMKIRAQNEKVVSDLAEQNVRACVIRLPPTVHG
FT                   DEDHAFMNRLASLARSQGNAIYIDAGLNRWPAVHRLDAARLYRLALEKGVAGSMYHAVG
FT                   EEGVAMKDIAEAIGHSLGLPAASKTLEEAGSLDSFMSFVMSMDNPTSSKKTQEALGWEP
FT                   LNRKLLDDIKAGVYTQK"
FT   CDS_pept        join(complement(218570..218707),complement(218247..218463),
FT                   complement(217718..218191),complement(217381..217658))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197316" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941252"
FT                   /orf_name="Pc18g00880"
FT                   /product="Pc18g00880 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAP94312.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniParc:UPI0001831C49"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC04"
FT                   /transl_table=1
FT                   /translation="MDSIVPKHEPGPDGSVSSTVSTPDPEAEPLTQDAAQTQKRKGGRK
FT                   PIYATSEERKQRNRQAQAAFRERRTEYIRQLETTIKRNEESLQSLQQSHRSAADECLML
FT                   RYKNSLLERILLEKGIDVQAELRLKTGAPGAPPKANPMPPKAAPSAGARPNQRHPAGIA
FT                   SKPETFGMSQREGAYGIPSPQFQATPTSHVSSPSHAKSPGFGFQGAMSPVEGRPQLLPQ
FT                   PRTFSQTSPPAISMPQTEPSDPKPQSRGGAMGPRGARVAAAYYPSPFQKHYDQLEQEYD
FT                   AQADMVDEDHDGSASYVPGFTPQSVGSGSHNMSGFSQPSGEGTPNDFSNANQLLGQYEP
FT                   MLDTDPFGLSASMHFPTPFNYEHNNSRQ"
FT   CDS_pept        join(219538..219725,219795..219987)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670014"
FT                   /orf_name="Pc18g00890"
FT                   /product="Putative uncharacterized protein Pc18g00890 "
FT                   /protein_id="CAP94313.1"
FT                   /db_xref="UniParc:UPI0001831C4A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC34"
FT                   /transl_table=1
FT                   /translation="MPHDLMGPDPLGHLEANHTPLSTGCPRRPNEGSSWDDAPSPDLEG
FT                   MHCGFLLHGTARLKLCGGMCGGGCLPVYDLELDLIPSVLGLARSRQHTYVGTLYMDRVH
FT                   GPSLDLKDRALGQIVENTRVLF"
FT   CDS_pept        join(220262..220436,220520..221379,221444..221554)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197327" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975990"
FT                   /orf_name="Pc18g00900"
FT                   /product="Peroxin-19 Pex19-Penicillium chrysogenum "
FT                   /cellular_component="peroxisome"
FT                   /protein_id="CAP94314.1"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="InterPro:IPR006708"
FT                   /db_xref="UniParc:UPI0000F586EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC35"
FT                   /transl_table=1
FT                   /translation="MATPLPKDRPDEAPTVTTPQDSQPPNTNAAPAPEPAPAQSQQGVA
FT                   NDDDEDSDFDELDDVLDDFNKPKPAPPANPPAPSATKPDPSTGATHPDFDEDAFLKQLE
FT                   QDMANMMGGGGAGSSSDPNFQATVDQGADVFAKQLEESGIPPGDFLKQLLADVMAEEGG
FT                   SGAGASAENLAAAAAAAGISAPSTQGSSSTPAVGAGAEQPTDSFNDAIKRTMGRMKESG
FT                   DKATAAASNEDDISEDMLAQLLKAVEAGAAGAGEDGDLSKMFMGMMEQLSNKEMLYEPM
FT                   KELDVKFGPWIEKNKNSGKVSAEDMERFETQARVVKQIVEKFEEKSFSDDDPKCREYVW
FT                   ERMQEMQAAGSPPEELVSNPLMEDLGGAAAGAGGVPDCPQQ"
FT   CDS_pept        join(complement(222173..222785),complement(221805..222040))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197338" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941253"
FT                   /orf_name="Pc18g00910"
FT                   /product="Pc18g00910 protein"
FT                   /protein_id="CAP94315.1"
FT                   /db_xref="UniParc:UPI0001831C4B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC36"
FT                   /transl_table=1
FT                   /translation="MFATQSPQTPFRQTHYTPARSSPLRKHNTTPPIWTMSPTRSIQSA
FT                   SQSPAPNPFSNPPPTFNIQTEPLARHVQNHHSPIPMQFNASASASTTPTSSNPFLLHTQ
FT                   TPTSPSSPTRQKPKYEARYASTIANPLQGAAGLARSKTRKMFLNRVRNERDHGRFEARG
FT                   EQMMRMEHLADRRRWEESMARDGEGVIAGFEAEVDEDDMLPDDVHALDEFMSQEEAMEM
FT                   ALRETQSRVPGRVGDLRRNGPGSFSDDEYDDIFMGLSEPQGNQCQSHCQPQSQPQDMDM
FT                   S"
FT   CDS_pept        join(complement(223483..224181),complement(223178..223426))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076716" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941254"
FT                   /orf_name="Pc18g00920"
FT                   /product="Pc18g00920 protein"
FT                   /protein_id="CAP94316.1"
FT                   /db_xref="UniParc:UPI0001831C4C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC37"
FT                   /transl_table=1
FT                   /translation="MQLKPSTLALALSLFVSSTIAEDEELSSTLVGCDEVSCPKEGIND
FT                   RCTVEDNTFLGIGLSRIRDVPSSLEGFSLVKGVNVSDGLAGNDNDKPTRSFKSFYYLGT
FT                   PSDVETRDLSGCVVVFNDAPSKKFNQNGNDVRAASGSCSDVIDNTCIERLTEKATELAD
FT                   EADGNVCTSLERELKSASLDECNGFGNGGNLGNFTVKSLGDLNAVKNSSDCWPIQPKSD
FT                   QLMEIASITALNDNTATALYDEAYKITPVLTVFTGNDNSSLVDKTASQLTCLKVVTEED
FT                   PSDDEDSSENSAVAVKASGFAAGIAVLAGILALL"
FT   mat_peptide     join(complement(223483..224118),complement(223181..223426))
FT                   /db_xref="UniProtKB/TrEMBL:B6HC37 "
FT   sig_peptide     complement(224119..224181)
FT                   /db_xref="UniProtKB/TrEMBL:B6HC37 "
FT   CDS_pept        complement(225815..226609)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197349" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127039"
FT                   /orf_name="Pc18g00930"
FT                   /product="Pc18g00930 protein"
FT                   /protein_id="CAP94317.1"
FT                   /db_xref="InterPro:IPR007567"
FT                   /db_xref="UniParc:UPI0001831C4D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC38"
FT                   /transl_table=1
FT                   /translation="MRLSSLSLFIQALLLTAVAAQSAGVSNIVSDLTTETTSSSTSEAP
FT                   ETTPTTSSTSTSSKETSTEESTTSNEPTTTSTSSTADPTTTDPTTSASPSSTPEPTVPS
FT                   TTSNTEPTSTSSSDGDSTTSSRSTTTSQTPVVKTITSYATSDGSTVANVMTTTSTPVAE
FT                   PSLNADKGSGSSGVSSSDKKIIIGVVVGVGGAILIGALGLVFWRIHKKRNEQFGDEDDL
FT                   MGGTAVGSGPREKAPSPAGNTPFKNTLDQYHNPGPVNAASNF"
FT   mat_peptide     complement(225818..226549)
FT                   /db_xref="UniProtKB/TrEMBL:B6HC38 "
FT   sig_peptide     complement(226550..226609)
FT                   /db_xref="UniProtKB/TrEMBL:B6HC38 "
FT   CDS_pept        join(228987..229105,229165..229615)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822782"
FT                   /orf_name="Pc18g00940"
FT                   /product="Pc18g00940 protein"
FT                   /protein_id="CAP94318.1"
FT                   /db_xref="UniParc:UPI0001831C4E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC39"
FT                   /transl_table=1
FT                   /translation="MAETRSPPQVTTASLPVLDVHYEHKFKDYDLSDITHIVVHLSDTH
FT                   IRNIINSNTDISNEYNNQCYLDIVEKILSVTFFGNENQLEWLGSERHGGRKFVAFTNIK
FT                   NEEKWVQNQSLRYGKLEVIEVMFMRANPRETQKIFWRPARKIVFRRVLIKVRKSVGRAR
FT                   VRVGATRADMISQKLAYRLRKGSASA"
FT   CDS_pept        join(230891..231473,231623..231992,232043..232853)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198634" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822783"
FT                   /orf_name="Pc18g00950"
FT                   /product="Pc18g00950 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94319.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI0001831D28"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC40"
FT                   /transl_table=1
FT                   /translation="MTKGCYTCRRRRIICDNGQPTCRKCRDAGKECLGYQKPLVWVKGG
FT                   VASRGKMMGRSFDDLETPPSKPKRQPATETYDSTTTSSGFGFLSIAESPSDAESHSSGT
FT                   QPSPETDAWTFETENPTFGGEIAHLGVNSAEEQDTSIVHVPRGTPPADYIPTPWGLVDP
FT                   LLKDLSRLSRYYVHHCETSPMNYPWASLTITQSDSSVLPWSSGNLSMSVEEIEDIVAPA
FT                   SSRKPTSQAYHHFLEYKQRALRQLSMDLHNPAMQKDGRTLAAIVLLAFIDIFESGSGAW
FT                   SYHIEGAKKLLKDRPENGPGQGILDDLDAFALDGCLIMEIMGSTLARPGALSKPFYSSS
FT                   MGPEILKRLEENSWVGCPAYLLEVIFFLHALWYPDSEVAAITPQPTALPNAIQHSQPLT
FT                   LDSFASLLQGIRDFDPIAWSQEMQNVFFIPNLTYRLALATSYQNAVYLYTSRLLSRARE
FT                   GFSPPWADVGLPPDHKLIATNLITQICLIPDSDPHFKCLIWPTFIAGAECRPSQRGLIL
FT                   EKLGSLFEALTSVNVRNAAWVLRLMWQKQDLKRQECQNLSGEQGYDNNDYDIEFDWIEE
FT                   LDNTRLDWLFI"
FT   CDS_pept        join(complement(234414..236487),complement(233975..234345))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198645" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127040"
FT                   /orf_name="Pc18g00960"
FT                   /product="Pc18g00960 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP94320.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015746"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831D29"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC41"
FT                   /transl_table=1
FT                   /translation="MNGDLNLSQTLGGLRIANPDDSPLPTEDATAGSTGSSPLGGPDGS
FT                   VSTQHNPAHDEHPSAFPPAPIEVPVTDDRHTSFSQASTEIPPVQSGTYQPYSAPPLSTP
FT                   PNPNRPLSSVYVNGSATSVLPRDNTYRIRTDSGASSQSGSQARLDTRGGSSALHAGVLA
FT                   RDNSHSDRSYRTAQIPGNGPAVMRQSSRAQARSGGASQMPRTSYMAENGPMASSEDWQE
FT                   RGAAVSVRQEVDANGQTVSRYIKKGVRDFSFGSTLGEGSYSTVVFATDRQTLKEYAIKI
FT                   LDKRHIIKERKVKYVNIEKDTLNRLTDHPGIVRLYYTFQDEQSLYFVLDLCKGGELLGV
FT                   LKRMTTFDEECTRFYSAQILDTIDYMHKRGVIHRDLKPENVLLDSGMHVKITDFGTAKM
FT                   LKTPRADPNANGILPLDSAELPQEERASSFVGTAEYVSPELLTDKNACKASDLWAFGCI
FT                   IYQLLAGRPPFKAGNEYQTFQKIVALDYEFPIGFPTVARDLVERLLVLEPARRLQIEHI
FT                   KNHEFFDGITWGPDLWKQKAPRLKAYVPPARDPIKLNDNKNGESMPPVISTAPSNAPNA
FT                   SSRHLPRVVTELPPPSQLDIEWSPVLSKSNERILKLGNLVVLSSAASHSPTSKNSSGEF
FT                   EAPRKFSRFFTGSATKKRQRLVMVTTSGRIILAASGGDDKKIKLEIPLLAPGTSYRIKI
FT                   FHLIETPQREKHYVFEDPKPSSSNIGATALQVQEWLDALDRSREMASQQQSAGFSDDAF
FT                   RDLSSGFPSPANTLDRTSDMQKEPSSGRNHLVKQQATDTESTKGKKRFSRRHSKNGLAA
FT                   VF"
FT   CDS_pept        join(237134..237596,237656..237915)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941255"
FT                   /orf_name="Pc18g00970"
FT                   /product="Putative uncharacterized protein Pc18g00970 "
FT                   /protein_id="CAP94321.1"
FT                   /db_xref="UniParc:UPI0001831D2A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC42"
FT                   /transl_table=1
FT                   /translation="MIRRPPTIVALDENDVEYHLQRIYIRHTLTGAFEQLHLDESCDET
FT                   DRSPSSCISTDSDVDIDTTGLSQAGSCFESTSPKDRGYAFKDAIAHNSVTKSCLKSPIP
FT                   NQQSSLQVATPTRVNSQADRSVDPPRLKVKFALSPQELELHSKAPLEEETDRGCHGENH
FT                   RPSHTDAMYTPMSIDSPASTQVSFLSCGVSSSPATASVPPRDLTLASTMSYEAVLAEGA
FT                   ISPTSAANSIGEDSGSHT"
FT   CDS_pept        join(complement(241231..241247),complement(241109..241178),
FT                   complement(240923..241003),complement(240516..240866),
FT                   complement(239448..240455))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000133030" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941256"
FT                   /orf_name="Pc18g00980"
FT                   /product="Pc18g00980 protein"
FT                   /protein_id="CAP94322.1"
FT                   /db_xref="UniParc:UPI0001831D2B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC43"
FT                   /transl_table=1
FT                   /translation="MTHPDISVDVLVIGAGPTGLGAAKRLNQINGPSWMIIDSNETPGG
FT                   LASTDVTPEGFLYDVGGHVIFSHYKYFDDCIDEALPKEEDWYTHERISYVRCQEQWVPY
FT                   PFQNNISMLPKEEQVKCIDGMIDAALEARVSNTKPKDFDEWIVRMMGTGIADLFMRPYN
FT                   YKVWAVPTTKMQCAWLGERVAAPNVKAVTTNVILNKTAGNWGPNATFRFPARDGTGGIW
FT                   IAVANTIPKENTRYGPKNKVEKVNAYNKTVTLADGTTIGYGKLVSTMAVDYLAEAMNDT
FT                   ELMPLTKQLFYSSTHVIGVGIRGARPDRIGDKCWLYFPENDCPFYRATIFSNYSPHNQP
FT                   EASKKLPTIQLADGSKPKSTEPQEGPYWSVMLEVSESSMKPVNNETLLAESIQGLVNTQ
FT                   MLQPGDEIVSTYHRRFDHGYPTPTLEREGALTQILPKLQEKGIWSRGRFGSWRYEVGNQ
FT                   DHSFMLGVEAVDNIVNGAVELTLNYPDFVNGRQNTERRLVDGAQIFAKKQ"
FT   CDS_pept        join(241289..241304,241361..241438,241685..241729,
FT                   241849..241908,241956..242271,242374..242439,
FT                   242525..242633,242716..242793)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975991"
FT                   /orf_name="Pc18g00990"
FT                   /product="Putative uncharacterized protein Pc18g00990 "
FT                   /protein_id="CAP94323.1"
FT                   /db_xref="UniParc:UPI0001831D2C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC44"
FT                   /transl_table=1
FT                   /translation="MSCGRRIIKGKEAEEPKKKGKWEDNVTSQAKGGGSAPGLNLGDNY
FT                   LGYLQKQGPEVHAICIHLSHAGSPFWNARYHNQSPSRKIILEESKERGKRGDMDRGNPL
FT                   NLDCGQAKNATDVCIGTLLAMVKLVHNIVSVLRSLCGPPPSKVTLQQNEPILDFVRDGD
FT                   PSFIYIDSVVKGKQLESSRSNIRSVDRPIWREDLSAQVTDLTDRHRKGQTSRMTGEYYQ
FT                   LPLETPTSSPDCVNTAFRGRIAAFPTRKGPDGP"
FT   CDS_pept        join(243804..243931,243989..244056,244113..244744,
FT                   244808..245176)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170162" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941257"
FT                   /orf_name="Pc18g01000"
FT                   /product="Pc18g01000 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94324.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI0001831D2D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC45"
FT                   /transl_table=1
FT                   /translation="MSDGEKVRASGETPREQSLPTVNPAAEKTEQPSTTFHPAVYVTAW
FT                   ITLSSTVILFNKYLLDYANFRFPIILTTWHLSFATIMTQILARTTTILDGRKKVKMTGR
FT                   VYLRAIVPIGIMFSLSLICGNMTYLYLSVAFIQMLKATTPVAVLLATWGMGMAPANMKV
FT                   LANVSIIVIGVVIASFGEIKFNMVGFLFQIGGIVFEATRLVMVQGLLSSADFKMDPMVS
FT                   LYYFAPICAVMNGAVALFLEIPHVTMDHVYSVGIWLLVLNAVVAFLLNVSVVFLIGKTS
FT                   SLVMTLCGVLKDILLVAASMLLWQTPVTGLQFFGYSIALMGLVWYKLGGDKMREYTSSA
FT                   GRAWAEYGNNRPAQRKFVVFGAAALMFFLFVGSMAPSYANDSVDRVKGYLGGATAGNA"
FT   CDS_pept        246295..247407
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941258"
FT                   /orf_name="Pc18g01010"
FT                   /product="Pc18g01010 protein"
FT                   /protein_id="CAP94325.1"
FT                   /db_xref="UniParc:UPI0001831D2E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC46"
FT                   /transl_table=1
FT                   /translation="MCPMILNRLSDGPATVLSPPREHAFAQFSSQTSFLDSPGSFNGYP
FT                   ASSSTVFANNSSAQSNPSSFNFSPAPAVPKPSRKRSRDEATFEEAVAPSAPLKHQTPPA
FT                   PKVKPIYGEGMVLLNPQTGLAISAESQTGTWYEQEAEAQQAAAAPVSSRSNALLSDATD
FT                   VSRKSQRLDKSAPGLDDIALSSIRQRLDDPSSNDQHRTLNAGPVPPAEPLVDDATRLLG
FT                   IGWQRVNTDDDMAPAVRGWTKYIDNQYSAHLHDSQMLMKSRGLNAYLVAATPTSGSSPA
FT                   FYLFTEDLTQGQLVASSWEACLQNLRSSPIIFESPAPLGATDRPSAQPLSFNSMDTGVP
FT                   LLQQALSNNPQASSLDELSGGAETGMEIDS"
FT   CDS_pept        join(248176..248686,248730..248890)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975992"
FT                   /orf_name="Pc18g01020"
FT                   /product="Putative uncharacterized protein Pc18g01020 "
FT                   /protein_id="CAP94326.1"
FT                   /db_xref="UniParc:UPI0001831D2F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC47"
FT                   /transl_table=1
FT                   /translation="MEQEPFALVNVKNPDGIDKLSETEEEDSKSRELSIRKRVKESTKP
FT                   SDIGQENPTEQDDRYNRLVQRLESIERVIGTLTQKKRSTREETRIQREIVLNAWCKAPS
FT                   PTERGPNDTSYEGDIRADIRTIISKEKTDPATADRWKAVFLDRYGLHWGVDCGSHNELS
FT                   DVAKEMILIARGYSISVMTGFLVGGVVRFPISPRRTTASSADFITLDPVCNVSLPHRWN
FT                   V"
FT   CDS_pept        complement(249408..251627)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198688" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941259"
FT                   /orf_name="Pc18g01030"
FT                   /product="Pc18g01030 protein"
FT                   /function="transcription activator activity"
FT                   /function="translation initiation factor activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94327.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR011665"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniParc:UPI0001831D30"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC48"
FT                   /transl_table=1
FT                   /translation="MSAPRSGARPIPPRGPRPPVGRLASLKPPNSTPINRPTAIGRPQP
FT                   PRPTTHPKTSNCPNPGCPAPHIVDDGGMKVCTGCGTVISENNIVSEVTFGESSSGAAVV
FT                   QGSFVGEDQTHVRSYGPGFQRGGAMESREMTEQNGNRYMLQLSRALTIPESATKAAGQV
FT                   FKLAVGLNFIQGRRTKTVAAVCLYIACRRQNGNTVMLIDFADVLMINVFKLGRTYKALL
FT                   DELRLGGNVFLMNPIDPESLIYRFAKQLEFGPSLMAVAGEAVRIVQRMNRDWMTTGRRP
FT                   AGLCGAALILAARMNNFRRTVREVVYIVKVTETTISQRLNEFGSTESGELTVDQFRSVQ
FT                   LENTHDPPSFTRGREGRKSRVKRLPETAAELEDDDSPTESEAESVQPPRIDADGFAIPS
FT                   LPIDPALTATSHGRRASVIAKAVNEVVEDIKNEPVHSKGKGKREPTPEPSAEQVASEAA
FT                   LEDEMRSMLAQGSNMIESVGSEQPPRPTVSDSAEIDAAEFEDDPEVANCLLLPAEVEIK
FT                   ESIWVTENKEYLRAQQAKALKRALEESTGGGTPRKPRKRRRGRLGDVTYLEGEGEDGRS
FT                   SRASTPAEATRRMLERRGYSKKINYSLLDTLYGGEGGDAKAQSVSRSQSRSQSVVSRRS
FT                   ASIEPEAASRSRRATPSDAKFDAKFVRPSSTAPLPTPPSTAPITTLDAKPAMAKDGVDK
FT                   IEAHPEEDEEEDEEDDYDDYEKDDGVDDAFAGNYESDYDYGDDDD"
FT   CDS_pept        252638..256471
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000198689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941260"
FT                   /orf_name="Pc18g01040"
FT                   /product="Pc18g01040 protein"
FT                   /function="ATP binding"
FT                   /function="copper-exporting ATPase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94328.1"
FT                   /db_xref="GO:0004008"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001831D31"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC49"
FT                   /transl_table=1
FT                   /translation="MSSVPNKSSDSEAAHQDLDAQTSVFFVSNVHCASCVAYITEVLSE
FT                   TPTVNNIEVTILTHEVRASHSTAVRPADLINALIHAAFEVQYVTTFDQRGRLTAELDTS
FT                   SWNHRGSTLFSSPRTSVSSISSNIKERIQTSRHKRHIANCDACRKEELETFPRPSSSRT
FT                   ELGYLNEKSSQSPFRPLSRHNEQDISAAKLESTPENAVQESLRSFATSETKVQLDVPAP
FT                   RLPTDIAEIPSPSAESADEFTAQISIEGMSCASCANSITAQVQQLEFVKETIVNLLTNS
FT                   ATVIYVGPRGNVDEIVEQINDAGFNASLEEVNQAPKLPASAELVANYVSEIAITGMTCG
FT                   SCVGGVTRGLEELPFIRDVSVNLLSHSGRVEFEGRDNLDKIIEKIEDLGYDATVTSVSP
FT                   LKVGTEKFSTAQIRTISIQVDGMFCHHCPQTILGAVKSVPDVTIEEALSEKSPILKVTY
FT                   TPQPPLVTVRTIISAINSANDNFRAIVYHPPSIEDRSRAIQHHERSRLLARFLFVFITA
FT                   IPTFLIGIVFMSLVSSENSVRMYLEQTMWSGSVSRIEWALFIMTTPVMFYGTDVFHARA
FT                   VKEIYALWRPGSRVPILRRFYRFGSMNLLISAGTSVAYVSSLAVLIVDAVVGTKSSPHS
FT                   TTYFDSVVFLTLFILAGRFLEAYSKAKTGDAVTSLGKLRPSEALLSDDTSEDGVKRTIV
FT                   DLLEVGDVVSIPHGASPPADGVIVDRASYQFDESSLTGESRPVKKTADDMVYTGSVNVG
FT                   QPVRICITELGGSSMLDQIIAVVREGQSKRAPVERVADLLTSHFVPLITLIAISTFIIW
FT                   LALGHSGVLPADYLDVAHGGWTFWALEFAVAVFVVACPCGLALAAPTALFVGGGLAAKH
FT                   GILVKGGGEAFQEASRLNAIVFDKTGTLTEGGSLKVSDHEILTSDPEVAKIAWALARKM
FT                   EETSNHPIAQAITEFCKTQQSSSVKSSDVLEISGQGMKGNFTVSGSEDEEQYEAAIGNE
FT                   RLLKSLVSPETDTYFVSNLLAKYQSAGKSTAVLSLRQVHRSSTESSKFIPAIIFATSDT
FT                   IRPEAVDVISQLQKRHVDVFMCTGDNQTTAHAVADMLGIPRSKVMANVLPAEKASFVRQ
FT                   IQERSPNATPADGETSPTSSTPRPIVAFVGDGVNDSPALAAADVSIAMASGSDVAINSA
FT                   SFILLNSDLSTILQLVLLSRRVFNRVRMNFGWAVIYNLCLVPVAAGVLYPIVSGHHKKT
FT                   IDGEMIMVNEHWRLSPVWAALAMALSSISVVLSSLALRIDKESIMKIVRRKK"
FT   CDS_pept        join(complement(258366..258457),complement(258146..258315),
FT                   complement(256579..258086))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198700" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670015"
FT                   /orf_name="Pc18g01050"
FT                   /product="Pc18g01050 protein"
FT                   /function="DNA binding"
FT                   /function="nuclease activity"
FT                   /biological_process="DNA metabolic process"
FT                   /protein_id="CAP94329.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="GO:0006259"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR020819"
FT                   /db_xref="UniParc:UPI0001831D32"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC50"
FT                   /transl_table=1
FT                   /translation="MSEECANPLLLGWIKEWLDQARERNSKGVTVYKKAYESMKACPLE
FT                   FQHPSQAQQLNGLGPKLCDRLTDKLKAHCQENGLPMPEPPEKGGKRTSEGGIDQPAKKP
FT                   RKAKPYVPTLRSGPYALMLGLGTQDENASQGMTKAQLIEVAQPYCDSSFTAPPDPTKFY
FT                   TAWNSMKTLIQKDLVYEHGRPLRKYLLSEEGWEVAKRLQKTLPGATQPATSGSQATATT
FT                   ESQQGALTPEFDSLQQEDDPSADVQENLSEQDIANIEPIFFPPKSFTIQLVLDTREVRT
FT                   STDRDYISGELMKQGITPQVRALEVGDAMWVAKCHDPNFLTRHGEEGDEVMLDWIVERK
FT                   RLDDLIGSIKDGRFHEQKFRLRRSGIKNVIYLIEEFAVTHPDSTSGSAAQYQEMVASAI
FT                   ASTQVVNQYFIKKTKHLDESIRYLARMTLLLRKMYGVEDAPSTGNADTNINRSTVTPSP
FT                   LSKIGLIPGRRLSTDSYLTILDNLRSRDPSITYGVSFVTFSALTSKSDVLTLRDVFLKM
FT                   LMCTRGVTGEKALEIQQIWPTPRHLVDAYLALEPKERETMIATRMSEVVGRKKVAKDLS
FT                   KRIAEVWGEANLF"
FT   CDS_pept        258948..259464
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941261"
FT                   /orf_name="Pc18g01060"
FT                   /product="Pc18g01060 protein"
FT                   /protein_id="CAP94330.1"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI0001831D33"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC51"
FT                   /transl_table=1
FT                   /translation="LKVXKVKIPRIYTKAIKSDFKDKWYKVMTIQLGKLXDTKAYKIVS
FT                   KPPLGSIVLPRKWVFDLKINKDNEVXEFQARXVIYGNRXRPGYDFNKNYAPVTHRETIR
FT                   LFLSIVAINKMIIEXVDYTVAYLNTIIDRRVIFIKQLTGFKTRGLDREKKDKVCLLLXA
FT                   LYRLRQVGYLWYETLANTLRKIGFQPLLDKPYIWIHEEKXIXILLYMDNTLIATFKVVE
FT                   IDWFKTIIPFRYKDLRKPARFLGSSLSXDENGIFLNQAIYTKEVIIKSRLXDISYIYLP
FT                   IKIGYKCLDIIRDPKDKDVRGXNDKDIXKGXNDKDIQREXNDDNNIALXVYNKPSVLKE
FT                   EALAFIEDISKLGXLADKSRPDIAVAINKLXRRTATPRXEDIDTLKXLIRYLEGIKNLR
FT                   ILLGKSNENLIGYVNVSYXDCEDRKSTEAYIFFYARSLISWNSRKEEIVARSSISAEYV
FT                   IIDSVVREAIXLYKVMKQIGIHXDLLITIFTDSDNAYTIIKKDNFVKAIKWLDIRYHFV
FT                   RHIVRTSIISFTLILSAENIADALTKPLGREQFEKMRKVMMYSDGKNXGLHTL"
FT   CDS_pept        join(complement(259784..260197),complement(259607..259648))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217748" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670016"
FT                   /orf_name="Pc18g01070"
FT                   /product="Pc18g01070 protein"
FT                   /protein_id="CAP94331.1"
FT                   /db_xref="UniParc:UPI0001831E17"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC52"
FT                   /transl_table=1
FT                   /translation="MPTQISLLVYKGVPVDFSKYRHTALHALYPDGQHDWLHAVGAHPF
FT                   FKFQKDSENPMSEPPIAWIPVCTVPDSVTKAKIIFACACTPVHNSNSDRDWNCQNWVGE
FT                   ALTELVKIGCLTKEERRAAIGKMVETILEAELEDGHVTNALNDQGHP"
FT   CDS_pept        complement(260485..261435)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000218208" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941262"
FT                   /orf_name="Pc18g01080"
FT                   /product="Pc18g01080 protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAP94332.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831E18"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC53"
FT                   /transl_table=1
FT                   /translation="MHVLITGAAGFIGQLLAKELLNDPDYRVTLTDIHQPPIPAGVRYP
FT                   QSATAVKADLLTGARDVVDPSLDAVYAFHGIMSSGSEGNFDLGMSVNIDATRNLLEALR
FT                   HTCPGVRVIYSSSQAVYGQPLPEIVTDSVIPTPESSYGAEKIVCETLVNEYTRRNFITG
FT                   FTLRFPTISVRPGAPTAAASSFLSGMIREPLDGKECVIPIEDRQFKSWLCSPKTLLENL
FT                   LLTLRLPVDSVPPHIRQINVPGICVTVQDMMDALEAVGGADKLALLTEKEDPALVPILK
FT                   SWPTQFDNTQAISLGFKRDESFEQTVRDYKQSLSQ"
FT   mat_peptide     complement(260488..261384)
FT                   /db_xref="UniProtKB/TrEMBL:B6HC53 "
FT   sig_peptide     complement(261385..261435)
FT                   /db_xref="UniProtKB/TrEMBL:B6HC53 "
FT   CDS_pept        join(262141..262243,262291..262423,262504..263582,
FT                   263649..264289)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000193831" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127041"
FT                   /orf_name="Pc18g01090"
FT                   /product="Pc18g01090 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94333.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831E19"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC54"
FT                   /transl_table=1
FT                   /translation="MDTTPLKRSPDDAGFGSPRENKARSVPKISKARACAECKRHKIRC
FT                   EFRAGESTCTKCTRSGIKCVVNDFSQKFVDDDVIWKSQANATMNQLQAAVSHLLRQAGL
FT                   PELSTYAPGDTLNGPSPAASYHGHNPSVDRSQTQTSRQEGLGVVMDVTREPSPEQDLQD
FT                   PELVPAPMRSLYEVTKLRNLRNNHVEAPKQTLLEEDFISRRLISLHEAEELFAYFSRTM
FT                   NQLLWGGIILVHRDLTSVRRASTLLSAAVLTVAALHIPNRTETLNRCYSEYVSLVSNMA
FT                   LTRAHTLDDIRGLCVGAFWLSELSWKLSGHAVRIATEMGLHQSYQRLTRGHTDQYERAQ
FT                   LWYLLYVCDHHFSIAYGRPPVIHEDVVIRNYETFLALPMVVPGDIRLLAQVALFMILTE
FT                   AYRMFGSDTEQALTDEDFGQLRVYNVAVDQWRLLWQPRSADSAYVRTYPSKGVVLHYHF
FT                   AKFQLNSLALRALSPSNTPVFSMDRKESANIAISSAMACLNMVLEEPDIRDAIVGVPIF
FT                   THTMVTFSAVFLLKVAINWNTAYLSINSRQVRRLVERVIELMNCVSAGERHLTRHIARG
FT                   LGKMLERFDSWEAAWQFQGSNDTAVEGRDVPGGANAMAQGFPPPDLIYGMVGTYGFGLD
FT                   ENLLDPSMADFDFLAQ"
FT   CDS_pept        join(264681..264760,264964..265109,265193..265428)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941263"
FT                   /orf_name="Pc18g01100"
FT                   /product="Pc18g01100 protein"
FT                   /protein_id="CAP94334.1"
FT                   /db_xref="UniParc:UPI0001831E1A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC55"
FT                   /transl_table=1
FT                   /translation="MTTRKRKAEAQEELQALPSDESEEEEEYEDSEPEVEEGSEESEQG
FT                   EVEGESESEEEEEGEEQAEEKPKAEAKDKEGAPAAKKQKTAPTEKGAEAENGAKGEEDE
FT                   EPEEEEGEEESAADTAKESGPAAAAAQAKGGDVPKESDLPEAEAAKEEK"
FT   CDS_pept        join(complement(268475..268497),complement(268219..268348),
FT                   complement(268014..268138),complement(267680..267960),
FT                   complement(266689..267632),complement(266255..266629),
FT                   complement(266030..266197))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198711" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941264"
FT                   /orf_name="Pc18g01110"
FT                   /product="Pc18g01110 protein"
FT                   /function="binding"
FT                   /protein_id="CAP94335.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015374"
FT                   /db_xref="UniParc:UPI0001831E1B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC56"
FT                   /transl_table=1
FT                   /translation="MVAPAVPEIHEEEDIYVAVDARTESLQSLRELGPPDLVYLVKQPK
FT                   ANSTRQTGVYHHVTGIDASSSASLAAYVNTLTFSPLDKTHKVVSGIYCCYNAFSHLDMR
FT                   VEVKIPGSLESYCIDERGDKRVATEALWLETFLCAVLRAYLYADDGSGDSVKRIVGVRR
FT                   FNPVTNTEMEHKFLDAAEKLFFLGRQLSSDPETQVPNTVSNHLTSGILKYIHTTGRYTS
FT                   GINLFEKLRTKDVEVSSLLARVQIMADEEVQAVRLMYDALQDVPMDYALLDCQASFCQS
FT                   KGESEMALECAKRAVTAAPSEFSTWARLAEVYVSMERWDLALLTLNSCPMFTYQDKDTP
FT                   RMPQPSRIMLPILAESILDEIDEGQPKQGDPHDYVHPSLRKIHAANYQGTFLKAYNLLT
FT                   KIAAAIGWDQLLKARSQVFVMEEEYRVERQHVSKPATSSGAETNGNSPGHEDDSGSVAG
FT                   PGPAEPSSEEIANGDAGENHTESPLERPEQTVASEVVKSGKEDPDPSHASYTQFRNKRL
FT                   CERWLDNLFMVLYEDLRIYTIWRTEMAQFRQQAMEYKKSATEWEILGELAQRLHHFDES
FT                   IEAYQSCLATRFSPKAMRGVLKLYEQRNDTRGILGALIRLIAWQYRWYSEFSPELLFLV
FT                   RKLIEDEGAVKVRSIVQATNLPQPVLDLTHQYCQLCATFRSSGSDT"
FT   CDS_pept        join(268854..273115,273180..273402,273445..273609,
FT                   273669..274994)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198722" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823016"
FT                   /orf_name="Pc18g01120"
FT                   /product="Pc18g01120 protein"
FT                   /function="binding"
FT                   /protein_id="CAP94336.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI0001831E1C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC57"
FT                   /transl_table=1
FT                   /translation="MSSWVALNVEPDEAVEEEVDDTKELQIEEALKLYHNALKLHSQGP
FT                   EHYSQAAEAYEALLNSEIFKYPESISDFKRGAFDDAHDAHDEIATEPIAEFNVNDSTSS
FT                   LFQMLYLSYKNHGKFVLDSVQDSIRTAPQTPESEEETQRKLTEASRKALGSFGDALERD
FT                   DSDLNLWRQSARLSSSLNSYRLSRYCLESVLADDDNRLELRSEQLGLEEIFAEQRLRST
FT                   LQSLFDKLSASQIPDQRPKKALLKYLKQHEDPYPNLPALPADLRRLNPSKGPLALHAFR
FT                   REISPADPTWESVGKALLQALHDEDDESLAAVPSRSIRIILPTGSSHAPTTPIANAEDA
FT                   EMTIDTEGRGNKGGNEVADVILEITENDGKPEQTSPQPAKEPSEPGEEHSSIDQSAEKQ
FT                   LMESLERQSTQPQDQQTEQDGNHAEEVDTNSAMDIRKRSSASAANEEPEGGRMKSRRTR
FT                   ARESNADTLAPPEEVAFDQDKYYGDRLEIFINADDWMFSTVDSLFSKVGIDALGSIEAL
FT                   REKCPANDSTDTPQDLETRLFQDFRGLIKTWDDEKSRLMQQKDDLSPLKDIRGTSKSGL
FT                   AVFLEHSRKAVRKPVIEEELPSGEQLYKFSSAINSDWLHPHETSFEWLKCLLMPDFGQA
FT                   SSNWSTAKSTYVCFMWPKELKKTVVELLVRDDGFIYQACSEVISNLEARILGSSDGAPF
FT                   EYKAKDFFELEMIQAIYELHLDVFASVEGLGSETDQETRLAQRDRLARWGMLARSSIDH
FT                   FVSHCPSGESQSNLTLRHLWASAFHINLAADAQREHILLCLHDLKQILQSLGNPSVSLI
FT                   NNTTMSELSAAVIDQEVLKLKCMDFFAKVFNSDSEDPVTLIEAIEPILEPSSIEYAETP
FT                   TENDVDHPTSHLGEMAAFLDRGDATLRLFLWRRLQEAYQAIDYPPKVVSCYLRSIEVVM
FT                   AELEAAKHSEETSQHRQIALLGWLKALDGIVAKAILLILEDSEQVFDCLDMEHLQTSMS
FT                   AIARLVRLLHSFILYEDLVRVGQISGRDFRGSLAKSLENMKERMRELYVRCWILQYTLF
FT                   MEAIAQNKELFDDPLEDRIHFLRSVHNALGVRSMCRYSQKRFLKLLKAEIFGLETKGDY
FT                   EFDVCQILLDLHGIKFSAFDGTVDHGCPPEKLDRPTAILMIDFVLQQANKMNMKDLSKS
FT                   ELKTTIEKMQQAIGPAKASSQTPQLTFNRRLVNSYLKAPLNPSNLLRAVQGVTELSTTI
FT                   VPTENAKIAAKGWFFLLGHAALTKFRSQKRLSPGSTSELDDAIGFFRQDLDHGTGRWET
FT                   WYRLAQTYDSKLDEDITWTADKINNNRSDLAALQRNAIHCYAMAVSTAMRSAEPTAETR
FT                   EAMSDLYSDFGIRLYSSSREPLSMGAFSVADFPRHFSSEESQQMYKGTPFKEMSAYSTW
FT                   NFASNLLKRAAIDKSKRWMTHYTLAKCLWKMFTSDDSLRTTSKRVEMPEVINAVLDAIA
FT                   ALPQRRDSRSDPIFEPHFKLFSFVHKLVARGNMTQHQPAEGSKTLLATPWARKIEPPEN
FT                   MEGWNTYILEVLRKYKSADKSNWHHRMGVKAAHVIYDDQQNATAAIAAKQELSQIFTKT
FT                   LTIQVWRPEFERPGRHFVYTTRYVYFFVGLLDQLDDRASLDQLLRRVRKKQGDFFNHTK
FT                   LWEDICLTYAKIIRRAAKINEGHEESVFKPIGWEEFSTKTARLESLPHLGLESRSILER
FT                   LRDALELKKLNNNLMKITMFEDLIADLYARLYEINTPHLVEQATEENKEKMKVDHVLMG
FT                   GDGPPETSTPPTSVPASDTPAPRGRTKGIARRDIQKRADTIVNTKLAPRTVASKITAAG
FT                   EPEPPATPQGVGSTTAGPSSAPPSSAKQVSITGDGSAEQMDEHDTADETGLSENDDTKL
FT                   GDEGASVLFPHVTDAEEGNTGDEGADEGDGEDDEGVHENEGEGEGDGDGDGDHGVAEGE
FT                   GDDDEEMQDEETKLEEEDKEEKEIPAADQSANDTETEHVADKRDTGEQDGMDITPSES"
FT   CDS_pept        join(complement(277729..278079),complement(276620..277670),
FT                   complement(276446..276573),complement(275868..276392),
FT                   complement(275756..275816),complement(275378..275697))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000198734" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976238"
FT                   /orf_name="Pc18g01130"
FT                   /product="Pc18g01130 protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="CAP94337.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI0001831E1D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC58"
FT                   /transl_table=1
FT                   /translation="MPPKQPQTSLFQVYLRLRPPMAQKPNESDRFLNVELPDVSQEETE
FT                   IVSLGPTHITLQPPNDTRRRAVERFGFTKVFEEAASQLDVFHDTGMEPIIRGVLKENRD
FT                   GLVATLGVTGSGKSHTILGSKTERGMTQMALDVIFRSLEPTTKADYDSITPVMLASLAA
FT                   ADASEAQLFSAQTFLEAVYGEPNGRTSRAQTPMSPSRANTPLMVRSPFTLNSPQGSPTP
FT                   RSRTPGSSLPIPRSKPGSPHKADSSPITSSNDAARAGFRQVSTEPSGWITPGFSNPIPY
FT                   THSNLFEPKSAKSRLYVFKEPTPALNFPRRHIRERPCALPRLPDMSHLTVDMDSNADYV
FT                   VLVSMYEVYNDRIFDLLSPSIVSGQGTMSRGNNQKDRRRPLLFKPTEGSPDRKLVAGLR
FT                   KIACSSYEEALAILDVGLTERKVTGTGMNSVSSRSHGFFSLEIKKRTWSKRTGEHNWAG
FT                   STLTVVDLAGSERARTAKTAGATLAEAGKINESLMYLGQCLQMQSNIQDGMKTALVPYR
FT                   QCKLTELLFSNSFPSPHQMSKGQYPQKGIMIVTADPLGDFNATSQILRYSALAREVTVP
FT                   RVPSVCESILSVASGSHRSASGCTSPNFDSSGELERAAAEIARLTRGCHGLAVKLAEEE
FT                   IARSDAEMRLRAAEERCLTIEQDVREECWAEMDEKTEEERRRWQRAWDEQIGRNDEHID
FT                   KKVELVSRGFQIFEDSGPNERVEELEQENDQLRRKLAALERETHNQSPTRKHRPKNATP
FT                   ARSNLLGRESDIENALQRMDQLKLADTMFAPPSPGAPPMKRTRKMGTRKWDLAPEDQI"
FT   CDS_pept        join(278844..278868,278922..279021,279071..279220,
FT                   279291..280038)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000198745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942298"
FT                   /orf_name="Pc18g01140"
FT                   /product="Pc18g01140 protein"
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94338.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI0001831E1E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC59"
FT                   /transl_table=1
FT                   /translation="MLEARSAYQEGSLWFYAPNKGAAIAFAILFAISGGLHGYQCYKYK
FT                   SWKVTGFLPWSALLFTAGFITRTIGAFGQWGNIGIFIASTVLLLAGPPVYEGANFFILG
FT                   RILYYIPYHSPIHPGRVFTTFIALGVVIESITANGAVLVARTDSSVSSQNTGKALLKAA
FT                   LIMQIFLMVGFVSLAGRFHFNCVRGRVLNHKIKSALLVLYCSCTLITIRTIFRTVEYFT
FT                   AASLDAYSDIENISPLLKQEWFFWFFEVVFMYSNTTLLNVFHPMHWLPRSNKIYLAEDG
FT                   VTEIEGPGYDDPRHWLQTFIDPFDVYGLIVKRGKKENYWEANPTRREGTTAKTTHGVGV
FT                   "
FT   sig_peptide     join(278844..278868,278922..279010)
FT                   /db_xref="UniProtKB/TrEMBL:B6HC59 "
FT   mat_peptide     join(279011..279021,279071..279220,279291..280035)
FT                   /db_xref="UniProtKB/TrEMBL:B6HC59 "
FT   CDS_pept        join(complement(281741..281946),complement(281662..281683),
FT                   complement(281530..281603),complement(281152..281481),
FT                   complement(280199..281102))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670271"
FT                   /orf_name="Pc18g01150"
FT                   /product="Pc18g01150 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP94339.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831E1F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC60"
FT                   /transl_table=1
FT                   /translation="MQFISSESTLSTGESEPSAVELLHDHCLEITPDGRYVRWLGDHPR
FT                   HPRNWSGLRKTYDIVLICLLDLFITASSTAGSAAAAQAKHEYNISETLSIFIFVTIFLL
FT                   GQVAGTILFPPWSETFGRKNMYIVSSGLSAICCMIIGLVRSMPVIIIMRITAGLLSAIP
FT                   YTIIGGSIEDMFNSHARIWAMYYWTIASNIGLILGPIMSSYIIAGLGWRWNFYIFAIIV
FT                   AAITGGLFFIRESRPSLLLAYEVKRVTDMTTVQYIPPPLNHDHTPDLNTFVKEALFRPA
FT                   QLFFQEPIIFVIAVMISVAMSLIYIFTEALQPIYESMGFAKTDASLMFIAIGLGTCLSA
FT                   LTRMLDSYILNYFRRQGRPIKPEYKLVGLGLGGPFLAIGLWWFAWTIPPETQTPWIVPT
FT                   MSLVLVGYALTEMDTVLYGYISDSYLSCSASATAAVAFVRALLSGAFPLFTPQMFDRLG
FT                   NNVAMSVLAAVATAFCIVPPVFICYGERIRRASKFARYSWEIQEELGKEKEDW"
FT   CDS_pept        join(complement(283106..283240),complement(282676..282873))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823017"
FT                   /orf_name="Pc18g01160"
FT                   /product="Putative uncharacterized protein Pc18g01160 "
FT                   /protein_id="CAP94340.1"
FT                   /db_xref="UniParc:UPI0001831E20"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC61"
FT                   /transl_table=1
FT                   /translation="MEKEDTYCVQLIRLVGLCFDRARGCGEVASSEIALAQIHCLSALQ
FT                   NNRLNRLDLTAQGKSGICMLSSELFELDELVSTNIRKIPEACSQAQGSYCARRMQYSSR
FT                   KWLLAC"
FT   CDS_pept        join(283355..283508,283564..283736,283908..283950,
FT                   284008..284165)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111516" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823018"
FT                   /orf_name="Pc18g01170"
FT                   /product="Pc18g01170 protein"
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94341.1"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="UniParc:UPI0001831E21"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC89"
FT                   /transl_table=1
FT                   /translation="MLSSLSSSITNARQSIAQVLNFALVLSTAFMMWKGLSVVSASSSP
FT                   IVVVLSGSMEPAFQRGDLLFLWNRDTRTEIGEVLVYNVRGKSIPIVHRVVRTFPEVEGR
FT                   ASAKKGDNNLADDTELYAQDQDYLDRAEDIVGSVRGYIPMVGYVTIMLSEHPWLKTVML
FT                   GLMGLMVMIQRE"
FT   sig_peptide     283355..283477
FT                   /db_xref="UniProtKB/TrEMBL:B6HC89 "
FT   mat_peptide     join(283478..283508,283564..283736,283908..283950,
FT                   284008..284162)
FT                   /db_xref="UniProtKB/TrEMBL:B6HC89 "
FT   CDS_pept        join(284541..284567,284636..284752,284881..285195)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942299"
FT                   /orf_name="Pc18g01180"
FT                   /product="Pc18g01180 protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAP94342.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0001831E22"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC90"
FT                   /transl_table=1
FT                   /translation="MGSIKRISKELTELTESPPEGITVELADESNVYEWKVIMEGPESS
FT                   PYYNGKFLVKLSLPTEYPFKPPTVSFATKIYHPNVTNDEKGSMCLGMLRADEWKPSSKI
FT                   AAVLQFARQLLSEPMPDDAVEGRIAEQYKNDRGRYEEVAREWTRKHAC"
FT   CDS_pept        complement(287018..287662)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(288951..288986),complement(288552..288884))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942300"
FT                   /orf_name="Pc18g01200"
FT                   /product="Putative uncharacterized protein Pc18g01200 "
FT                   /protein_id="CAP94344.1"
FT                   /db_xref="UniParc:UPI0001831E23"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC91"
FT                   /transl_table=1
FT                   /translation="MSSTRLTHVPQAVLNLSGDLEELVYTKTAIGIYDRTMLSIINSTT
FT                   TPAQLNLHRGSWLQAKSKVASLHRSIVADFKLLPRHMRRSFVRANRSTLCEHGFRPSVD
FT                   NLGITRPGSRSQDVVIVL"
FT   CDS_pept        290022..290861
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670272"
FT                   /orf_name="Pc18g01210"
FT                   /product="Pc18g01210 protein"
FT                   /protein_id="CAP94345.1"
FT                   /db_xref="UniParc:UPI0001831E24"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC92"
FT                   /transl_table=1
FT                   /translation="MAKTQGSCDLDLDRSFLKDLPASIKRYTYHGEEQFLDVFQTELTH
FT                   FEASTEASGFLLFHASKEVIETLSDPENIENDDNPISRVCSSYDLSEQLFLVAMRTGPH
FT                   AAAGDLVSTVIREAITPMNLSTSLQGYTGKTTRGRSRGKTPDYSWRPRQPGQPSSPSVT
FT                   LEVAWSESDSKLNSDVRFWLNPDDSDTNICLTLRINRSRPEIRIEKWERQNDKAHRSQI
FT                   IWITRNKNQTHVSDHPLVIPFESLFRRNPTGPAERDLAISQQQLVFVAEALWEEQEL"
FT   CDS_pept        join(complement(292589..292696),complement(292125..292538),
FT                   complement(291499..292059))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000227794" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942301"
FT                   /orf_name="Pc18g01220"
FT                   /product="Pc18g01220 protein"
FT                   /function="fructose-bisphosphate aldolase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAP94346.1"
FT                   /db_xref="GO:0004332"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00018310E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC93"
FT                   /transl_table=1
FT                   /translation="MGVLEQLNRKSGVIVGDDVLRLFEYAKQKGFAIPAINVTSSSTVV
FT                   SSLEAARDQNCPVILQVSQGGAAFFAGKGVSNDGQKASIAGSIAAAHYIRSVSTAYDIP
FT                   VILHTDHCAKKLLPWLDGMLDADEAYFKLHGEPLFSSHMIDLSEEPVDYNINTTAAYLK
FT                   RAAPMKQWLEMEIGITGGEEDGVNNEDVDNNSLYTQPEDILAIQNTLSAISPYFSIAAG
FT                   FGNVHGVYKPGNVKLHPELLSKHQKYVKEQTGSSSDKPVFFVFHGGSGSSKEEFKEAIS
FT                   YGVVKVNVDTDMQYAYLTGVRDFVLNKKDYLMSQVGNPDGADKPNKKNFDPRVWVREGE
FT                   KTMSKRVKEALEDFNTAGQL"
FT   CDS_pept        complement(293726..295585)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197917" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942302"
FT                   /orf_name="Pc18g01230"
FT                   /product="Pc18g01230 protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAP94347.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI00018310E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC94"
FT                   /transl_table=1
FT                   /translation="MQEKPTTVAAYAAGASLAAVALFYVFGPNYTIDGDESNDSNRKKS
FT                   IVGLSNLANDCFINSVLQALAGLGDLRVYLIHELHRRELDGPEIYHTLPSEDGLSPARS
FT                   DKLRELQQGITTRALKEMLDRLNERPIYKKTISARDFIQALEYAFRTRISRNQQDAQEF
FT                   LQIVLERLCDEYHAGARARQRALGTMGAAGSSSAGEEGSAQESSSEVEVRIDDGSANGL
FT                   PAIIDTKLKEIDQESGFPFEGKMESQIECQFCHYQYKPNQTAFVNLTLQVPQKSSTTLN
FT                   SCFDGLLKTEYIEDFRCDRCRLQHAVEAKTTELTRARIQGDRDRLDQEISRLREALETD
FT                   PEAELEGIVFPPSETAPKRRIARHMRITAFPKVIAIHLSRSIFDQSSSSKNAAKVSFPE
FT                   RLPLGSILSQKWYKLLAIVCHKGSHHSGHYESFRRNHIYPPFSTPEVFSSYAQSRTASQ
FT                   SPSAAPSPRIVPRSSPDVEGDASISRAGSSTSLSGASATQLTPPQPRPTTSGSRRSFQS
FT                   TTSRSSKQALSPVSGSNSPTTDQGRWSPAAPRPSHSIPRPSQDTPTVSSRLRRRRKPND
FT                   RWWRISDEKIKECKTSDVLGMQREVYLLFYELEKPDASPTMGR"
FT   CDS_pept        join(complement(298254..298314),complement(298113..298193),
FT                   complement(298019..298035),complement(297720..297960),
FT                   complement(297628..297654),complement(297401..297573),
FT                   complement(297251..297347),complement(297112..297186),
FT                   complement(296976..297048),complement(296640..296922))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000143704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976239"
FT                   /orf_name="Pc18g01240"
FT                   /product="Pc18g01240 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94348.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018310EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC95"
FT                   /transl_table=1
FT                   /translation="MAGQKIWLRAETKPAEARSALTPTTCKALIDAGYDVTVERSTQRI
FT                   FDDEEFSKIGAPLVEEGSWVQDAPKDAVILGLKELPEDDFPLEHVHVTFAHCFKQQGGW
FT                   EKVLSRWPRGKGTLLDLEFLTDDSGRRVAAFGWSAGYAGSALAVKNWAWQLTHPNETLP
FT                   GEVPYANQDRLVESVKESLEAGKKVAGRSPKILVIGALGRCGSGAVQLAKDVGIPEANI
FT                   IQWDMAETARGGPFKEISHEADIFVNCIYLSAKIPPFVNVESLSAPNRTLSVICDVSAD
FT                   TSNPLNPIPLYDITTTFDKPTVPVSGLEAGGPPLSVISIDHLPSLLPRESSEMFSEALL
FT                   PSLLTLNDRANARVWKQAEQLFDEKVATLPKSLQA"
FT   CDS_pept        join(complement(299615..299657),complement(298892..299472))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670273"
FT                   /orf_name="Pc18g01250"
FT                   /product="Putative uncharacterized protein Pc18g01250 "
FT                   /protein_id="CAP94349.1"
FT                   /db_xref="UniParc:UPI00018310EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC96"
FT                   /transl_table=1
FT                   /translation="MATEGAPMQNNAASDADQRDIAVRDTAQLVREHSHAFQNRLNTTQ
FT                   TDSPPIPEAERSDIDTDQPKADAGLEAREPAPETEPPATEPAGPAQGSIPVDRKSQIPV
FT                   GPKGEIVAGDKRVIDSTVTPTPAQPEDEQRTIEPSDEPNTKKLKTEDKPVTDSNGTAAA
FT                   PSNTGNGGQKKASRSKKEKIKDVVNKVIPGDGIGSRTRSRTKGS"
FT   CDS_pept        complement(300642..301856)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197928" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942303"
FT                   /orf_name="Pc18g01260"
FT                   /product="Pc18g01260 protein"
FT                   /protein_id="CAP94350.1"
FT                   /db_xref="UniParc:UPI00018310EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC97"
FT                   /transl_table=1
FT                   /translation="MKGTSIFQFKSWPKIHQPLPRTPRESQQLLNALTSSFRRQLDGAY
FT                   PASGNNHGRPISNPESSAHATDQHLQNILDNPLFRIIPTRTISQEPTTLQSIEGQRRLA
FT                   EEPMAVFDQMAAAGSVTTLTINDCLKSQLLLSRSPADMSASRAASRIVDWYWASDGTTR
FT                   QMLLRLRSVTTSLTKFIVAEGLHGTIMKWLQMLMSHDLGSQNGRMTEGLARQTFNHLLI
FT                   DFIDAEACFGNGFGSAMAHYLSVCQMHFQSASSHKSRKPMLLAAGAHLSRMAMEHKPSG
FT                   EQVSTLVYDQFRDTVSVLSPRSLLVASVAVCHPTNPDPRPFLQFVENLSPSKFQSWNET
FT                   RRDAFFEIGSEALRVLVDRKRFRDISRLEQHISELLPEPATPVAEKSRTSSEEEHLGRL
FT                   NWSFT"
FT   CDS_pept        join(302482..302770,302856..305176)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197939" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942304"
FT                   /orf_name="Pc18g01270"
FT                   /product="Pc18g01270 protein"
FT                   /protein_id="CAP94351.1"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="UniParc:UPI00018310ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC98"
FT                   /transl_table=1
FT                   /translation="MSDIQNRSSASRGRVSARGGRGGFSSRGGRGGNRSANDNSDISSF
FT                   EEGEIGQMKKKYSDTLPTLKEMFPDWKDEDLVFALEDSNGELLEAIERISEGNVSQWGE
FT                   VKKKTTDRTRPKPKEAPSASTETTTPSTRGTRGRGGIEGRGRVRADRGRGGRGGRAGAV
FT                   TNGTRASTAVETSAPTAIPATTSDWATPKAEEKVGDATAEGEWESTEPKSSVIPEGTKK
FT                   GWASLFAKPPAPPVQKKPQAAPPVPVAEKPAEPVAEPSPPAPAPAPEPETAPATSQKTP
FT                   VAKPTHPVIPAIPTTTVNPPKGNLTETNLEQVPDASAPAPTATAASTIGSGVDPAAVAA
FT                   ATATPSRFPSSAYPPSATKQGRTPGLQRRVMEQQQAVVMPGNHAVDRAAVQFGSMGLNG
FT                   DAIDIDENREEAETRAQPPQHSPVAPRASLPPATQAPHSMESGAAGRPAPGLPPVPQGA
FT                   SADSFTDFARYSEPQQKPFDPFTQQVSQPQPQIPEPFANQAPAQPTATTGSEYSPFYAA
FT                   EQQRFPYYASYASYGQSQDAPTGPRAGAGFGVSGAEVQAQIPTTQPPNRYVPVDATNSG
FT                   HNTPNPTIPGVTQQTPAAQHMPGQSAQQHAYGYQYPNYYTNPHYASYMNQMGQQQQQQQ
FT                   YGGGNRPRYDDARRYEDHYMQQQQQHNQQYGYGSQYGPYAGKGGMYGQPHGAFSYDQQS
FT                   SSPANTGSFSQAMPSRDSVYGRTGSAQQSDNQSATGANAFGTGMSDVFSRSQGSFGQNP
FT                   PIAGQPPVTTDETKGFEAPKAGGPSPSLAQNRPGSATNSVPGQPQAQTGLPPLQGQQGQ
FT                   QTFGSYPQLNPQYGGLGGLGHQGAATQASGYGNNYGGGFGNYYGNSGRGGWGGNYGH"
FT   CDS_pept        join(complement(307540..307611),complement(307179..307504),
FT                   complement(307073..307127),complement(306227..307009))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197950" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942305"
FT                   /orf_name="Pc18g01280"
FT                   /product="Pc18g01280 protein"
FT                   /biological_process="steroid metabolic process "
FT                   /protein_id="CAP94352.1"
FT                   /db_xref="GO:0008202"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="UniParc:UPI00018310EE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HC99"
FT                   /transl_table=1
FT                   /translation="MSPQSQVPPSSKGSWTSFLKARRLSIASFNGDLSSLTAPPFILST
FT                   TSLTEYSAYWAEHPALFVAPAKEADPEKRALLVLKWFLSTLHQQYCSRSEKLGSEKKPL
FT                   NPFLGELFIGKWAGDAEVGETALVSEQVSHHPPATAYAIRNEKNGVELQGYNAQKASFS
FT                   STILVKQIGHALYSLTPPGSDEKEQYLITLPSLHIESLIYGSPFVELEKSTKIVSSTGY
FT                   VAKIDYSGKGWLSGKKNTFTASLFKESEGEKKPLYTVEGQWSDKFSIKDARTKDVVDTW
FT                   NSKENPVTPLTLAPLDQQDLYESRRAWSDVAANIQKGDMDAVSGYKSRIETAQREQRRI
FT                   EKEEGREWERRFFNRIEESAEDAQIQRLAKSADLAFETDKTGGIWRFDAQKAAGAQPPY
FT                   HKVGGEGLGLTE"
FT   CDS_pept        join(308623..309051,309102..309335,309389..310306)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197961" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127315"
FT                   /orf_name="Pc18g01290"
FT                   /product="Pc18g01290 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP94353.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018310EF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCA0"
FT                   /transl_table=1
FT                   /translation="MSPTASKVSSEERRSQSWANETEIQRSRSRRSQREGAVNSLDHVR
FT                   SHVSHHDMAVNDDFQEVDAEQYLRFSPARKVVIVGVLSFCSFLAPISSTSILAGIPEVA
FT                   KTYNTTGSVINASNALYMAFMGIAAPFWGPFSQVWGRRMVFLVSAFLFFAFSIGTALAP
FT                   NLPAYYIFRVLTAFQGTSFLVVGSSALGDIYEPRARATALGWFLSGTLIGPAFGPFLGG
FT                   VIVTFCSWRVVFWLQTALGGCGTLLVFFFFPETYPHLTKSDMAGKTMWQKAKYLWHRIS
FT                   PLQVAIMLSKYPNLFCTGLAAGALVWNQYSLLTPIRYVLNPRFNLTSPIQTGLFYIAPG
FT                   CGYLVGTLMGGRWADHTVKKWIRKRGGVRVPEDRLKSCLIFLGGVIPGCILIYGWTVEK
FT                   AVGGIPVPVLAMFFQGVAQLFCFPSLNTYSLDVMQSSGRSAEVVAGSYLFRYVFGALGS
FT                   GLVLPAVERMGVGWFSTISALFLIASGVGVWLTTIFGDQWRDKVEKKNQRKAEERTEEI
FT                   QQNTTKAET"
FT   CDS_pept        join(complement(312310..312518),complement(311780..312262),
FT                   complement(311604..311728),complement(311357..311551),
FT                   complement(311034..311272),complement(310925..310981),
FT                   complement(310781..310864),complement(310442..310729))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942306"
FT                   /orf_name="Pc18g01300"
FT                   /product="Pc18g01300 protein"
FT                   /protein_id="CAP94354.1"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000159304B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCA1"
FT                   /transl_table=1
FT                   /translation="MPNIRESDKTNKVNVTTPQPYSTLEEYERLFGVDEDAYEQPTTTR
FT                   KELWSYYLYYNGDNGVGPGSYSQALFQWALNGAGHQPGSNPPEACTDSSACVVPWAGGT
FT                   RSVSSVVLIANGLCFTFMTVIFVWLGSAADYGTFGRWLLLALTVVCWALQYGMMSIRHP
FT                   SQWPTAMGLYVVAYIAYGATLVFYAAVFPRLARYTRHVRKAREEDLREGKIDQEEYDTI
FT                   ESLERNHISNISTAHSNIGYLLTLVLNLSVLLPLQDNSFSNNLALSLTNSYWVILGIWW
FT                   FIFQQKRPGPKIPKGSSYTTIGFKQIWLAIREIRSLPQTFLYFLAYFLLADGLNTTGTL
FT                   VSIIQNDSVSFSFLQITYLGITQAACSITSTFGFWYIQRYFKFKTKTMFLFTNFFSVLI
FT                   PFWGMLGLWTNRIGYHNRWEFYFYNVIFGLFQAPYYAYAQTMISELMPRGYDNMFFALF
FT                   GITNRASSIIGPNVIQAIINNTHNSWMGFPFLFAICAAAMATICFVDIKKGREDCREFT
FT                   EQRKIDRVVAETGLDPNDIAKGKQPVHNEDGPEVHASTLASE"
FT   CDS_pept        join(312838..312873,312927..313049,313103..315142,
FT                   315200..315559)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197983" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127316"
FT                   /orf_name="Pc18g01310"
FT                   /product="Pc18g01310 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP94355.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00018310F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCA2"
FT                   /transl_table=1
FT                   /translation="MAYLDLQKQVGQLFAVGFHGCTPSPEIKTLIHDYHVGGIVLFSRN
FT                   FQNAEQLQALTLALQNEAKSAGHERPLLIGIDQENGLVTRISPPIAAQVPGPMALGATH
FT                   DPECAYSAGKATGETLSFFGINMNYAPVCDINSEPLNPVIGVRSPGDDPEFVGRFASAA
FT                   ARGLREHNIIPSVKHFPGHGDTAVDSHYGLPVIPKTRDQLERCELIPFRRAVAEGIETV
FT                   MTAHISLPCIDLTRPATLSPDVMGILRKDMAYDGMIITDCLEMDGIRSTYGTEEGSVLA
FT                   LRAGSDSIMICHTFDVQVASIKRVCEAIKSGTIDQARLADACRHVSTVKDKFLSWDAAL
FT                   RQSSLAGLSSLNNRIAETTMDIYSRSTTLVRDKNSVLPLSKTSIIIFLFPGDKTPVGGA
FT                   VDGEGTGRSGLYQSSKYLDVLRQHNNSIAELRYGASGLTSEQWRSLEVADVVIFTSLNA
FT                   KESPYQESLGLKLAERVRSLVHIAACNPYDFLDAPSVKTYITTYEPTIEAFSVAADIMF
FT                   GALVPTGALPVGTNALTKTSAVVIPFDAQRDLDEVVEVWAAALPTYLVPNESLRSMIVC
FT                   PHGHHFIARIGSQVVGFCLAYTDAQSAPSTVYIAVLAVSPRYQHQGIGISLLEETRAYF
FT                   RATFGFNNVKLGSSFPRFWPGIPQDLPESVQHFFTHRGFRLSPPSARSVDLYQDIRNFQ
FT                   SPEKYITRARERGFRFAPLKSEDYEACLVGQRKNFSNNRSWVEAYVTLHPDKYPDSVMT
FT                   AFDSQGQQVGWTLMLGPSDALNTSWAFPQTCGPNTGLIGAVGIDESHRKYGIGLALICH
FT                   AIEAMKQRGIEGVFVDWVALDGWYEQVGFKTWRSYRPGEL"
FT   CDS_pept        join(complement(316424..316560),complement(316154..316359),
FT                   complement(315721..316094))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000125752" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942307"
FT                   /orf_name="Pc18g01320"
FT                   /product="Pc18g01320 protein"
FT                   /protein_id="CAP94356.1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI0000F30214"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCA3"
FT                   /transl_table=1
FT                   /translation="MSSNITLYSWPTPNGVKASITLEELGLSYKAEGLDISSSSNPQKE
FT                   EWFLKINPNGRIPALLDGSQRVFESGAIMTYLVDKYDTDRKISYAPGIPEHAEQTSWLM
FT                   FQMAGLGPIQGQANHFRLFANTRSDYAIKRFVDETRRLYSVLESRLNESPYLAGEKYTI
FT                   ADIASFSWVRGSPISLEIDLSEFPALKKWVDEIDKRAAVQRGLDIPHSTWTPEQKAEIF
FT                   RNCRAKIDAMTTSDQH"
FT   CDS_pept        join(316930..317029,317091..317441,317496..317935,
FT                   317998..318238,318291..318515)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942308"
FT                   /orf_name="Pc18g01330"
FT                   /product="Pc18g01330 protein"
FT                   /function="DNA binding"
FT                   /biological_process="DNA integration"
FT                   /protein_id="CAP94357.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI00018310F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCA4"
FT                   /transl_table=1
FT                   /translation="YKVYRSDEGLGXDSSAGQRVKVEGASNIILLIRRLDGSRYELXVX
FT                   XLYKPGNRFNLLSLLAIRXQXGIRXNPDNIIIRDKNKAEIRYTFVGMNVLFIELVDKLN
FT                   LVLYKILNXPLIXXXLAVLYALILAKLIHRRLGYIGSYKGRVNKEKLGEDISIECFDYE
FT                   LYYKAKSKKIVSREKXARATKVGXLVYIDLYPCKLKGISKIGKXDREYAMIITDDASRF
FT                   RITICIAKKGEASPILILXAETFKNHTRYYLIEWRFDNGTKFLHFXKWAKEKNLTVSPS
FT                   LAYIYEXNGVAEFSGHYMIXIARTIHIDRGALRELXTEVYYTTTYVINRLIRHSEEAPI
FT                   LAXRRAMNLRGDEATNLSFLRVXYSKAYVHXPKETRVXGMKMDPRVXIGFLIGYEGDNR
FT                   HYFRIYNPKTKKVTVYRDVVFXEPKAPKTYDSTTDFQIGETASDNVKNQKT"
FT   CDS_pept        join(318887..319033,319171..319291,319344..319456)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942309"
FT                   /orf_name="Pc18g01340"
FT                   /product="Putative uncharacterized protein Pc18g01340 "
FT                   /protein_id="CAP94358.1"
FT                   /db_xref="UniParc:UPI00018310F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCA5"
FT                   /transl_table=1
FT                   /translation="MAGESPVSLRSDSVEVDCPYLEKDGRPLLQLPRAYTHTRYNHQNS
FT                   SLKLENVTVVFFVSAKATLPSRKSNFHLGVYNSVPTPDQNGGRKYGTVRYDGTEYNIDV
FT                   SIFCFAPLRQGTWMVLKAALTM"
FT   CDS_pept        join(complement(321207..321379),complement(320768..321066),
FT                   complement(320594..320645),complement(320309..320522))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976240"
FT                   /orf_name="Pc18g01350"
FT                   /product="Pc18g01350 protein"
FT                   /protein_id="CAP94359.1"
FT                   /db_xref="UniParc:UPI00018310F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCA6"
FT                   /transl_table=1
FT                   /translation="MANKGTRGWGDFRCDDVGERRKTKVDGEEELEKGQSASVNGSTSF
FT                   DETSETNKVVNGKVSDLLPETEQTWESWGNLLDCIIHSLSLHLMDFVSAKYYIKSTLLP
FT                   SLMPSTRSMNKILGPSTTTCIWTTSKTSDLNRDVQIQTQRESTPSAAKPQIYLAPHSTK
FT                   GAGFVVVASRQGLVSGDFARLRVSGQDNLPFGSTLIESEILLIIGNMLNEEHLILDPFP
FT                   NSVKLGEKWKSGGNCGDDIYLLG"
FT   CDS_pept        join(321408..321448,321505..321579,321646..321909,
FT                   321960..323089,323165..323279,323339..323615)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000158970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127317"
FT                   /orf_name="Pc18g01360"
FT                   /product="Pc18g01360 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94360.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018311C1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCA7"
FT                   /transl_table=1
FT                   /translation="MAQEAITLAGSDQRSSNDQNSAEKGYVEQVDLHNNISAKIKNPLA
FT                   DLTKNQVLRNVEEFAEEYNVTDILPELKKGALVARDPAEFETVADLTEPEITALRDEVL
FT                   HKWRQPKPLYFTIALCSIGAAVQGWDQTGSNGANLSFPDAFGISEDPAKSPHADRNLWL
FT                   VGIVNAAPYIASACLGCWLSDPVNRVLGRRGTIFISAIFCVLTPIGSAVSQNWQQLFVT
FT                   RLLMGIGMGLKASTIPIFCAENTPAVIRGGLVMSWQLWTAFGIFLGFSANLAVKDLGKI
FT                   SWRLQLGSAFIPAVPLLFGVYFCPESPRWYIRRGEMSKAYRSLCRLRNTPLQAARDLYY
FT                   IHAQIKIEMELVGKSNYVTRFIELFTIPRVRRATLASFVVMIGQQMCGINIVAFYSSTV
FT                   FKNAGASATQALFASWGFGLVNFVFAFPAIWTIDTYGRRTLLLFTFPQMAWTLLGAAFC
FT                   FWTPQGTAHLASIAFFVFLFAAFYSPGEGPVPFTYSAEVFPLSHREVGMSWAVATCLGW
FT                   AAVLSITFPKMLSAMTATGAFGFYAGLNVTALVMIFLWVPETKQRTLEELDYIFAVPTR
FT                   VHMKYQVTKALPYWFKRYIFRRNVELEPLYQFDQLASGNENVAVSRKQSVHSDHVKS"
FT   CDS_pept        join(324635..325664,325721..326049,326099..326500)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942310"
FT                   /orf_name="Pc18g01370"
FT                   /product="Pc18g01370 protein"
FT                   /protein_id="CAP94361.1"
FT                   /db_xref="UniParc:UPI00018311C2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCA8"
FT                   /transl_table=1
FT                   /translation="MPCFKGLAVSIHTPDGPISEYSIQRHSRASRIGCFIPVPPPKIPE
FT                   SGTGKAEQSTFAISVTLLNPEQDVPYSTPKPTADCPSPKPKVVGKLPGEPGQIAGTVAP
FT                   YQGLTNSPNETVAAYIYFDGRQKEEVATLLRRGEETWVNSRWVSIPESEGGGIAEREFL
FT                   FREVGLERWLNGLDLEGKDAAAKIERRRQKMEKRRAKRAAQEDPTAMDMEDNHPAKSKT
FT                   IMRYGNDEKSPLEDVSDDDLSSDSDDDDPIPETAGQIKVALFRVLASGEIKRGEYSPQF
FT                   DAHDDEEGGQDNSGGGDADVDHTTSFAKPKSLDPKTISTQTVTGIDPSDKPYAVFTFMY
FT                   RGERQLQKMGILKDAKVQETPAATKRKSIQADFANLGPIKPGGSVGFLNFRENEAKPRK
FT                   GKKSVDDMDSDDDDTDNPILGKADDEEAKDDDRFLSPDDIKRQGELAESLRKIRLKRQH
FT                   SAEPPGGSVGDSADTPASGSGSTPPANERSATPPKAAATGSAAEPSQPAAEPEDGLFGS
FT                   PLKKQRASVSTADENALRRRIAESSGRINEVLGSSVPTESTLTSPKIFTDGFSLAPDLS
FT                   AAPPANDEEL"
FT   CDS_pept        join(327007..327075,327137..327805)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942311"
FT                   /orf_name="Pc18g01380"
FT                   /product="Pc18g01380 protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP94362.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniParc:UPI00018311C3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCA9"
FT                   /transl_table=1
FT                   /translation="MLRSIFLPASASRRVLAPGFLHRNSPHPPQIHDATRTLNRPFGLD
FT                   RLRGTSEHSISIQNNPQIPQFRTTNPIHKMTGLNPETDKILQICCFITDAQLNLLEPTG
FT                   FETVIHVPDSTLDAMSQWCIDTHGRTGLTAAVRASTTSPSTAADSLLAYIRQHVPTPRT
FT                   ALLAGNSVHADKAFLACAPYSQVLDHLHYRILDVSSLKEAARRWGSDQLLEQVPRKREV
FT                   HLARDDILESIEEIRFYKDKLFG"
FT   CDS_pept        join(328306..328358,328409..328710,328769..330081)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000009550" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976241"
FT                   /orf_name="Pc18g01390"
FT                   /product="Pc18g01390 protein"
FT                   /function="intramolecular transferase activity,
FT                   phosphotransferases"
FT                   /function="magnesium ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP94363.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016868"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniParc:UPI00018311C4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCB0"
FT                   /transl_table=1
FT                   /translation="MSVQTVSIQPFADQKPGTSGLRKKVKVFQQENYSESFITSILLSI
FT                   PEGVEGSFLVIGGDGRYYNPEVISKIAKISAAYGVKKLLIGQHGIMSTPAASNLIRVRK
FT                   ATGGILLTASHNPGGPENDFGIKYNLANGAPAPEGVTDKIFETAKTLTSYKYLEVPDVD
FT                   TSTIGIKNYGPLEVEIVHSTADYVTMMKEIFDFNLIKEFLSSHKDFKVLFDGMHGVTGP
FT                   YGVDIFVKELGLPTSSTMNCQPKPDFGGGHPDPNLVYAHELVEAVDANGVHFGAASDGD
FT                   GDRNMIYGANSFVSPGDSLAIISHHAKLIPYFQKQGVYGLARSMPTSGAVDRVAKAQGL
FT                   QSYEVPTGWKFFCNLFDEKKMSICGEESFGTGSNHIREKDGLWAVVAWLNIIAGVAKQK
FT                   PNETPSIGSIQNEFWQTYGRTFFTRYDYENVDSEGANKVVGTLSDLVANRDTFVGSEIA
FT                   GRKVLDAGNFSYTDLDGSVSKNQGLYAKFDDGSRIVVRLSGTGSSGATIRLYVERYEAD
FT                   KSKFGLTAQEYLADNISLALSLLKFKEYVGREEPDVKT"
FT   CDS_pept        complement(330397..332052)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942312"
FT                   /orf_name="Pc18g01400"
FT                   /product="Pc18g01400 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94364.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018311C5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCB1"
FT                   /transl_table=1
FT                   /translation="MKEPIPPPTDTIPSSSFPSSKQLRLLVIGAGSRGNAYARAVTTAT
FT                   PGVIHAIAEPHAFKRREFGRKYIWGASESSQEGQEFTDWREWLQWELERRKRATQNNGD
FT                   NAADTTPIPVGVDGVFVCTLDETHVEILQALAPLQLHILCEKPLALSLDDCLTVYRALQ
FT                   PPEGPNNTPQAPKNIFSIGHVLRYSPHNILLRKLLLTDRVIGDIVSLEHCEPVGWWHFS
FT                   HSYVRGNWRRATAAGDGSLLTKSCHDIDFILWLLCSPPSPETASNQAHKPHFPRSISSA
FT                   GTMTQFRRKRKPISAGNATNCLSCPAERDCNYSAARIYNDRHLATGHTAWPVDIVCPDI
FT                   EDVFHAQGGKAAESLLLSRLAEDYDRDTMPNSDIAARPWYGRCVYEADNDVCDDQIVTF
FT                   AWDDEETAPHRLAKTASFHMIAPTEKQCERRGRVYGTTGEVSYDSKTISVYDFATEKTE
FT                   VFDVPKPPPGQNESHGGGDFGLARQFVSAVEAVEGGLDVETAQARFVACSLEEAVRSHA
FT                   VVFAAEEARREERVVKWESWWGEKLRVSADAWKA"
FT   CDS_pept        join(complement(333777..333975),complement(333017..333727),
FT                   complement(332357..332964))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178887" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670274"
FT                   /orf_name="Pc18g01410"
FT                   /product="Pc18g01410 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94365.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018311C6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCB2"
FT                   /transl_table=1
FT                   /translation="MATKADTMEKDPPMEAFKLLPNKTNPNWIKDRGLRKLNMGIVFMF
FT                   STASSAGYIGSLVNSLLVLPEFDTIIGGLNPNIVGLIIAATSLGALVSFAPASYIADKF
FT                   GRKTCVGIGSSIAIVGAIIQAAVKNHWAFFGTRILSGIGMGIAQTAAPLLATENAHPRQ
FT                   RQTATALYNACWSLGAISSAAVTYATIGISNSWSWRLPCLLQISYPLFQILGLIVFVPE
FT                   SPRWLVSKGRKEEALAILGKYHANGDMDDELVQYEYRWICSTITAEITNTRKWSTFFSS
FT                   RGDMHRLAICVLVGLMQEWAGNGLLSYYLAPILDSVGITKAADQAAVNVSLNIWNLLLA
FT                   AAGALASERYGRRILWLLSTVGMIVFLSMSTLASGLFTERQLPAAGIAVVPLLFLFFGA
FT                   YDMAYAPLFISYPAEVLPFQLRAKGIAVTLSVDAIACFFNQYVNPVAFTAIAWKYYCVF
FT                   LGCLVLFLGLIYLLFPETKGRSLEEVAMIFDKENESESASKKETETT"
FT   CDS_pept        join(complement(335696..336291),complement(335132..335631),
FT                   complement(334988..335074),complement(334389..334930))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197194" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942313"
FT                   /orf_name="Pc18g01420"
FT                   /product="Pc18g01420 protein"
FT                   /protein_id="CAP94366.1"
FT                   /db_xref="UniParc:UPI00018311C7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCB3"
FT                   /transl_table=1
FT                   /translation="MSSPQELPDDHEIRDVIIIGAGPCGLAVAARLSEETPSAVFTDEE
FT                   HQRYHWIKKHSGRMSLVQARHSKINGVRAAKWDSERGCPCQDDRQRRTSTDSASSVPSL
FT                   SSASSTSSTSSISTLVLDGSGDKWMQRWNNAFRTLEIKQLRSPMFFHVDPGDRDGMLAY
FT                   TQESGRDADLWEISGCVGKEMSKHKKKKRRQGGKTQTIGGEIDERDRKDYFSPSTELFS
FT                   DYCSSVIQRYGLDEPGQILQREATDISYNYLSDSSDSKIFTITTSTGEKFYSRSVVLAI
FT                   GPGGAGVSKIYPWKPSTEQEGAAACCHSTEIKTFPSLNVQKKIQRRQETNVVVVGGGLS
FT                   SAQIVDMAVRKGVTKVWFLMRSGLKVKHFDISLPWMGKYKNWEKAAFWSADTDEERLEM
FT                   LQNARNGGSITPRYTKIVKQHAAQNRASIHPCTEIKTHDYNPATQTWTLTTDPPIPDLP
FT                   AIDYIYFATGVRADVREMPLLRTMNDQYPIEVKAGLPCLTNDLSWRDDVPLFMTGRMAS
FT                   LRLGPGAPNLEGARVGAERVAWGMEEVLHKGREVDGQCEGFCGLGNRYASLLGECDE"
FT   CDS_pept        complement(337113..339035)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823019"
FT                   /orf_name="Pc18g01430"
FT                   /product="Pc18g01430 protein"
FT                   /protein_id="CAP94367.1"
FT                   /db_xref="UniParc:UPI00018311C8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCB4"
FT                   /transl_table=1
FT                   /translation="MPAVDSARFRPTTPPRLSLEEYIDSGHSRHASNSSVYSSESSPWS
FT                   TMTGNTSPTTSPTRHYHGPKLLPKIRPQDVVIEPVSAGGPLRHRRVLSNTRNPPPGFIS
FT                   YPPVRPSAGRRTREVADRLALASPISPAPLTTQGSFPTLSSPVTITPSYKRKAGGGHSR
FT                   SVSASVIDAATLTGIGYPTYRGLPQMQAQTTPTTPVTPITPNIMPCPSYSQRPGGQHSP
FT                   ANTQTPLTVPTPQYNYRQASAAQHSPVLLSPHEDLAPRSTTLLSYLTLPIQPINLVRNV
FT                   SVIPTRGLHDYFWWDIRNLRSWSSFSLATFDSLDSRLIQLLKTEIPAELTPHVPVPSAS
FT                   LAPESEHDLVTLIRDLYAPRINAALAVSQGKDHLQLYAAPDVRNTGHKNHGHPHFLANY
FT                   LSDTEQTSAGLPRGRLVGIVKSFDRWNTGMRNEAPHRRVEYLNGLAHLQRCMREHSCRY
FT                   GFIITEIELVCVRAGCDPGDDVPYFGYLEIAASIPLKTAAVRGMRTHAREAPLATPISA
FT                   RSFSPSSSSSFNSHHDSSEPEPGEDALPAMTAGLGLYFLLMLSKSVPLPHQPSAHLNVG
FT                   GPGAMTRQRILAEAKDKWIPEPQIGERRDAKRVRGWVWPLDPWHRREGGASRAKAGTKT
FT                   KKWHK"
FT   CDS_pept        join(complement(339803..339897),complement(339604..339714),
FT                   complement(339317..339533))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823020"
FT                   /orf_name="Pc18g01440"
FT                   /product="Putative uncharacterized protein Pc18g01440 "
FT                   /protein_id="CAP94368.1"
FT                   /db_xref="UniParc:UPI00018311C9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCE5"
FT                   /transl_table=1
FT                   /translation="MGHFSVSRSSYPITEYDAGAGRVLQTHPTHVAPWNHTFHDPGGYF
FT                   YLSAFLEPLTADPASPEAGRITNKLTILGNLKIDIEEDAKYSNNLTRDSPMKPHYAELD
FT                   PLGGAVSRALLLNMPVFRHDVGSFVFQRVDVPLIGD"
FT   CDS_pept        join(complement(341764..341823),complement(341593..341695),
FT                   complement(340318..341531))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000012351" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127318"
FT                   /orf_name="Pc18g01450"
FT                   /product="Pc18g01450 protein"
FT                   /function="hydroxymethylglutaryl-CoA synthase activity "
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="CAP94369.1"
FT                   /db_xref="GO:0004421"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="InterPro:IPR000590"
FT                   /db_xref="InterPro:IPR010122"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013746"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniParc:UPI00018311CA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCE6"
FT                   /transl_table=1
FT                   /translation="MAARPQNIGIKAIEVYFPTQCVDQVELEKYDGVAAGKYTIGLGQT
FT                   KMSFCDDREDIYSMTLTVLSSLMNKYNIDPNSVGRLEVGTETLLDKSKSVKSVLMQLFA
FT                   PHGNTNIEGVDNVNACYGGTNAVFNSINWLESSAWDGRDAVVVCGDIALYAAGAARPTG
FT                   GAGCVAMVIGPDAPIVFEPGLRASYLTHAYDFYKPDLTSEYPVVDGHYSLRCYTEAVDA
FT                   CYKAYDAREKTLKPQTNGTNGATDESLSPLDRFDYILFHAPTCKLVQKSYARMLYNDYL
FT                   ANPSHPAFAEVAPELRDLDYEKSLTDKVVEKTFMGLTKKRFAERVNPGLQVATQCGNMY
FT                   TATVYGGLASLLSNVTFDPKEPKRIGLFSYGSGLASSMFSAKIVGDVSGMVEKLDLQNR
FT                   LNARTVLEPAQYDAMCKLREHAHLKKDFKPTGNTETIKSGVYYLTEVDEMFRRKYEIKA
FT                   "
FT   CDS_pept        join(343158..345569,345625..345807)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197172" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942314"
FT                   /orf_name="Pc18g01460"
FT                   /product="Pc18g01460 protein"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP94370.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007365"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI00018311CB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCE7"
FT                   /transl_table=1
FT                   /translation="MGDEKFDYQAVPIPSYAEATGQPSSSRSDLGEGTDVERQGLLGRD
FT                   HASTRGYHPPTVESARTSLDDLESLTSRSDRESVEELRQELDQMDVDDSASAPLAGRHA
FT                   PLRHRFSKQLSSLSRTLSAIQRPFQRYMPSMPSMPSFRFTINLSDTRARLKDHGCIMLL
FT                   RVFALLLVVTLVYVFFIADVFNINSRMAMGQSYSAASVENFIQGHINETNIAENLRRVT
FT                   NYTHIAGTEGSFALSKLIEQEFQNAGFDEVSREEFQVYLNYPRKDGRRVAIIDPPGLAW
FT                   EAKLEEENAKDLVFHGHSKSGNVTGHLVYANFGSREDFKLLADKGISLDGSIALVRYYG
FT                   TEADRALKIKAAELAGAAGCIIYSDPSQDGFVKGPTFPEGRYMPSDGVQRGGVSMMSQV
FT                   VGDVLSPGWASTPGENHRLSPEESTGLPKIPSLPLAWRDAQILLQGLKGHGSKVPKAWV
FT                   GGVPDVEWWTGNQDSPTVHLMNLQDEVERQPIYNIHGRIIGMDERDKKIIVGNHRDSWC
FT                   MGSVDPGSGTATFLEIVRAFGELLTYGWRPLRTIEFVSWDAEEYNLIGSTEYVEKEVDD
FT                   LRANAFAYLNVDVGVAGPDFRVSASPVFERTVLQVLGRISDPYANATLKDLWDKKGSKI
FT                   TPLGAGSDYVAFQDIAGTSSIDFGFEGEPYPYHSCYETYDWMVKFADPDFQYHKILAQF
FT                   WGLLLLDLSENPMLPFDLEVYGDSIGGWVKDLDKFAKSKKAEVDMEPMFKAAAEMKANA
FT                   VTFQSWNKIWHDTVWGMGGYESNIMAVQRVNHNARMAAFDTNLLDLEEGGGIPNRTQFR
FT                   HVIFGPELWSGYDASIFPAIRDSINTGNWTLTQYWIDRVANTIHHASDKLLH"
FT   CDS_pept        complement(346344..346721)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(350441..350589),complement(349676..350385),
FT                   complement(349237..349618),complement(348881..349169),
FT                   complement(348438..348806))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234999" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823021"
FT                   /orf_name="Pc18g01480"
FT                   /product="Pc18g01480 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94372.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018311CC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCE8"
FT                   /transl_table=1
FT                   /translation="MSRLAACEACRKAKLACDHQLPVCTRCSASKGICIYRTTPFKRKR
FT                   AEKQSLGSPDEPPSFNPRRNPYPNPGYLGSSSHAAIFKHITPDGDHGHGSHQTVPEDLH
FT                   SDLFGDNHLVLQGADILKHLLTTYKLSAMKDLVMFWLAKGANLALAEPFVDQCAQSVSQ
FT                   LFTYHDDNWHLVYARRLLQNSAQPLHFNDTSDLAAFSAQFLDHNSRWETLGIFFAAVSR
FT                   ATTDIAFFPSLYTTEQEQYSLRRLCTKLCDFALEISLSLDCLNDLQLIMQYENFIVHSY
FT                   VDGDQSEGYHSWRKLGDAISSTFALGYHENIEIKTGLPPFLKELRKTAFARIYSADKNI
FT                   AIFLGRPPRMNKRFCHFQIPSCRNAEEGSAEWTLDAEAGYRADTRWSALCASLKEEIWE
FT                   LLQDKHDPSCAQRASVIQCQAETQWQHLPAHFRLESSLKKCTQGPFERDFVAGVRLHHL
FT                   HVLFLLRLLLLKSPTEPDLPIIETAGQMLTLVVEIILLRDQLTNSGTGLIWKVAYYGLP
FT                   AAGIMLLAMLKQHMPRAHRTRSLQDLSVFVAEVQIGTIVKAGDPNYALLSKATRTIQRF
FT                   LDSTHSDPPLSEVAGVEGNDEWALLSQDLWDFEAGFWQSLADHPSLLAIEPSLPPI"
FT   CDS_pept        350757..352472
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000061334" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127319"
FT                   /orf_name="Pc18g01490"
FT                   /product="Pc18g01490 protein"
FT                   /function="carboxy-lyase activity"
FT                   /function="magnesium ion binding"
FT                   /function="thiamine pyrophosphate binding"
FT                   /protein_id="CAP94373.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0016831"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="UniParc:UPI00018312A8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCE9"
FT                   /transl_table=1
FT                   /translation="MTQDIKLADYLFIRLRQLGVDSMFGVPGDYNLRLLDFVTPAGLHW
FT                   VGNCNELNAAYAADGYGRIKGLSALITTYGVGELSAINGIAGAYAENTPVLHIVGTPPR
FT                   PLQSARTFMHHTFSDGDYRRFANMSTHVTAAQARLEDATTAPERIDYILRQALIHNRPV
FT                   YLEFPDDMPDVLVSATNLETKICIPQPPSSTQEPQVLARILERVYSAKRPFIFVDGEST
FT                   GLGIVDQLDALIKATNWPTWTTVYGKGLVNEQLPNVYGLYAAAFGDKPAQEYFEQADLI
FT                   LTFGPHNSDTNTYFYTTIPKPAVAITFSGSTVQIEHDTYRDLSARNILSKLLQSLDPAR
FT                   LVKATGPPKQETTLANIQNTDPIAQNNFYRLVNPLFREGDIILTETGTAAHGGRNFKLP
FT                   AKSRIFGAVTWLSIGFMLPATLGTALAQREHNKGTESKSQTILFIGDGSLQMTAQEISV
FT                   MIREKLNIIIFIINNDGYTIERVIHGRKQVYNDVPFWRHAQALNYFGADEEHAANNTFT
FT                   ARTCGELKDVLANERIQNGSGVRLVEVLMGREDVQGALLYLLNKQLDQEKETEQ"
FT   CDS_pept        join(complement(355436..356223),complement(352839..355383))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197160" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823022"
FT                   /orf_name="Pc18g01500"
FT                   /product="Pc18g01500 protein"
FT                   /protein_id="CAP94374.1"
FT                   /db_xref="InterPro:IPR013887"
FT                   /db_xref="UniParc:UPI00018312A9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCF0"
FT                   /transl_table=1
FT                   /translation="MSPPSPETNDDQNPELSRAASYTDLPSQTATESSLRRTFSDYAVP
FT                   TLAESPTKETVAAGKDILRRTSLRSKDKSKQASVSQFTLSSSEDLKDTDSFVPETRAPE
FT                   PAARPSKSRSMSGRIVSLARKPWGSSSRSPSPSAKRSKQQDSQSPSRSTGRKTEDDQIQ
FT                   PSRRRTILYKRPRRPMLAVVAKGPEDSPGSPSSPSGNSLRHRSSFEKFTASLSVSTPVL
FT                   PPMPKGAAETAAAYANAGTHHARKKDELWGIFRGLEADFQKFQAKSSSLKANVIRTSLL
FT                   PFLSRHHLHASCKNLRPEDLDRRVNILNKWWIGMLEMLNGKNNQSISGTDRPVFLEAVV
FT                   GIMARPEWRIPFPMAQNGSGPTESLKYASTSVSETSDGSGSSGSDFLVESIHHNIRNIF
FT                   IQNLLSQMAFVVERMSMRHAPASLVAFCGKVCAYAFFFCPGVSETLVRLWSTPPNMYRR
FT                   ILSESAESRTGNMRVYTQELAACFPPALRPLAFHSQAPLLRYLRQKPELPLNTTSINWN
FT                   RPWIARWAGRDTDLFYVFVKYIHILYAEYLPPGTEKAKRILAPGLLMVHAQVLLVLEDT
FT                   IYKQSAQQGSDNPHTAAAITFDDFIESPDASASTQHLRSGSNTHRSMAENRLIILLRDL
FT                   LSESSVEPNRARLLFAESFCGIIKAAAQKMSLFDHNACFLLCDFLEEVIPIVTRYAQSI
FT                   ETELFDWGFWLDVCRQMMQSHNSLTEVRVFSFLFCIWGTWTATEERKASICLDFLLHEP
FT                   VFYHYFNHWSPMVRAYFHRLLCWRVGRFNTEPSSLDSNVYEILSDRLLRVWEYYIGFQS
FT                   KAEEGMTAPLSSAPCTPAPGRRIIIIRCENQLSPANLFVSFDRVVPPVPSDQLTSHRRT
FT                   GSSDSNGSDGQPSKRRWGILKAMFGSSSNTRSGDGISSSSSDDSENAVSDSTMTADTKC
FT                   MDDHEQTAINGMDEIIRPKAPHQPFFFKFSLEWMDRPQWPTKNKRLFTPCLPVASQLHV
FT                   EHRRSPDKSDYDTASENLGQSDFENDEQQPDSLTNDQDTPTQPTSDTWPRTPTTKNSPL
FT                   PELPSQPSYDHLVSSKYAGRALAEWAHIVSECDSFFARRRDEGVPSDRMVETPTLGVES
FT                   FRK"
FT   CDS_pept        join(complement(359271..359297),complement(359134..359212),
FT                   complement(358777..359039))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197149" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942315"
FT                   /orf_name="Pc18g01510"
FT                   /product="Pc18g01510 protein"
FT                   /EC_number="3.6.3.14"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP94375.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR019711"
FT                   /db_xref="UniParc:UPI00018312AA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCF1"
FT                   /transl_table=1
FT                   /translation="MMSQSLRASRTLFSRASRAQVSVARRTFLTSAVRQADPVQDLYLR
FT                   ELKAYKPTPIKAGDAEEHVQKFTAPKPPQSPEEANLASELSAYESQEVEVEGQAAAGEA
FT                   APVEESWFEEEEEAPAAH"
FT   CDS_pept        360465..361517
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000108634" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823023"
FT                   /orf_name="Pc18g01520"
FT                   /product="Pc18g01520 protein"
FT                   /function="transcription regulator activity"
FT                   /function="translation initiation factor activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /protein_id="CAP94376.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniParc:UPI00018312AB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCF2"
FT                   /transl_table=1
FT                   /translation="MATSTLAKPEGATPWKKNLSAHLVCPECKEDPPNLEFPDSHETVC
FT                   GSCGLVLADREIDLHSEWRTFSNDDQNNDDPSRVGDASNPLLNGAQLETSIASGGSGRA
FT                   RDLYRAQNKQSGEKANKALLAAYKEIGALCDGFNIQKTVADTAKYLFKMVDDAKAFKGK
FT                   SQEVIIAGCIFIACRQCKVPRTFTEIFAVTKVTRKEIGRIYKALEKFFTTQNVERHNAA
FT                   LENGETHDFAGDYNATTSTKPSDLCNRFCNLLDLPYQVTSVSVSLSDRVTAMGDLAGRS
FT                   PLSIVAACIYMASFLMGHGKSAKEISQVAHVSDGTIRGAYKQLYAERERLVDPEWIKGG
FT                   KGDMAKLPVS"
FT   CDS_pept        complement(362183..362554)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942316"
FT                   /orf_name="Pc18g01530"
FT                   /product="Pc18g01530 protein"
FT                   /protein_id="CAP94377.1"
FT                   /db_xref="UniParc:UPI00018312AC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCF3"
FT                   /transl_table=1
FT                   /translation="MTTFMRLKTPFQARSPITALSAARTQTPRISLYRSYATKSSNDPE
FT                   QATTTTRKPNPPSRPIPSNKAKPTLIEGEQSHLVDREGNPRKDLPQDVKKHNRDMEERY
FT                   DKPYNSTDDDGTVKPAFKS"
FT   CDS_pept        complement(363116..364405)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942317"
FT                   /orf_name="Pc18g01540"
FT                   /product="Pc18g01540 protein"
FT                   /protein_id="CAP94378.1"
FT                   /db_xref="UniParc:UPI00018312AD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCF4"
FT                   /transl_table=1
FT                   /translation="MKSSKPSKRTNVTTDTHESANTKTKSLPQLLPWPSIEDSPTTQNP
FT                   MMSSSRDLVPPSGLNRLPPPLSMSTPLPPLPAGWEGTEDMKLWLHTKMEEERRRQQEER
FT                   TYQATLVLERRRIEQSILSDALRAGVPPNLVPLIFNGIYTTGANLELATELQRQWSTPG
FT                   SISVAPPTMSQPQNNPGPAPPAKLPVAPQPIQQNFREPPRAQDSDLPPAATDYLPGTRN
FT                   SRWSEATSRSHRDRVISSEREQLRRKLKAQNVDSADMKLLDTAFEHTFPITSSTMEAEA
FT                   SRHLAGPLDKPSGTREKRRQAPQKPHPRSSPQSRSNPQQQLQTSPRNPANTSNPPSQVH
FT                   PEQTDIPSPKRKDQRLHKKVSPPQYRRNETACGQEDPFDEAELDQKQRQRDLSSSHESR
FT                   TCGGSSEQPSESTPASVGKFSATAAEYLQR"
FT   CDS_pept        join(complement(368159..368351),complement(367623..368017),
FT                   complement(367165..367569),complement(365574..367100))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198477" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942318"
FT                   /orf_name="Pc18g01550"
FT                   /product="Pc18g01550 protein"
FT                   /protein_id="CAP94379.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR018444"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00018312AE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCF5"
FT                   /transl_table=1
FT                   /translation="MDMTEPRRGAPEEDPIDSNDYSDHSPASFHEAKQELPDDLPKSLD
FT                   DRRSVPVFQPETEMYDAWQGQSQYLTAPVAAKPLSFSLALDDHSHDSEHEIRAHYGRDI
FT                   EDNDARLMEMLAAQAAHREVDSLTADEETIAADEKLTDDEKRDILQKSLNMAASNGDVD
FT                   RVRKLVQGEARTYVDVNKPDEEGTVPLIYASCFGHQEVVAALIVAGALVDRQDRNQWSA
FT                   LMWAMTNRHKTIAKILLDNGASPDIKSSSGGRAFDFAQPGSEISEYLHENGYSFGSGNI
FT                   DDDFYDAGLAHGRFEEELAESEMKRRMMMEESAINLEVDLSSLGLDEKFEPSDDDELEE
FT                   DQQEFVWDKCLNDQMFVFQDHELERILDMIITNMTPQRSPSQKPVPANLLFLSARYAHY
FT                   HASPELLTTLLSSAMEKINDVVERYQWDMTMQAFWLSNATLLLHYLKKDGGLVESTVEF
FT                   QLHLAELINEIFVLVIRDAERRMNKVLDAAMLDHETIPGLEDVAFQNEWKLFRKNKNKN
FT                   PEPDEKRFRPPSPRRRAQISPRNITSLLSSTLFVLDLYDVHSVITTQILSQLLYWLSAE
FT                   IFNRIMSTKRYLARTKAMQIRMNVSSLEDWARTNNRVPEHYENGSTNTTGESTIDAARR
FT                   HLAPVIQLLQWLQCFSSLGDDHESLVTTLLQLQQLTPAQLLHAVKSYRPEVGEKGLTKQ
FT                   AMKFLLDMQSDPGVLHCEQQKIQEEKAKAAAGPGPQAAADARPKTPPKDQPSAAPTSPD
FT                   TETSPGSAAVPSRPGSMVTGRNDERSGAGNSVFLDPTLFLPFSLPTSTDMLVSYGAGFG
FT                   GTNRERARKYIPTVPPEVLSRFDRGDV"
FT   CDS_pept        join(complement(374086..374450),complement(369682..374003),
FT                   complement(369362..369609))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198466" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670275"
FT                   /orf_name="Pc18g01560"
FT                   /product="Pc18g01560 protein"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP94380.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="UniParc:UPI00018312AF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCF6"
FT                   /transl_table=1
FT                   /translation="MEPFPPPTHPEFKDAFLGPQVQINELSASNRMPSGPQNPISNLRR
FT                   ANTVAQGGNVKRNLELKAARERTATGINAKDSHELLRQNKLQRSQTHRGPLEARPPGRK
FT                   AGHFTVRSVGQNGKIFLRPIANPPQKSPQPASFSPVDTAKPSLLQPQSHAHAREDPDPS
FT                   RWSSSQLSELRPREQPKDPEPVLAVSPELSSQHRTRPISFSTISEQQSIAGAGKRGELR
FT                   IVIDRSEDRPKSARENSTPALEVPIPRYQLGSPRFNAEGSAMMQSSVYTRTSMSDNFRN
FT                   STLLGGMADPLPGLHSPYPRDSFSRHRPSFAISMFSGTAAAMDMNRASPAPRNSMVYEL
FT                   KEPVEPSIYETLVYDMDDGSVVRYIPGTKDISAATPARIVAQISSESFMDYELVSDFFL
FT                   TFRSYLSTTHLLALLLARLKWAINRLQDDGRIIRIRTFAALRHWILNYFVDDFVTNYEL
FT                   RTNFCETINKLYSEVRSRHNGGTSDRKILIDLKRCWNGKCSVYWSSPQLSRAYNDPEIP
FT                   IVPGDAQIELPKAGELQQSVPTYGMAPNADTTFRESPIQHDRNDSAATTQSIPFSAKSD
FT                   QSLMALSCSLPPKSPKRLSMCASKGKAPRPVVLGLTKSKPPSNTHEPPRSPVSPMVSRH
FT                   PYHSHSHKRSGSFSDSVRDDRVPMFAVEPDTGPAPQEILDPVSLIRGEMYPPAESYMTM
FT                   MAPESPPLPPPLKNPNPDRRSTPDVPKSSPNSGVRTIIGSIKRALHTRNGGQSVSARIA
FT                   NAHEAISLPSRGKTSAMPTGLAFGSEFYRERKMAAIPKYPGRIDVLCDEVLKQYRLAMN
FT                   QEGTKDQTQPPAASDFHQAAAGEPASNTSNLLPTQTPKPDPKLRSGITMGSESIIIVDD
FT                   TGFEMPFMSGAAQKPGRIANDETHETPEIEVLDDTSTQSIPVEGEYLQPICYKADEPES
FT                   AAQSNVFYPLRPLTPQRSSSVERGSTPVKEKKNSLSLRLRKYASFQSGISRQRFSMSSE
FT                   TALSTVDSNAMQDQNHKQSGPVLRRRRGGNLRQMQTGNGTEPPSCRDSFASWGDSVVDE
FT                   TVPSDGDESRPPSTLIPPNPRYSLIRPHTSRQIRRSFESVIAKFAQIPDDDDGGIESTL
FT                   LKLEGKWNGPPSTDRDSNSHREQPLGPHYGETARPGWDIISRRRQTDKSSYSTVGGRLA
FT                   PPRPYSDSVTESEESYNSIPLLERGLADESMKSQPTSQPFQYDLHVAPLTLVSSHETSE
FT                   LASSNPSIQIVHETDSMRRIPRGATIPASATDNAGQVTPKHFSALSSEMSVDLIDPHEA
FT                   MDARISTDARSLGSSTVEIPPHPLAQPPSPPMTIQHPGSFASYPSPLNTVLFQTQPLTP
FT                   DTSPRHKEVGISASRPLDIQQISSDVLFNSENNCTDQNPVINLLPDHVPFILACESQVL
FT                   AHQLTLIEMAALSEIDWRDLVEMKWSNASPLVTNWVQFLTCEERKGIDLVVGRFNLMVK
FT                   WILSEIVLTRDINERARTIIKYIHTAAHARRICNYATMLQIAIALSSSDCSRLHRTWQL
FT                   ISLEDKRLFKDMECLIQPVRNFNDLRVEMETANLQEGCIPFIGLYVHDLTYNAQKPAQV
FT                   SNTDGGLLVNFERYRTAARIVKSLLRLIDASAKYKFEPVQGIIERCLWIACLPEDEIQS
FT                   RSKALE"
FT   CDS_pept        join(complement(378393..378464),complement(377703..378191),
FT                   complement(376553..377651),complement(376095..376495),
FT                   complement(375952..376025),complement(375631..375904),
FT                   complement(375539..375592))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198455" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976242"
FT                   /orf_name="Pc18g01570"
FT                   /product="Pc18g01570 protein"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP94381.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="UniParc:UPI00018312B0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCF7"
FT                   /transl_table=1
FT                   /translation="MQSEKGLLLDVSEVYDSEDNDFVPPSPHPEAPPLCQSQECIHAAS
FT                   EILYNLDPDYENIDPCTDFDRYVCGGWRERHDMRPDQGSIFAGTIMHENAQTKLRHILE
FT                   RTEPPQPSDADNFKKLKAAYDACLDEATVNKRGSKPLTDILDELRTIYPAKAGLVKGAQ
FT                   DQLTNALLYLANAGVEALASSGVTPDDRDPDNVVIMISPPREIGLPAREYYNNTKTVAD
FT                   YTAVLKQVVQRLAGDGFDKTAEDVVAFEKKLADVTPDTQTQEDVTKYYNPLSVKETEAL
FT                   VPEISFTDIISSLAPHDYKGDRLIVGSPSYMKALSVLLKDTPRETILLFLQWKIIQAFA
FT                   EVVEDASIEPLRRFENVLAGKEPQAKEERWRKCLGRLDEGLEWSLSRFYVLDAFSEDSK
FT                   KLGDQVVSDIKERFIFTLDQTSWMSPEVRKLGIEKVGNIIQKIGFPTKSPNVLDPEDVN
FT                   KFYRDLELSKDTFFENEVAVARFQLRREWSKLGKPTNRDEWGMSAPTVNAYYNPPGNEI
FT                   VFPAGIMQPPAFYGPSAPLYLAYGAFGAVSGHELSHAFDSTGRHYDESGNYTNWWDDKT
FT                   VEAFEERAQCFVDQYSKFTVIGPEDKVLHVNGRLTLGENIADAGGLTASYHAWKKHDEA
FT                   KPDLHLPGLDAFTKEQLFFISYGNWWCGKTTKEAAEQAIYNDPHAPKSARIIETMANSR
FT                   EFKNAFSCPDKKPACKLCLSILTWSQHKCLAAPQSGFIVHYLNGYYCNPPANVTSTLID
FT                   AHSARPRCRNPKAADLHGDRCPKQAGTSPGQGNIPYRPDPKMIEEEEGEKQGPSPLALE
FT                   LDDFGSRF"
FT   CDS_pept        379723..380139
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942319"
FT                   /orf_name="Pc18g01580"
FT                   /product="Putative uncharacterized protein Pc18g01580 "
FT                   /protein_id="CAP94382.1"
FT                   /db_xref="UniParc:UPI00018312B1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCF8"
FT                   /transl_table=1
FT                   /translation="MKVSTIVTLTFATAASAAQFRITATSGDWLKTFPTSDNTPSVVLL
FT                   DDHFASVYEQWAIEGSGERYTVRNIGTGHYISCSGESCVATKEPMAFSISSAGDGFYFV
FT                   TDEVKGFTWSKAGDHLGFSEFDPNNKFKFEPVHN"
FT   sig_peptide     379723..379773
FT                   /db_xref="UniProtKB/TrEMBL:B6HCF8 "
FT   mat_peptide     379774..380136
FT                   /db_xref="UniProtKB/TrEMBL:B6HCF8 "
FT   CDS_pept        join(complement(382679..382751),complement(381742..382625),
FT                   complement(381522..381674))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217463" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127320"
FT                   /orf_name="Pc18g01590"
FT                   /product="Pc18g01590 protein"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94383.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00018312B2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCF9"
FT                   /transl_table=1
FT                   /translation="MANKILSIADLEEAASNSLSVSARDFFNSGATNQVTLHDNCAAYR
FT                   KYRLLPRVLRDVSLVNTGISLFDRDITFPLCVSPTGMQVMAHPEGELATSRACAKMGVN
FT                   MGISSYANHSVEEITVAGKELGPVHHVMQLYAMNDKAKQERIVRRAEAAGCKAIFLTAD
FT                   SPVLGVRWNEWRNGFMPPVGLGYPMYERTSVEIQQQSHDDGFSSTNSDSHSWATEIPWL
FT                   RRVTKMEIWIKGVLTPEDVETAIEYGCDGVIISNHGGRQLDETPATIDALPPCAKAARG
FT                   RIKIHIDGGIRSGIDIFKALALGAECCWVGRPAIWGLAHDGQQGVELMLKILFDDFKRC
FT                   MQLTGCRSISDINSASLAIVNAYGPLARL"
FT   CDS_pept        join(384093..384202,384305..384475,384582..384765,
FT                   384874..385032,385091..385588,385643..385959)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942320"
FT                   /orf_name="Pc18g01600"
FT                   /product="Pc18g01600 protein"
FT                   /protein_id="CAP94384.1"
FT                   /db_xref="UniParc:UPI0001831370"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCG0"
FT                   /transl_table=1
FT                   /translation="LKNKEDFDNXYNGVYKILRGYHLYRLIDKNIERPDIDIENAEDXV
FT                   TLSIXVVGXLIXYIDPDIANDLTNSRERIELVDNFMYXLKLYIRGEGYTTLSIAMIKLF
FT                   RTXRTEFTTVIEFIDGVKXRFKAINDLKVKLYPYIALIIIMSELEQVTEIKNAIEIKTN
FT                   EIKNIKDLVIEISITDYLKICTKINNKAKALGVDGGMGASVTKALKASRXLASTSTSDR
FT                   KKDKLLNVLPLGKYAKKYVEEWKNHKTXRIANSACSYYGTXGYNTKICYYLDYDNRPLN
FT                   "
FT   CDS_pept        join(389933..390059,390117..390304,390359..390522,
FT                   390573..390831,390886..391227)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000038730" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823024"
FT                   /orf_name="Pc18g01610"
FT                   /product="Pc18g01610 protein"
FT                   /function="GTP binding"
FT                   /function="signal transducer activity"
FT                   /biological_process="G-protein coupled receptor protein
FT                   signaling pathway"
FT                   /protein_id="CAP94385.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007186"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR002975"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="UniParc:UPI0001831371"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCG1"
FT                   /transl_table=1
FT                   /translation="MGCLVSKPEEADKDAFQRNARIDRAIKSDKKTLDRTIKILLLGAG
FT                   ESGKSTIIKQMRIIHSRGFPEEERHQTRAIIYSNIVIAFKVLLDIMNAEDIDFENEEKT
FT                   KPFADLLDNTDPDVGSDEAFSDLEVRDAMRAMWKDEGVQKAVARGHEFALHDNLHFFYE
FT                   SLDRIFTPGWLPDNQDMLQARLRTTGITETLFELGQMNFRMMDVGGQRSERKKWIHCFE
FT                   GVQCLLFMVALSGYDQCLVEDQNANQMHEAMMLFESLVNGEWFKRKPIILFLNKIDLFK
FT                   GKLAISSISKHFPDYTGSDTDYDASAQYFADRFRGINRIPDREIYIHYTNATDTTLLKA
FT                   TMDSVQDMIIQKNLHTLIL"
FT   CDS_pept        join(392149..392497,392599..393287)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198444" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942321"
FT                   /orf_name="Pc18g01620"
FT                   /product="Pc18g01620 protein"
FT                   /protein_id="CAP94386.1"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniParc:UPI0001831372"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCG2"
FT                   /transl_table=1
FT                   /translation="MLSTSLRRAAWTPLPLPGITRSGQNLTSSLLGATRPLHQRRYSSS
FT                   SSKPPVPPSDGPRRMDTSAPAKGVNSSSEKSKANRRRGKDSSARNGSSKSSQPTAFSNL
FT                   PSVPSTQHRQPHASFFSIHRPISVTTTVPPTSSTDAFEAIFSSKRPLKNEPEDVIFTLS
FT                   SAVQSMETGSQGMSESEEQFRSFSEQDGELRMLDGPDAKMSVEEFTRRLRPFQPPPPPV
FT                   PLDTSAAETAESTDAQIDNEYQTYSTVLTIREARHADGRKTYEAHTGPFVRSGEMEDPS
FT                   DMRDEISIEAPSDSTAGMTYMERLRNNHTMHAISTMRRRKAKMKKHKFKKLMKRTRTLR
FT                   RKLDK"
FT   CDS_pept        join(complement(395319..395335),complement(395179..395191),
FT                   complement(394921..395050),complement(394665..394821),
FT                   complement(394498..394601),complement(394375..394433))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000056520" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823025"
FT                   /orf_name="Pc18g01630"
FT                   /product="Pc18g01630 protein"
FT                   /EC_number="3.6.3.6"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="hydrogen-exporting ATPase activity,
FT                   phosphorylative mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, coupling factor F(o)"
FT                   /cellular_component="proton-transporting V-type ATPase, V0
FT                   domain"
FT                   /protein_id="CAP94387.1"
FT                   /db_xref="GO:0008553"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0033179"
FT                   /db_xref="GO:0045263"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="UniParc:UPI0001831373"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCG3"
FT                   /transl_table=1
FT                   /translation="MATELCPVYAPFFGALGCTSAIVFTCFGAAYGTAKAGVGVCSMAV
FT                   LRPDLIVKNIVPIVMAGIIGIYGLVVSVLVANDLTQKLPLYTGFIQLGAGLSVGLAGLA
FT                   AGFAIGIVGDAGVRGTAQQPRLYVGMILILIFAEVLGLYGLIVALLMNSRSKAVC"
FT   mat_peptide     join(complement(394921..395017),complement(394665..394821),
FT                   complement(394498..394601),complement(394378..394433))
FT                   /db_xref="UniProtKB/TrEMBL:B6HCG3 "
FT   sig_peptide     join(complement(395319..395335),complement(395179..395191),
FT                   complement(395018..395050))
FT                   /db_xref="UniProtKB/TrEMBL:B6HCG3 "
FT   CDS_pept        join(complement(397113..397125),complement(395626..396980))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198433" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942322"
FT                   /orf_name="Pc18g01640"
FT                   /product="Pc18g01640 protein"
FT                   /protein_id="CAP94388.1"
FT                   /db_xref="UniParc:UPI0001831374"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCG4"
FT                   /transl_table=1
FT                   /translation="MQIDDDILTSLPSGPASLSAAPASVPLLLVTPSFAHWLDSSSPFL
FT                   SQFLSRLYGNSPDKDTLYAVTAVVDALPNTTSEGPNFSESEGLSLLAVGQAGVHAKAAP
FT                   ARLIRSSASEETNLLFSFQTEAIGQPAHEVGLRLANTIFVNGRETTIFGTRWLWDKSSN
FT                   RYVLDKSADFTSCMVTASSQAVDTALELPLHPVTERRRVMTSMGNILRQLAKSTDVRSM
FT                   DTMPASSELEKELPRYIAEHNIIDQRVSVWALVEKPQLEVAGAGSSTHDRLIKSLHQGG
FT                   KLHRVMSGGGGWGKKQGLLSLDPEICFSETVKRDDLVALSQIFDPDTTQLDTLPSIDKG
FT                   ITVDDLSLLSQVATAGDYIQFFVSVEPTGAQSKVSSDHDSQEEPISYHFGMVADPMEIE
FT                   THVTNEDSNGIISLPRTFGALSEKAISYSQPIKAEMESESCTKLDIPGSRVVLKTV"
FT   CDS_pept        join(complement(398405..398659),complement(398008..398133))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823026"
FT                   /orf_name="Pc18g01650"
FT                   /product="Putative uncharacterized protein Pc18g01650 "
FT                   /protein_id="CAP94389.1"
FT                   /db_xref="UniParc:UPI0001831375"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCG5"
FT                   /transl_table=1
FT                   /translation="MERLDLVQQPQSSTKAIASLLFQCHRISPHSPTRSEPTPYCGTVF
FT                   HESLQVVPYFLQETHPADLIFSAAAFLMLTERLRVLLNRLGEPVFEQPSDLRGFQGFVW
FT                   CIRIGYSFAYVYLGNLGIYGWS"
FT   CDS_pept        join(398834..399126,399190..399220)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823027"
FT                   /orf_name="Pc18g01660"
FT                   /product="Putative uncharacterized protein Pc18g01660 "
FT                   /protein_id="CAP94390.1"
FT                   /db_xref="UniParc:UPI0001831376"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCG6"
FT                   /transl_table=1
FT                   /translation="MLISLGHEQLTPATFLFQSSHKRQPHADTRRLAGAQVGAIHHRAE
FT                   LPGHDLQQVLGRPKQVKIHAKFRSDGVCRDRRYHETSTAAWAHSYILQSTEYINLGQSK
FT                   IKS"
FT   CDS_pept        join(399691..399707,399852..399986,400045..400066)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000274029" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942323"
FT                   /orf_name="Pc18g01670"
FT                   /product="Pc18g01670 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94391.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniParc:UPI0001831377"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCG7"
FT                   /transl_table=1
FT                   /translation="MPFTASDICKIIFAIILPPLGVFLERGCGADFLINILLTILGWIP
FT                   GVIHAIYIIFKY"
FT   CDS_pept        401552..403474
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976243"
FT                   /orf_name="Pc18g01680"
FT                   /product="Pc18g01680 protein"
FT                   /protein_id="CAP94392.1"
FT                   /db_xref="InterPro:IPR008427"
FT                   /db_xref="UniParc:UPI0001831378"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCG8"
FT                   /transl_table=1
FT                   /translation="MTLLPIHRILIAILLILTLRSAAEDASNSALYDMVPDCAKDCVDS
FT                   FIKSEYTPMECTSPSDIKCLCRTRTTSSLTLGEAALSCVLSVCSQTVIAKSKAYHICDS
FT                   VSEALPKTHQTITATVFSDTSTTKPSDEKTTAETISTSSTSTAEHTSEASVTTPTAASA
FT                   STPTSTTSSQTSEITSYDASSSSGSPVEPTSSTGQISSDSSEDTNKKGDHGITPAAVIG
FT                   MSVASGVAGSFIIGVAVFYCCKRWRRKQREQAAPHVFEIGGAMSEPPDFSKPMPQLPRE
FT                   GLGLGSSYSPASDRETMLQRPGTFHSMGSVQPVSRYSPQSCTVHNLGQSKEPKGQERIG
FT                   FAISSDSDWESSPRTQSSQHSVARLLPDPTAGLYPKPLKWSHRPPSGETLFEEDESQQA
FT                   AAAATAGMVQNDSPRLGVQPKLVGLPANPRAFKKGLPAGHFNQRSGAPSTLSPPFNPNP
FT                   AFGASSSDSSATTNETPETSETSQTSYSSLNPNVLFAAPANTIHTQPKDRSLSPGRQAP
FT                   QPCPTPSSSSTLPPGSEIVSRPRIIRGNDIKRVEIRNSPRPPSEVVAPYCPDDLWLERG
FT                   RILAPPRSREPSGELPYPSDMFPGAVHYPDSPKKKADAASNRVSPTSRNLTPSRRGDDL
FT                   ILRVD"
FT   sig_peptide     401552..401620
FT                   /db_xref="UniProtKB/TrEMBL:B6HCG8 "
FT   mat_peptide     401621..403471
FT                   /db_xref="UniProtKB/TrEMBL:B6HCG8 "
FT   CDS_pept        join(403952..404582,404635..405623)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976244"
FT                   /orf_name="Pc18g01690"
FT                   /product="Pc18g01690 protein"
FT                   /protein_id="CAP94393.1"
FT                   /db_xref="UniParc:UPI0001831379"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCG9"
FT                   /transl_table=1
FT                   /translation="MATPTDRKLVQRSTLLPVFPLELWDIIIEHLREEESAQHLSRLAQ
FT                   TCPALYSRIDPQLYKSVRLFNSESGGRLALTIEKRPELASLIREIRHKQDTGSEIWSHR
FT                   HLKFYKAAVTLPNLEKLSLRRNPRPFDSTRWASTHARDDAVVQWVKKIASGSGSIKEYR
FT                   DLGYGPPGESSFSPPDDELICMQDGAAETLFWHASLQNPPGLPALRVCHIGSDYNHDVH
FT                   DTKMDGRCIPSFNEALFCHPSLRKLCITGATCQISQSSLPNSTLSTSPLEELTLLNCVI
FT                   SPLDLQTVLEYPTALKRFTFRGPRSQEMVDSEGDTHSYIESALKHDNSLEYIDYDLYWG
FT                   SDVETDFGELVRLKHLTTTLATLAGRECIELDPPDDTLPPNLESLTIRYDEVKSWLPSV
FT                   VYEMVKVGDLPQLRRFTCEVPEIIEHLPSINESKSNPPATEICQEGNTWKSKFAELNVD
FT                   MSMVLVPYPIDMPKYDVCSCECLPFYHRMSYHPHKPLSLPWEDDYREEDVFFEDWADID
FT                   DGMDLDALMDDLAEDSDPDVWD"
FT   CDS_pept        join(complement(406989..406994),complement(406812..406895),
FT                   complement(406308..406520))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127321"
FT                   /orf_name="Pc18g01700"
FT                   /product="Putative uncharacterized protein Pc18g01700 "
FT                   /protein_id="CAP94394.1"
FT                   /db_xref="UniParc:UPI000183137A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCH0"
FT                   /transl_table=1
FT                   /translation="MMRLFRSSEYRLFQIHRAYQAVDVILREIKCRAHFDALNSVQWTR
FT                   DNMRDTCQTWSEHPGPFRRWRIQPFIKECNVEGRMLERHTRLSVAALCRDAPDSY"
FT   CDS_pept        join(407572..407891,408014..408959)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184411" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670276"
FT                   /orf_name="Pc18g01710"
FT                   /product="Pc18g01710 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP94395.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR006353"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000183137B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCH1"
FT                   /transl_table=1
FT                   /translation="MANTLGTGRVRLDMATARADLYGPNVVVPKHFINFTSDHIFKSNM
FT                   TKQVSDTSPINTPMKNPPKVTSDDFALAFDIDGVLIKGGEPIPEAVDAMKYINGENPYG
FT                   VKVPYIFLTNGGGKTEKERCLDLSKQLDLEVDPGQFICGHTPMREMAERYHTVLVVGGE
FT                   GEKCRVVAEGYGFKDVITPGDIIKTRHDTTPFRTLTDEEHENSRLLDLDKVRIEAIFVF
FT                   ADSRDWAGDQQIILDCLMTKDGWLNTRSEIFTEGPPVFFSHTDVVWSTSHEHSRLGMGA
FT                   LRASLEAVYTAITGKDLNTIAFGKPQLGTYAFATRLLQKWRKDSCAIDKPPSTVYFIGD
FT                   TPDSDIRGTNEFNETTDNDWFSILVKTGVYQDGAVPRYPPRKICDNVFDAVKFAIEREH
FT                   RKSSKGVTVSELDYETSNDVPK"
FT   CDS_pept        join(409469..409471,409525..410316)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230779" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942324"
FT                   /orf_name="Pc18g01720"
FT                   /product="Pc18g01720 protein"
FT                   /function="ATP binding"
FT                   /function="alanine-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="alanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP94396.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004813"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006419"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniParc:UPI000183137C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCH2"
FT                   /transl_table=1
FT                   /translation="MVPRTEAVYLDDATLRTLTTEVLSFQSITSLSEEEKGLAKNVPAE
FT                   DNAITMRQTIFYAQGGGQPSDTGAIGPVDQDPTFEVSAVRKTPDGRFLHFGKFLDATSS
FT                   FVVGQSVVQKVDDSKRNYHSRLHTAGHIVGLAMQLLMPEKKKVKANHFPREASMEYEGL
FT                   LYNEHKPVIQEKVDELVRLDLPILISWLQGGALVGDGEGAEEGRSHDGRTRIASIGGLD
FT                   HNPCGGTHVARTSLVGSVVIRKISRQKGISRVSYDVSPGIEA"
FT   CDS_pept        join(complement(411806..411870),complement(410435..411740))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198411" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942325"
FT                   /orf_name="Pc18g01730"
FT                   /product="Pc18g01730 protein"
FT                   /protein_id="CAP94397.1"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="UniParc:UPI000183137D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCH3"
FT                   /transl_table=1
FT                   /translation="MESSETMPDASKADHLCVLIHGLWGNPSHLDYIASALRDRYGGDN
FT                   LYILCPKTNSGNYTYDGIELGGERIVHEVEETLESLAERGQKITKISVIGYSLGGLLAR
FT                   YAIGLLNARGWLDKLEPINFTTFATPHLGVRAPLKGYKDQVFNVLGPMTISASGRQMWL
FT                   IDSFRDTGRPLLGVLADPESIFITGLKKFRQRSVYANIVNDRSVLFYTSGLSKVDPFRD
FT                   LEDVNINYVKGYEDVIIDPDLHVLPPLERKPGSATARFWKKLKSVTLWIPLSLLLIILV
FT                   PLASTIFLINAGIQTCRSSKRIRLHEVGENGERFGRYRVPVFLQDAQHVVEQAFENVNT
FT                   IQEPAYLSNSDTEVSDAAPEKSRSSFSKSAQNDADAQSSSARRSSTEASTHSPKLALTR
FT                   EQFGIIDSLNAVGVRKYPVHIQKHYHSHAAIIVRAEKDGFREGKIVMKHWLDNEFVL"
FT   CDS_pept        412522..414447
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000198400" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942326"
FT                   /orf_name="Pc18g01740"
FT                   /product="Pc18g01740 protein"
FT                   /function="exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP94398.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000183137E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCH4"
FT                   /transl_table=1
FT                   /translation="MFTPLGLFGAISCPQGQDCTLLKCIFSHDNEPAPAEAPISKIPAS
FT                   ADDGPPSKRVKVGNTQLPGPTLPSHSSKESSLEMERRSSKPVVSKQSHNSRDTSGTQDI
FT                   PQPTSSHGPPKPLGNEPVKSTNTTSAGSSSRLPPRKAPKETLNPRMLAHAPATHGSRTA
FT                   ILQKLHSAMTALNEKLRKDKHSSNRCFVLTPDELITMALDEEEKFARDSPSVYSNVIKL
FT                   RIVKVTKMGIDEWTKEVMSHLNARYYKINPIQKPQAIPMPINTGLTPAEEIAVVSQLVT
FT                   PLAGLEQHGYVTKPPTNADIEIAKRGVDESKGWEKCDRCGQRFQVFPGRREDGTLASGG
FT                   CCNYHPARPVYPQRKKTDHVTGPSQPYFPCCSEALGTSTGCTRAETHVFKVSEAKRLAS
FT                   ILQFQTTPSQPGKGPLEPVSIDCEMGYTTLGLELIRLTAVSWPKGSTLLDVLVRPMGEI
FT                   LDLNTRFSGVTQQHYASTIPYGTSMPNTHSPAGDETKKTNPPLQLVQSPAEARELLLKL
FT                   LQPETPLIGHAIDNDLNACRIIHPTVIDTVLLYPHPKGLPIRLSLKALVQRHLGRDIQV
FT                   GDNGHDSKEDSIATGDLVRVKVGEKWKELKKKGQKIEGGRLVCPDGQVSTSTSSWTTVQ
FT                   KRKSNR"
FT   sig_peptide     412522..412569
FT                   /db_xref="UniProtKB/TrEMBL:B6HCH4 "
FT   mat_peptide     412570..414444
FT                   /db_xref="UniProtKB/TrEMBL:B6HCH4 "
FT   CDS_pept        join(complement(415372..415386),complement(414948..415180),
FT                   complement(414739..414865))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198396" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942327"
FT                   /orf_name="Pc18g01750"
FT                   /product="Pc18g01750 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP94399.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR002671"
FT                   /db_xref="UniParc:UPI000183137F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCH5"
FT                   /transl_table=1
FT                   /translation="MAPAAARGRKAQKVTQKFVINASQPASDKIFDVSAFEKFLHDRIK
FT                   VEGRVGNLGENVVISQSGDGKIEVVAHIPFSGRYLKYLTKKYLKKQQLRDWLRVVSTSK
FT                   GVYELRFYNVVNDEAEEDEE"
FT   ncRNA           415793..415985
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="U2"
FT                   /db_xref="Rfam:RF00004"
FT   CDS_pept        join(416647..416761,416815..416862,416922..417164,
FT                   417224..417249)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198385" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942328"
FT                   /orf_name="Pc18g01760"
FT                   /product="Pc18g01760 protein"
FT                   /biological_process="mitosis"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAP94400.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="InterPro:IPR004123"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0001831380"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCJ7"
FT                   /transl_table=1
FT                   /translation="MGSIVLPHLQTAWHVDQAILSEEERLVVIRFGRDHDPDCIRQDEL
FT                   LYKIAERVKNFAVIYLCDLDQVPDFNQMYELYDRMTIMFFYRNKHMMCDFGTGNNNKLN
FT                   WVLEDKQELIDIIETIYKGAKKGRGLVVSPKDYSTRYRY"
FT   CDS_pept        join(417808..417873,417985..418021,418138..418191,
FT                   418319..418452,418506..418611,418704..418789,
FT                   418847..418996,419063..419137)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198374" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942329"
FT                   /orf_name="Pc18g01770"
FT                   /product="Pc18g01770 protein"
FT                   /function="sequence-specific DNA binding"
FT                   /protein_id="CAP94401.1"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR002848"
FT                   /db_xref="InterPro:IPR016068"
FT                   /db_xref="InterPro:IPR016069"
FT                   /db_xref="UniParc:UPI0001831381"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCJ8"
FT                   /transl_table=1
FT                   /translation="MIDQRIFENLQTKIDEETTVRDELHEIVQKLARRGRSTQAILSRA
FT                   HSTPADQLKPVLDDVTKEILAQKEEVTRLKAVADQHPFYKYNGLWSRELQNLVASIELC
FT                   AWLGGLQEHKGPSSTSFMTIEDVGKFLDIPVNLKEQDAFHLTIEEYLLALIAMVEELAR
FT                   LAVNSVTLGDYTRPMQIGNFVKELFAGFQLLNLKNDILRKRSDGIKYSVKKVEDVVYDL
FT                   SLRNLVPKGSSSA"
FT   CDS_pept        join(complement(420058..420100),complement(419426..419952))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000277054" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823028"
FT                   /orf_name="Pc18g01780"
FT                   /product="Pc18g01780 protein"
FT                   /function="glutathione peroxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="CAP94402.1"
FT                   /db_xref="GO:0004602"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0001831382"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCJ9"
FT                   /transl_table=1
FT                   /translation="MSSATSFFDFEPVDKKGAPFPLSSLNGKVVLVVNTASKCGFTPQF
FT                   EGLEKLYQELKAQYPEDFTIVGFPCNQFGSQDPGSDDEIQSFCQLNYGVTFPVLGKLDV
FT                   NGDNAAPVWTFLKEQQPGIMGMKRVKWNFEKFLVSADGKAVNRWASLTKPEGLKDTIVK
FT                   EIEKAKKEGTLASLKSEAGAEQAKLS"
FT   CDS_pept        complement(421193..422161)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942330"
FT                   /orf_name="Pc18g01790"
FT                   /product="Putative uncharacterized protein Pc18g01790 "
FT                   /protein_id="CAP94403.1"
FT                   /db_xref="UniParc:UPI0001831383"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCK0"
FT                   /transl_table=1
FT                   /translation="MKFTGFTVSLAVAGLGYSAALPVLGNVNGAVSGVEGVVGGATGSA
FT                   AKIVAPITSTAGGLTGGLKRDNTASLGETAETIPGLANTAVGIAGSAVGTGESLVSGAA
FT                   GTAEKAIAGAGPAAKRGVNDLVGSTLGSALPAIMKEAKAGAPAGILKRDGTAALGDTVE
FT                   TIPSLANSAVTIAGSAVGTGESLVSGAAGTAENAVAGSAAKRELNDLVGSTLGSAVPAI
FT                   IHEAKAGNPVAGAGPAAKRGVNDLVGSTLGSAVPAIIQEAKAGGPAGVLKRDGTAALGD
FT                   TVETIPSLANNAASIAGSAVGTGESFVSGAAGTAENAVGHT"
FT   mat_peptide     complement(421196..422101)
FT                   /db_xref="UniProtKB/TrEMBL:B6HCK0 "
FT   sig_peptide     complement(422102..422161)
FT                   /db_xref="UniProtKB/TrEMBL:B6HCK0 "
FT   CDS_pept        join(422169..422207,422348..422483,422561..422658,
FT                   422780..422843,422942..423019,423105..423259)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942331"
FT                   /orf_name="Pc18g01800"
FT                   /product="Putative uncharacterized protein Pc18g01800 "
FT                   /protein_id="CAP94404.1"
FT                   /db_xref="UniParc:UPI0001831384"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCK1"
FT                   /transl_table=1
FT                   /translation="MFVRSRRVEKSDSGHREPPRIWGVQGRCFDRCSCPLRSTKVVNYQ
FT                   PPALTGCNPSSRAGFKRCGGSKCPTIGQDKAGQIMVEACSALRDIFAIQVRDVQYDLGS
FT                   AWAVGSGKGSPLDALAFTLYEIQALMKLQQFPALDDVQLDNQTTVVSLGKIVSLGSSGM
FT                   TSSAFSRGDATEDKVNMKQIANKLLY"
FT   CDS_pept        join(424224..424272,424346..424877,424931..426170)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198341" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823029"
FT                   /orf_name="Pc18g01810"
FT                   /product="Pc18g01810 protein"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /function="protein tyrosine/serine/threonine phosphatase
FT                   activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="CAP94405.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008138"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="UniParc:UPI0001831458"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCK2"
FT                   /transl_table=1
FT                   /translation="MTTDFNHGGQMIEYIQDRLYLASYDSAPSSRTPFPFHLDAPKSPS
FT                   KRARAQPATPSKRRSPVYFTIDDTLLYNAFHADFGPLHIGHLYRFAVLFHEILGDPANS
FT                   DRPVVFYSKTDARSRANAACLVACYMVMIQSWPPHLALAPIAQADPPYMPFRDAGYSQA
FT                   DFILNIQDVVYGVWKAKEQSLCGLRDFNLEEYEKFERVDMGDFNWVTPDFLAFASPQHQ
FT                   PVEPIPVNTPEYNALPTTISEISSSKLPMPFKNVLAHFHQRNVGLVVRLNSELYCPSYF
FT                   TAMGIAHIDMIFEDGTCPPLQLVRRFIKMAHEMITIKKKGIAVHCKAGLGRTGCLIGAY
FT                   LIYKYGFTANEVIAFMRFMRPGMVVGPQQHWLHLNQGAFREWWFEDSMREKLAQSTPVT
FT                   PRVSTKKRTSNGVVSTPPNNSHSKRAALGEIDHNEAAAYPDQDLPAPTPGQPRKSHRKD
FT                   SRHHPYSRTASGSLAVENEQRSHRSHRKSNESSESEEEIQLRRLAQRSSRSPVASPTSR
FT                   SISYSATVTASYTLTEDNHKDQENWVDHSAPKTPVSRKSGAAPISVSKVRSSPRRPTEN
FT                   TRSESRGVRKPSGRIGSNTISPARAIKTIH"
FT   CDS_pept        join(complement(429339..429467),complement(429238..429292),
FT                   complement(429116..429218),complement(428986..429053),
FT                   complement(428762..428934),complement(428657..428692),
FT                   complement(428095..428601),complement(427658..428043),
FT                   complement(427394..427605),complement(426860..427329),
FT                   complement(426789..426806))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184379" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127322"
FT                   /orf_name="Pc18g01820"
FT                   /product="Pc18g01820 protein"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="double-strand break repair via
FT                   nonhomologous end joining"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94406.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006303"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR005160"
FT                   /db_xref="InterPro:IPR005161"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR014893"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniParc:UPI0000DAC7AA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCK3"
FT                   /transl_table=1
FT                   /translation="MAEKEATVYIVDMGRSMGERHHGRPMTDLEWAMQYVWDRITATVA
FT                   TGRKTATVGVVGLRTDVSTHWDPCLMFGTGTINDLEEESFSNISILFGLGQVLMPDIRK
FT                   LRETIKPSNTNRGDAISSIVIAMQMIIDYTKKNKYKRKIILVTNGTGVMSDDNIEGIIE
FT                   KMKEVNIELVVMYYGVKEEDKDSRKAENETFLRSLAEDCEGAYGTLEQAVSELDIPRIK
FT                   VTKSMPSFKGNLTLGNPEEYDTAMTIPVERYFRTYVAKPISASSFVPRSGTEPGSQAPV
FT                   KGDAEGDALASVRTSRTYQITDESAPGGKIDVERDDLAKGYEYGRTAVPIEQTDENVAN
FT                   LQTFAGMGLIGFVQKDQYDRYMHMSNTNIIIPQRANDYASLALSSLIHALYELESYAVA
FT                   RLVTKESKPPMLVLLAPSIEADYECLIEVQLPFAEDVRSYRFPPLDKIITVSGKVVTEH
FT                   RNLPSVALKDAMSNYVDSMDFVTTNDEGQATDDLPIDESFSPLLHRIESAVRYRAVHPN
FT                   DPVLDPSERLTEFAHPSEDMVKNSKSHLEKLMSIADVKKVPPKTKGRKRQRETEKPLSG
FT                   LDVDALLSLEPKRTKISTENAIPEFKQTLSRAENIDAIHDAVQQMAKIIESQITHSLGH
FT                   SNYDRVIEGLGTMREELVDYEEPAVYNDFVRQLKGKMLREELGGDRRELWWFVRKGKLG
FT                   LIGKSEVDSSAVEEQEAQEFLAPN"
FT   CDS_pept        join(429776..429804,429855..429888,429959..430247,
FT                   430312..430478)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160735" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127323"
FT                   /orf_name="Pc18g01830"
FT                   /product="Pc18g01830 protein"
FT                   /protein_id="CAP94407.1"
FT                   /db_xref="UniParc:UPI0001831459"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCK4"
FT                   /transl_table=1
FT                   /translation="MDPRPYHVLSYGTLLGTQFYQSFVGGFVSFRALPRPQFASLQTAI
FT                   FPIYFSLQSALPVVVALTASHGGQALGLSGLTAPENRLNTLLPLATVTVTGLVNMFVLR
FT                   PITTNVMRKRKHQETRDGKRSYDPAPHSKEMLALNKKFGRVHGISSLVNLVSLVATIWY
FT                   GAVLSKRLE"
FT   CDS_pept        join(432119..432157,432264..432298,432348..432405,
FT                   432507..432551,432604..432639,432691..432809,
FT                   432863..432888,432939..432969,433024..433378,4
FT                   33432..433680)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161754" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942332"
FT                   /orf_name="Pc18g01840"
FT                   /product="Pc18g01840 protein"
FT                   /protein_id="CAP94408.1"
FT                   /db_xref="UniParc:UPI000183145A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCK5"
FT                   /transl_table=1
FT                   /translation="MDQDTHHDPVEPESDIDGSSLYSDSLDNASYTTSVTSSVLDYQYN
FT                   GRRYHSYREGEYLLPNDEREQDRLDLSHHIYLMLLKGELLKAPVKDPKRVLDLGTGTGL
FT                   WAIEYADTNPNSQVIGIDLSAIQPSWVPPNCRFEIDDFEQPWSYSKPFDYIHGRELEGS
FT                   IRDHDLLFRQALDNLNPNGWLEMASFDVNTYSDDGTHLKATNLMISIKHMHESSRMFGK
FT                   DMTSSPSWKERMVKVGFVNVKEDVYKLPQSPWPKDPKLKELGRYHQLNMLEAMPIYTYA
FT                   LFSRVLGWTRSEIEGLLTGIRMELRDTSYHLYTNLRVVYGQKPGGPVAA"
FT   CDS_pept        join(complement(434618..434627),complement(434216..434517))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942333"
FT                   /orf_name="Pc18g01850"
FT                   /product="Pc18g01850 protein"
FT                   /protein_id="CAP94409.1"
FT                   /db_xref="UniParc:UPI000183145B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCK6"
FT                   /transl_table=1
FT                   /translation="MPQGRYKVCEIAQIQLEVEIDNFKVYQGNMSENIDTRDSTPKISK
FT                   SQSSEDLNATQEKSHPSPLQRLKKQWKEIKKEWGPLMAAKEDWDDEYTFPPGRYSGQR"
FT   CDS_pept        join(435546..435574,435630..435749,435808..436006,
FT                   436069..436472,436570..436876)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000046303" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127324"
FT                   /orf_name="Pc18g01860"
FT                   /product="Pc18g01860 protein"
FT                   /function="D-amino-acid oxidase activity"
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94410.1"
FT                   /db_xref="GO:0003884"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006181"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniParc:UPI000183145C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCK7"
FT                   /transl_table=1
FT                   /translation="MKSEPVVIIGAGVIGLNVALVLAEKGYGRYTTIIAEHLPGDTSIN
FT                   YTSPWAGANFSAISASDPNALRWDKLGYMHLLDLAAKDGQNAYVKETPSVEYWDELPSR
FT                   EKIDSMAAYLKDFKKIATQDLPAGVAFGVKFTTITLNAPMHLRYLFKKLTEEYGVQVIR
FT                   KKLPQLSSGYLSKDTKVVFNCTGNAAKELPGVQDSKCFPTRGQILLARAPHVQHNIMRH
FT                   GKDYETYVIPRPYSNGNVILGGFMQKNVGTPDTFGEETESILARTTALLPVLNSDETEI
FT                   LGAFAGLRPSRKGGARVARESVKVGDAGRWGVVVHNYGAGGTGYQAGYGMAVEAVNTVI
FT                   EEITALEVQSHL"
FT   sig_peptide     join(435546..435574,435630..435669)
FT                   /db_xref="UniProtKB/TrEMBL:B6HCK7 "
FT   mat_peptide     join(435670..435749,435808..436006,436069..436472,
FT                   436570..436873)
FT                   /db_xref="UniProtKB/TrEMBL:B6HCK7 "
FT   CDS_pept        complement(437113..438162)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942334"
FT                   /orf_name="Pc18g01870"
FT                   /product="Putative uncharacterized protein Pc18g01870 "
FT                   /protein_id="CAP94411.1"
FT                   /db_xref="UniParc:UPI000183145D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCK8"
FT                   /transl_table=1
FT                   /translation="MVPTEFAHRPKGQLKGKLQRSTRDLVGRSTAMWDNSKDRYHQSTM
FT                   EIWHKSAGTLNDSKDRCHQSVKLMLYRSVSKWNQSADQLHRVARLEDTIPYVPARDEQT
FT                   EEQTPPQSRFYSREFNSQSTASSPNPKTISPSTQAASIKPTSVIGPSLSPEEQIRVFHE
FT                   ATVPVNSTVKQARQLRDDKRTALGEIELEWVNSTITDAENAANDLAAFVKQFKQTSPQY
FT                   RSSWKRRDYEVALKKQSHMLLSHSKVKAILSHLGSLQTTLGKNEGFFSPSEVSTVLPPI
FT                   SELPCETSVISVFELPCISPAKTERPIPKIVVTHYDGDRDDNETYSHADESPPLSHEAN
FT                   GMNSMAELP"
FT   CDS_pept        join(439005..439543,439593..439758,439815..440246)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217563" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942335"
FT                   /gene_name="abnx"
FT                   /orf_name="Pc18g01880"
FT                   /product="Exo-arabinanase abnx-Penicillium chrysogenum "
FT                   /protein_id="CAP94412.1"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="UniParc:UPI000019A64E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCK9"
FT                   /transl_table=1
FT                   /translation="MRIPQVLAFAAAAAAATIPRSKQSSPTSLTNVTIFSPPSDYIVPR
FT                   TLYPRNEQLPNGDLLATWENYSPEPPAVYFPIYRSKDHGKTWNEISRVHDTVNGYGLRY
FT                   QPFLYSLPERVGSFKKGTLLLAGSSIPTDLSSTDIVLYASQDDGMTWDFVSHIAAGGEA
FT                   RPNNGLTPVWEPFLLANKGKLICYYSDQRDNATYGQTMVHQVTNDLKNWGPVVEDVTYP
FT                   TYTDRPGMPVVTKLPNGQYFYVYEYGSFFGTETYSFPLYYRLSSDPENIASAPGQRLVV
FT                   SSGTQPTSSPYAVWTPYGGENGTIIVSSGTQGTLFINKALGEGEWTEIPCPEEHGYTRA
FT                   LRVLSEDGGRYLVVNSAGVLLGENNRVSVSVMDLKEVL"
FT   sig_peptide     439005..439049
FT                   /gene_name="abnx"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCK9 "
FT   mat_peptide     join(439050..439543,439593..439758,439815..440243)
FT                   /gene_name="abnx"
FT                   /product="exo-arabinanase abnx-Penicillium chrysogenum "
FT                   /db_xref="UniProtKB/TrEMBL:B6HCK9 "
FT   CDS_pept        join(440708..440917,440984..441509,441565..441791,
FT                   441848..442127,442191..442424,442476..443218,
FT                   443275..443437,443491..443823,443883..444006,
FT                   444063..444134,444247..444990,445047..445130,
FT                   445190..445564,445615..445846)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185453" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942336"
FT                   /orf_name="Pc18g01890"
FT                   /product="Pc18g01890 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94413.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000183145E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCL0"
FT                   /transl_table=1
FT                   /translation="MLDCSVEEDAFGPIVAPSCLHGFDFTLLFEESILTLGPIVLVCFA
FT                   ASIRIWKLWAVPEKVNRSWLYATKELSWLFYTGCHMILLALWCQSTLKTRATVLTTFVT
FT                   VIISLLLAYLSHLEHLRSIRPSTVINVFLVFTLLFDLVRLRTLYFMPISQTLKLLFAIS
FT                   LAIKATILGLEATEKRSLLKKRYENSPIESTSGMLNRAIFWWLNELLWRGSKDILKVDS
FT                   LPALDNDLRAASSPRSLLDRWDKANKHHQNSLLWTFISHYKWAFFEGVIPRLAYTGFCF
FT                   AQPFLVERVLNFMAEPEHVNSANYAYGLIGAYAIVYLGIAISHAAYEHKTYRVITMVRG
FT                   SLVTLIFNKTLRMSTTAISDTAPITLMSTDIERIGSGLREVHEVYSNFIEVALALWLLA
FT                   RLLNIATIAPTVVVVVCLAAGVPLAVACGKAQGTWLEAVEERVTVTSKVLEVMKNIKMT
FT                   GLTETISSSLRNLRSAEIHASFPFRLYETLGITLGYTSSSLAPVFGFGVYAILARVNDT
FT                   ATLTNGLAFSALTLFSLLDQPMGSIVNGSEDLMAVVNCFQRIQKHLMEKERVDYRLKHN
FT                   ARDSQSVQNTTTAPLVETDSSAWEHYIEPCAIIRNVSAAWSIDTEPVLKGLNINIQESK
FT                   ITMIVGAVGSGKSTYLKMLMGEIPECSGSISTSFNHAAYCSQSPWITFGTIQENIVGAS
FT                   PWDRPWYDQVTKSCALQPDFQQLPAGDQTKVGVSGSRLSGGQQIRVALARALYSKEPVL
FT                   VLDDALTGLDRETEKMILENLFAEHGCLKRSRQTVIMATNSAYHLLYADNVIALDQDGR
FT                   ITQHGSYSDLMGFDGYIRMLSDNIHQVNSVRAPDIVLDDETLRELNLDDQPTDLSRRTG
FT                   DWTVYRFYFQNIGWPLLSIFLACCVLFILGLSFPQIWLQWWTSANEQHPNEHVYYWLGV
FT                   YVALSFFSLLTTFAGTWILIMIIQPRTARRFHEILLRTTMGILSFLNGLLILLIWFLAC
FT                   RFSQDLELIDDELPPALELTVNAALSCVIEGFLVFVGSSYITAAVIPVCVLVVYYVAKF
FT                   YVQTSRQMRLLDIEAKAPLFSQFLEALNGLSSIRAYGWTEDYHRRNQIALDASQRPSYL
FT                   LYCIQRWIGLVLDLIVAGIAAIVVAVAISMKGSPSMNLLGIALFNIVNFSGTLQMLVTD
FT                   WIGLETSIGAVARIRSYVRQVTTEDLDSETKTVPEDWPRKGGIDITGLSASYDSASGPV
FT                   LTGIDLSIQPGEKIALCGRTGSGKSSVVSAILRILELDSGTILIDDIDISKVSRSHVRS
FT                   RINTIPQQPFFLHGTVRLNANPEGNATDEAIVESLQAVNLWSHIQLKGGLDIDMSDDLL
FT                   SHGQQQLFCLARALCKSSNIIIMDEATSSVDSETDALMQTVIRTHFKNQTVIAIVHKLH
FT                   AVLDFDKVALLESGKIVEFDTPKALLSKEGSAFRNIVEAFDDSSKE"
FT   CDS_pept        join(446127..446257,446302..446321,446380..446558)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942337"
FT                   /orf_name="Pc18g01900"
FT                   /product="Putative uncharacterized protein Pc18g01900 "
FT                   /protein_id="CAP94414.1"
FT                   /db_xref="UniParc:UPI000183145F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCL1"
FT                   /transl_table=1
FT                   /translation="MSDSPYDFTENPAVQCELNTKQEPSISIRGALQEDGVGDEDEERK
FT                   EGLPQGKSVPGVLYKEGTIRKVSIKGTLSPDIATPNPHSSDGKCSRQGNVRLRVRSQLG
FT                   RVEEL"
FT   CDS_pept        join(complement(448014..448230),complement(447592..447963),
FT                   complement(447432..447541),complement(447251..447373))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201554" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823030"
FT                   /orf_name="Pc18g01910"
FT                   /product="Pc18g01910 protein"
FT                   /protein_id="CAP94415.1"
FT                   /db_xref="UniParc:UPI0001831460"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCL2"
FT                   /transl_table=1
FT                   /translation="MENTVEARKSWRKALKHRLRTRRKTSKEISTIPITDLDSSEIPHH
FT                   FNLTHCLPTEFELSLRETEMVSLPAHLSSILPDYGIATSHSPPNKALIRSRIDVIILTV
FT                   LAKVKREFAAKPLSSIAPASSIASTSHESVHLRVAREMKFVWKSGKQQVRLSGIVDYSL
FT                   WYGKRNDHANMVMVKMVAMDLLKFGVHQCLAYMAIIHETRKQASIPDTSVYGVATDSSE
FT                   WVFIRIRPNGEWVTKSYDWVHSPQEVVSMLAKTLAHAASFHPQTGQKRWCH"
FT   CDS_pept        join(448848..448989,449047..449486,449564..449749)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127325"
FT                   /orf_name="Pc18g01920"
FT                   /product="Pc18g01920 protein"
FT                   /protein_id="CAP94416.1"
FT                   /db_xref="UniParc:UPI0001831461"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCL3"
FT                   /transl_table=1
FT                   /translation="MIEEDCAKIKTTKGHQHVAKAFGLSPTRWWNKRQLNAQNTWSAPD
FT                   HLACLWDDLEIVTAGKGSKHPLFSVRIESLFLALLADNIKKESLGPNGPQELPHWSFRK
FT                   RILTREMKDDKIPAPEDIIDYVLWYGHCLELETNMIVMKSERPVPRSWTLLQNMSGIHH
FT                   ARKLAERDAVIYGVITDGSKWVFIHLTNQSRYTIKVFAWDNERDQIIGQVQNIIDRAVA
FT                   LYRKIMSRSSLPKPTVHQISRCRIRELPASCAG"
FT   CDS_pept        complement(450483..451532)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294678" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942338"
FT                   /orf_name="Pc18g01930"
FT                   /product="Pc18g01930 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94417.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831462"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCL4"
FT                   /transl_table=1
FT                   /translation="MQAIRVHPAPPSATPYSPTNPAPTTALHNDQIPIPTPTAPNQLLI
FT                   HIKATTIIRDMLTWPETYDQPYAIPGHDFSGTVASVSPGSTTTFKPGTAVFGMTSADRG
FT                   STWASYALVTTDEVAPKPADLGWEEAAALPLSAQTAYEALFVHAGLPPPVLGGRAQMEI
FT                   QHRQEQDYQHARQLKQRVLVTGAAGGVGIFLVQLAACAGMHVVAASGSVVRNGEFLTDL
FT                   GADEVVEYADLEGQGGRFDVVVDSVGGEVLERCWGFVKEGGVLVSVDSASFDFVEAHAK
FT                   RGLRRDGIKALFFVVEGSGEILRALSELAARGELRSFVAASFGIDRVQEAYEYASGRFE
FT                   GRGKIVLTV"
FT   CDS_pept        join(complement(454556..454612),complement(454259..454496),
FT                   complement(451897..454199))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000031215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942339"
FT                   /orf_name="Pc18g01940"
FT                   /product="Pc18g01940 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP94418.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="UniParc:UPI0001831463"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCL5"
FT                   /transl_table=1
FT                   /translation="MKFAWFEVAALTASVANANSLAYSPPYYPSPWMTGEGDWSEAYTR
FT                   AVEFVSNLTLAEKVNLTTGSGWMQESCVGETGGIPRLGMWGMCMQDAPLGIRFSDYNSA
FT                   FPAGVNVAAAWDKRLAYQRGVAMGEEHRDKGVDVQLGPVAGPLGKFPDGGRNWEGFSPD
FT                   PVLTGVMMAETIKGMQDAGVIACAKHFIGNEQEHFRQSGEAQGYGYNISQSLSSNIDDK
FT                   TMHELYLWPFVDSIRAGVGSVMCSYNQINNSYGCANSYSLNKLLKGELGFQGFVMSDWG
FT                   AHHSGVESALAGLDMSMPGDVILGSPYSYWGTNLTISVLNGTMPEWRVDDMAVRIMSAY
FT                   YKVGRDRFRTPPNFSSWTRDEYNFQHSMVSEDWGKVNERVNVQRDHAQIIRKIGSDSTV
FT                   LLKNKGGALPLTHNEKFISILGEDAGSNAHGANGCDDRGCDNGTLAMGWGSGTANYPYL
FT                   ITPEQAIQNEALEYSNGQTNVFAVTDNWALTQMAALASQADVALVFVNADSGEGFINVD
FT                   GNEGDRKNLTLWKNGEEVIKTASQHCNNTIVVIHSTSAVLISDWYDNDNITAIIWAGLP
FT                   GQESGHSLVDVLYGRINPGGKTPFTWGKTRKDYGPPLVTVPNNGADAPQDNFEDGVFID
FT                   YRRFDKDNIEPIYEFGYGLSYTKFAFSDIKVTPLASSQRGEYKATTGKSQKAPVLGEPS
FT                   TVSDNLFPEGIKRVRQYLYPWLNSTDLRASSGDPDYGMDSKDYLPEGATDGSPQDLLPS
FT                   SGSSGGNPGLFEDLYQVTATITNTGSVTGDEVPQLYLSLGGNDDPTKVLRQFDRVTIAP
FT                   GQSLQWTTTLTRRDVSNWDVASQNWVISGAQKKVYVGNSSRKLPLSADLPSVE"
FT   mat_peptide     join(complement(454556..454558),complement(454259..454496),
FT                   complement(451900..454199))
FT                   /db_xref="UniProtKB/TrEMBL:B6HCL5 "
FT   sig_peptide     complement(454559..454612)
FT                   /db_xref="UniProtKB/TrEMBL:B6HCL5 "
FT   CDS_pept        join(455109..455225,455309..455365,455603..455773)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127326"
FT                   /orf_name="Pc18g01950"
FT                   /product="Putative uncharacterized protein Pc18g01950 "
FT                   /protein_id="CAP94419.1"
FT                   /db_xref="UniParc:UPI0001831464"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCP0"
FT                   /transl_table=1
FT                   /translation="MHRLASISYTRTAKRRHLASRLPYHRARAFSPLILILRGYNYTHW
FT                   HRLSQSCGKGSHQALLSRITALSIYTKVGSQRHPQLSVFATVETGVRDPRTPDSGMPTP
FT                   VSKISDGLRD"
FT   CDS_pept        join(complement(457970..457993),complement(457021..457914))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210454" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976245"
FT                   /orf_name="Pc18g01960"
FT                   /product="Pc18g01960 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAP94420.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniParc:UPI0001831546"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCP1"
FT                   /transl_table=1
FT                   /translation="MDSTKDQKKNAERLARVRENQRKSRARKQEYVNELEQRLAVYKEQ
FT                   AHQKDIEHRLATQKVEAENRHLRALLGSLGVSSASVQQYLQEADTGANINRKVAIPAIQ
FT                   RVEGENPMSLSRRDARRSNLSMAIPRVYKEEPETTELPAAVSSACSSTVAQPTDQPEAV
FT                   RSACTSTVVQPTDQPELARGACAPTMVQSTEQREAVRSACAPAVVQPTDQPPKQTPQEV
FT                   DPDLCGCGTDRENSDMVSDEDVLNSTLCAIAEEMINQYNTKGVDVDEIRRRIWSGFRAG
FT                   ANGTGCRVQNHILFQVLDDISSDV"
FT   CDS_pept        join(458653..459193,459255..459336,459388..459502)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210465" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942340"
FT                   /orf_name="Pc18g01970"
FT                   /product="Pc18g01970 protein"
FT                   /function="cholestenol delta-isomerase activity "
FT                   /biological_process="sterol metabolic process"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94421.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016125"
FT                   /db_xref="GO:0047750"
FT                   /db_xref="InterPro:IPR007905"
FT                   /db_xref="UniParc:UPI0001831547"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCP2"
FT                   /transl_table=1
FT                   /translation="MVSTRHHPREFPSPEAVKELAKLPPATTSANSRKWTHTPAAALTI
FT                   WLVFSVPLVIWDTGYVLLRPHSMPGGRLHSPIWTPYALYGKVDYIYGWPAFNAHNGFTA
FT                   AQTMLNILETIGYIYYLWIVYHHGSTIGRGGGSRKISKGFTWLLKGDKVVAGRIGATAL
FT                   LVAYTASVMTLSKTILYWLNEFFSGFENIGHNEPLALFFYWILPNGLWLVFPSYNIYVL
FT                   GDEILSSLELATPRQKVGRPKST"
FT   CDS_pept        460192..463305
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976246"
FT                   /orf_name="Pc18g01980"
FT                   /product="Pc18g01980 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94422.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831548"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCP3"
FT                   /transl_table=1
FT                   /translation="MAELFAKPPFAAEPFPIFGATSLSPQFRLSFRFSRSSNSKFHSKF
FT                   TSPGRTRAPSRKHLLLFPTVPKDASGLGPGVSAPVMIQRDSDKSPSKTPGVTFDLGQEE
FT                   AAAALEDFDTQSHASSRDPGSTQAVDPALGPDNGTLDQRDDTGNGPSNFEHINDEDKPA
FT                   WSEMKTKAGKERKRLPLACIACRRKKIRCSGEKPACKHCTRSRIPCVYKVTTRKAAPRT
FT                   DYMAMLDKRLKRMEDRVIKTIPKEETRDMLSIGRSVVKPSASVQPSKAQKKRNAEEAFA
FT                   AEMDEWTRGNSRPPHETFPMNREGKSTDGTGLLTEGAEFLPSLEIQEHLAEVFFDCVYG
FT                   QSYLLLHKPSFMRRLKAGTIPPVLILAVCAVSARFSTHPQLNSDPPFLRGENWANPAAA
FT                   IALSRHDEPNITILTVFLLLGLHEFGTCHGGRSWSFGGQALRMAYALQLHQELDQDSLL
FT                   SQQNGNGSQLSFTDQEIRRRTMWACYLMDRYNSSGSQRPPIGNERFLQIQLPIKEPHFQ
FT                   MEIPGPTEDLDGDIPNPVPEDSGQLSNAKENMGVSAYIIRAIVIWGRIVDYLNLGGKRK
FT                   DSHPLWHPESGYMQLKRQIEEFSASLPGPFTFTYENLQIHAAEKIANQFIFLHIIIHQN
FT                   MLFLNQFAIPLSPGGRPPRDMPKAFLSNAGRAAVEAAHHISVLFDRASAYPLTVPFAGY
FT                   CAYSASTVHIWGIFSKNVQLEARSKENLRHTYRYLNKMKKYWGMFHYMVESAKDRYRQF
FT                   ADAAIKGSMAIQNGASLTPMFQYGDWFDKYPHGVSRVHWEDPDTRHKETGEDAVMGQKP
FT                   DLQSVEDFFAGLSPTPQPSQPRKSRSRKNSKLSDGASGMDQTSSPSMMEVPMGNTPGVP
FT                   GSAFPQPSMFQQSRPMSFGQPPFDFSIPPDQLPQLDRQFVYGSFSEFDPTSFVPNNPPI
FT                   PPLNGVETQNPDQSLFTGHLDPSAPAGMGEFYQPSAWFLPFNLDPVGGGNPPSQAPPSA
FT                   PIPGGNNRGSTPSGLPSVDISGFGGAGGMPLSAYDLGLTGSNTKASRP"
FT   CDS_pept        join(complement(465499..465869),complement(465115..465414),
FT                   complement(464923..465049),complement(464173..464379))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210487" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942341"
FT                   /orf_name="Pc18g01990"
FT                   /product="Pc18g01990 protein"
FT                   /protein_id="CAP94423.1"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="UniParc:UPI0001831549"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCP4"
FT                   /transl_table=1
FT                   /translation="MKLTSSAHYSIFLLSSILGLSSASYPSHLVDDAPCVARSPTTGLY
FT                   FDLNAISLSPPEMKDGHKLSKDARDNSWYAKGHDYPANFTINICAPVIENVTDVVGIES
FT                   SRWKNVSAYYERDNKRYSIGQQASEPFFRGRKLVLNYTNGSPCPDAYDMGSSNVSTRTK
FT                   STIMSFLCDRDAAPNVATPSFVGSMDECSYFFEVRSSAACGGIAVDPNAGGLGPGGVFG
FT                   VIMVIAIAVYLIGGCAYQRTVMHQRGWRQCPNFSLWAGVFDFVKDMFVIIFSSLVNLFN
FT                   CKRSPAGSGYTRADSNGRGGFIGAIGGRGARGQGRDVDAENRLIDQLDEEWDD"
FT   mat_peptide     join(complement(465499..465800),complement(465115..465414),
FT                   complement(464923..465049),complement(464176..464379))
FT                   /db_xref="UniProtKB/TrEMBL:B6HCP4 "
FT   sig_peptide     complement(465801..465869)
FT                   /db_xref="UniProtKB/TrEMBL:B6HCP4 "
FT   CDS_pept        join(466250..466323,466372..466676,466754..467862)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000193296" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670277"
FT                   /orf_name="Pc18g02000"
FT                   /product="Pc18g02000 protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP94424.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001171"
FT                   /db_xref="InterPro:IPR018083"
FT                   /db_xref="UniParc:UPI000183154A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCP5"
FT                   /transl_table=1
FT                   /translation="MAEKHSKKIPVQPVPEKRGYEFGGPLGAFGIVFGLPILIYVFTFV
FT                   CNDISGCPAPSLLNPSTLSLEQLKREAGWPDQGVTALYDTNVTLWTLSYYAFSLFLQVF
FT                   LPGQEADGVVLACGGRLKYKFNAFPSAIIILSGLAGGTYLYGADFVVWTFLWDNYVQVI
FT                   TANILISSFIALFVYTKSFTVPAPGQATPSLRQLAPGGHTGNMLYDFFIGRELNPRVCL
FT                   PIPFVSEASRTIDIKVFMEMRPGLLGWTILNLSNVAHQYRTYGYITDSIVLVTVFQAFY
FT                   ILDALYMEPAIMTTMDVIMDGFGFMLSFGDVVWVPHVYSIQTRYLSVFPYELGLSGMAV
FT                   VLGITAVGYLIFRGANNQKNRFRTDPNDPRVKNIKYIETAAGSKLMISGWWGLARHINY
FT                   LGDWTMSWAYCLPTGVAGYVLIESINPASGIVQKQAVQTPEVRGWGMIFTYFYMLYFGI
FT                   LLIHREMRDEEKCEKKYGADWKRYTSIVRSRIIPGIY"
FT   CDS_pept        join(complement(468896..469352),complement(468325..468839))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235010" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942342"
FT                   /orf_name="Pc18g02010"
FT                   /product="Pc18g02010 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP94425.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI000183154B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCP6"
FT                   /transl_table=1
FT                   /translation="MALKSPAECANCGTGTKTMCSRCPHAPEYQSGDSRVVFYCSRECQ
FT                   VMDWPNHKVYCKNMQQRKILLRAAQVLKAAMLAYREIVYDVDLTKIECRDGVLYLHQKQ
FT                   RPVSSQSKRGPFPNHMTDNIEHKEAALVKSQSTAAMALLGPLTRRLLRGVPLKIESMVV
FT                   NIGRPRVPTRLVPGPDLHGGPHTVLKIGTESNETWIIDTTGCQYGFRDVFIPLGKYFLD
FT                   NKCRILNGPRIYDAYEMNDLDYLSTLHVFNKTKAQRQDMRLERLTRHHFAVFVSLSVHD
FT                   NFLVESDADYKRKIGHFVNELKTHMVDSIRKAGDDFEDSEDD"
FT   CDS_pept        join(complement(471541..471694),complement(471336..471378),
FT                   complement(469843..471274))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210498" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942343"
FT                   /orf_name="Pc18g02020"
FT                   /product="Pc18g02020 protein"
FT                   /function="RNA binding"
FT                   /function="adenosine deaminase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAP94426.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004000"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR002466"
FT                   /db_xref="UniParc:UPI000183154C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCP7"
FT                   /transl_table=1
FT                   /translation="MSGDTSSFPLSSRIASLVHAHFDALPTRSKPTIFPDGSREWIPMT
FT                   GIVAVKGENTPSESLTCISVTSGAKCLSASHIPRCRGLVLHDCHAEILAIRAFNYWLLT
FT                   ECNSVLSREKQLPNGHDPSASDNQKVSDSPFIQRRKIGEVQDSNGTPPTEWPPFELRPD
FT                   IKIYMYCTCAPCGDASMELCMAAQEDATPWEVIQEEGPSPKPQDADDPGTETLLDGRAH
FT                   FSLLGVVRRKPARMDAESTRSKSCSDKLALRQVSSLLSCNTSRLVAPSGNAYLAGLVLP
FT                   EDEISQVGCDRSFGENGRMQALRGRYWPKEAKSESTLGYRFRPFQVLSVPSEEVAALWP
FT                   FAKPKSVPCPAISSGQEGDPSVSGVKSRKSRPGNVSAVWILAPSYHYPSAVTMDTGSKT
FT                   VPTLCRSKTGLYETIINGVKQGNRASSPGARGASSLSRAKLWALFREIAPALVPHACQA
FT                   NVSPAGSLLHASETGDPHVDIVQQRVPDITTYQDFKNPTRLGDPLQIRMQAIRDAKLVL
FT                   KGWTPNAGDESWGLDVLVDPKKRKR"
FT   CDS_pept        join(471901..472143,472184..472192)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210519" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942344"
FT                   /orf_name="Pc18g02030"
FT                   /product="Pc18g02030 protein"
FT                   /protein_id="CAP94427.1"
FT                   /db_xref="InterPro:IPR009846"
FT                   /db_xref="InterPro:IPR017089"
FT                   /db_xref="UniParc:UPI000183154D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCP8"
FT                   /transl_table=1
FT                   /translation="MADKLRTIQNLEALQARYIGTGHADTTKYEWTSNILRDSYSSYVG
FT                   HPPLLSYMAVGMGEPKEKVRTMMLEKMVRGAGNPPETG"
FT   CDS_pept        complement(472952..475120)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210520" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942345"
FT                   /orf_name="Pc18g02040"
FT                   /product="Pc18g02040 protein"
FT                   /protein_id="CAP94428.1"
FT                   /db_xref="UniParc:UPI000183154E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCP9"
FT                   /transl_table=1
FT                   /translation="MTSLHEALQCLKPTSWDEVPHDPDELRDYVREIFKKSRLIAESLP
FT                   DPPISDNDDYPELDDTTNSSARRIVPSSARVGETDPEIADLQKEWGKPLKMGGPKDNPL
FT                   DVTVWKLSANDGGGSWFGRRSVHEGLPFLRWRKKLSTEYDETLKVNRRKIEEGQTPDKS
FT                   IRGIGAEEKIETIEVKDHDGSVLGDLMVYHVSAQFPKPTAPRDFVELIINSDSGLQTGG
FT                   TKQPGRSWIMISKPCEHPDIRHRQGYTRGQYESVEVIREIPKKDGNWASSSTQGSKRNN
FT                   DSPSSNLQRHEGLPERDEAGDDEDEEMNPVEWIMVTRSDPGGNIPRWMVDKGTPRSVGT
FT                   DAAKFVNWALQDDKPPKQESAVTESANNLAGAKAKFGESTNEYDSDQADDSDTDYESLD
FT                   SDGEHSHHGLIASVTGLLNTGLERFAPQVLGYGAHTKVSSDLPAGDEVSYIDADGIAHL
FT                   SPESVQQNKTALDAELSRSREQDHASISSANSEQETAIDEAAHNNMSTEELNQMTKNGK
FT                   LTSHEKELAKLAIRKREVESKLEEVRAELDKFQIPSQPPSVPGTPVKGITEADSDTNGM
FT                   RKRAATNRSSGSANTRTQQSQSQPQGEINNEDQSSPAQTATPDPPSYLPKAASQFLNGE
FT                   SKLLKQLRKIEASQLKVTSKIQARKRKDEERSKKSKSKNKSEVDGLKQEVHDLKKEVKQ
FT                   LRSERQKWVDLVTSLQAENTRLAAKSNA"
FT   CDS_pept        complement(477040..478110)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210531" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942346"
FT                   /orf_name="Pc18g02050"
FT                   /product="Pc18g02050 protein"
FT                   /protein_id="CAP94429.1"
FT                   /db_xref="UniParc:UPI000183154F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCQ0"
FT                   /transl_table=1
FT                   /translation="MPTVLLPSSAAAFAPRSSPNVVLNTKVEPWLTATLKRVNRVKRPL
FT                   NNVTQHTRCLTETLSSKNAIWTLCSMMFTKVPQAELEKNENQLWEALHNHQMIHMEAYV
FT                   VHVDMVSRNEVAFKLTPETIESLVDFHKEVYSVDAAANTYNWSGKHGELKRLQEEFVQA
FT                   ANKFVYRANAQALEGLEEDGAGELLSGRSEEAKAAIGKLFVPLVAPSPPVMDVMRPMPI
FT                   LPSSTGPENWWQNPVPQQAPLESWKVLSPSPNPATTGDSNPNLWASLSFSDAQLASPTP
FT                   SYSQPFTPSPFQTYDCLPTTCMPTTSAAISPPPLPSTFPSVFPSMLVQPCSTAVNMGMG
FT                   GFSWGEFAPLPYGTIA"
FT   mat_peptide     complement(477043..478053)
FT                   /db_xref="UniProtKB/TrEMBL:B6HCQ0 "
FT   sig_peptide     complement(478054..478110)
FT                   /db_xref="UniProtKB/TrEMBL:B6HCQ0 "
FT   CDS_pept        join(complement(480092..480132),complement(479631..479964))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942347"
FT                   /orf_name="Pc18g02060"
FT                   /product="Putative uncharacterized protein Pc18g02060 "
FT                   /protein_id="CAP94430.1"
FT                   /db_xref="UniParc:UPI0001831550"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCQ1"
FT                   /transl_table=1
FT                   /translation="MVYSGSTKESVQQRGGDVTIPTGWQPDNHETRPIELGFSNRLAVD
FT                   LAKICPRFQLSTLANSYVFSNQFYGKKSEVDTVKQELYSVLIRALHNYLHVGPEISATT
FT                   WRVMCTASYLFREKANNGGA"
FT   CDS_pept        complement(481369..481779)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210553" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127327"
FT                   /orf_name="Pc18g02070"
FT                   /product="Pc18g02070 protein"
FT                   /protein_id="CAP94431.1"
FT                   /db_xref="UniParc:UPI0001831551"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCQ2"
FT                   /transl_table=1
FT                   /translation="MVKPEPSPPASSPTAEAAAVPLDSPTRVIPIHPDLAEIKVPDGPL
FT                   PSYRYHPVTCQPIKPRDYQTELKQLEEQYKSREAALHAQEQISKEVKEKIEAAKRKREE
FT                   VQKSMDKKVKERDTEMKVVSKFQETKASDIPS"
FT   CDS_pept        join(482140..482152,482204..482220,482276..482299,
FT                   482355..482767,482824..483406)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210566" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823031"
FT                   /orf_name="Pc18g02080"
FT                   /product="Pc18g02080 protein"
FT                   /protein_id="CAP94432.1"
FT                   /db_xref="InterPro:IPR019448"
FT                   /db_xref="UniParc:UPI0001831552"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCQ3"
FT                   /transl_table=1
FT                   /translation="MQAFVPKNRRPRFELILRIIDINNVPLGNSVAFVRWRLPSSSSTE
FT                   HQGHTEKATLSDHRAYWGYEKCLQVRLTIDRTSILQECELSFEVIQEYTSSPMSEKSVL
FT                   GKIKLNLAEYVDKTEEDDGIIRRYLMHESKVNSTVKIGIAMRQLEGDRNFTTPQLKSAT
FT                   VFGGIAGVVQSTEQPINADEFGQLPSIDTKSREIADMQDMYRRTLVASWSSRAGDLPAD
FT                   KLVEELFAGSSCWNNDAHNANAGISAGDHRDSLLSAETVPRQSRSGKKLSPSFERRPKS
FT                   TSSNRSHSSNKAPDSLAALGHQKKGGSIEQQLYEGVKGRAWKATDTNNELSEFDVREDL
FT                   RSWEVVPKQ"
FT   CDS_pept        483707..485986
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210577" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942348"
FT                   /orf_name="Pc18g02090"
FT                   /product="Pc18g02090 protein"
FT                   /protein_id="CAP94433.1"
FT                   /db_xref="UniParc:UPI0001831553"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCQ4"
FT                   /transl_table=1
FT                   /translation="MLRRPASNKLGLLSFQSLSYRRPLLSYPHAVLSRYQSNWSRDHEA
FT                   FDGPNSERNRKPKDNGKPEAGKFTLDVDTLGKPGEIVVVPSRRSRMLNRNRNRNRDEDP
FT                   ENASGDTISAMLNELDDEKSLPSDKSVKERIDEVRGSYQLGQILPAADLKALWSKLASS
FT                   FTYKQLSDFISEYNRNAAIEEKGWTWRPSSSKSLLGKTRGFRGKPRAAETIVRNCWQLV
FT                   ADGERGRLEFRMPAQFISLLLHAEHFSFHELASLHGCGIEVTQSAGLVSLTGKRNDCES
FT                   VHEIIVDATGRIREGDVGIDPYIHGNGTSQVFTPDFLEWVNSTHGVFVEHKVHRPPQKI
FT                   LYLAENKLGADNARRTLNLALSNTTSPSAPFSTYLPASELASAYSYRPGAHASWFEQQN
FT                   LWFRWAMSSSQNAEAENLETPFFDKHQTRLSDELLKLLRVSTPQTGSVIGLHESVTAVV
FT                   GKCLFMQKPSFDETAISPAQLGRLSLPRAFTNDIPLVSRFIDSLTPIRPKEEAQLYRLR
FT                   LSPTSNAGSPPELEIEVAMNSNLDGVDIHSVKAILTTNSVDYLLPENGLDLRFTRTISQ
FT                   DLLYKPSSNSELSETSSEHLLSDPSSSPQVHEMLQSIKTSLQGPVVSSGASQGPVPPPI
FT                   FCNITLPCDLVHQPASQKVKSKRLDESMAEGCVAVEYMFPPLSDIRGAVVQKYNFDGRA
FT                   LDYRYYESGSHLAARTNEVSLRMEIPQIDSAAENDQSEQRDHEFHSFYNAACGMAFKIH
FT                   GKRYVD"
FT   CDS_pept        join(487347..487841,487890..489578)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210599" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976247"
FT                   /orf_name="Pc18g02100"
FT                   /product="Pc18g02100 protein"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /protein_id="CAP94434.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR017906"
FT                   /db_xref="UniParc:UPI0001831554"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCQ5"
FT                   /transl_table=1
FT                   /translation="MSLQVENVTLARRGEQVDGTLHLTPHHLIFSHIPPISPEDQIKGV
FT                   TTRPRELWFTYPIIAFCTLRPAPAASRQLSSIRLRCRDFTFVCFYFVNEHKARDVFESI
FT                   KQWTCKSSRIDKLYAFSYQPPPPEKEFNGWELYDPRKEWARQGCLEEGKAWRLSEINMN
FT                   YEFSPTYPALIPVPCSISDNTLNYAGRYRSRARIPALTYFHPVNNCTITRSSQPLVGVR
FT                   QNRSIQDEKLMSAIFLTSRSERPLASFSATEKETDSSSPEMSQVMVPELNNAEEIEDDL
FT                   LAATSSDLEDHRSIYGAQQSNLIVDARPTVNAFAMQAVGLGSENMDNYKFATKAYLGID
FT                   NIHVMRDSLNKVIDALKESDVTPLGPNRDQLARSGWLKHIGGILEGAKLITRQVGLTHS
FT                   HVLIHCSDGWDRTSQLSALSQICLDPYFRTLEGFMVLVEKDWLSFGHMFRHRSGHLNSE
FT                   KWFQIENERIGGDPNRAFGDGGGAGKAIENAFLSAKGFFGRDNNSRDSLPESDGELQNY
FT                   DSDTPAKKPATPRSGVSEKEITKPKETSPVFHQFLDATYQLLHQHPTRFEFNERFLRRL
FT                   LYHLYSCQYGTFLFNNEKERVDCKASERTRSVWDYFLARREQFTNHQYDPVIDDNQRGK
FT                   ERLIFPRVNETRWWNEVFGRTDAEMNGPRPSTAPSEIPESTVLTGIETAGPANAGKMTD
FT                   VSGMAAAVTSGVSKLAFPAERTDKQTKLEVEMQ"
FT   CDS_pept        join(489923..490076,490226..490539,490627..490953)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210611" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942349"
FT                   /orf_name="Pc18g02110"
FT                   /product="Pc18g02110 protein"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAP94435.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="UniParc:UPI000183163A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCQ6"
FT                   /transl_table=1
FT                   /translation="MAAVQGAISKRRKFVADGVFYAELNEFFQRELAEEGYSGVEVRVT
FT                   PTVTDIIVRATHTQEVLGEQGRRIRELTSLIQKRFKFPENSVSLYAAKVQNRGLSAVAQ
FT                   CESLRYKLLNGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRAARAKSMKFTDGFMIHS
FT                   GQPAKEFIDSATRHVLLRQGVLGIKVKIMRGSDPEGKAGPQKTLPDSVTIIEPKEEQPV
FT                   LQPMSQDYGAKAIAAQQAAEQQRLAEQQAAEAEGGAETFAQE"
FT   CDS_pept        join(complement(494146..494178),complement(494066..494093),
FT                   complement(493911..494017),complement(493282..493866),
FT                   complement(492655..493235),complement(491801..492602))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210634" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942350"
FT                   /orf_name="Pc18g02120"
FT                   /product="Pc18g02120 protein"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="CAP94436.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="UniParc:UPI000183163B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCQ7"
FT                   /transl_table=1
FT                   /translation="MNSNGGAVYCTLLLSDNYLPGAMVLAHSLRDNGTKARLVALFTPD
FT                   RLQSSTIDELRSVYDELIPVSSMVNDTPANLWLMDRPDLIATFTKIELWRLTQYQRVVY
FT                   IDCDVVALRAPDELLSLEADFAAAPDVGWPDCFNSGMMVLRPNLQDYYALRALAQRGIS
FT                   FDGADQGLLNMHFRDWHRLSFTYNCTPSANYQYIPAYKHFQSTISLIHFIGARKPWNMP
FT                   RQIVPLESPYNQLLGRWWAVYDRHYRLPSVPSAPVEIEETALVQGDQVHTPRHDRAPRY
FT                   DSTIPHETQPTSEQQPYRIEEQASFDDESHKIPPVDHSHPEPHQEHSAPTVVRHAAVPV
FT                   LSMVPQYVRGEEHISTFVSPLPPAPITLALRVSHETYETQIHAQTQMQSPNQTQAQTQI
FT                   HYPDGHIHQPQPLAPVPPVIEYQSPPSPVPEVPTFEAPRSEWDPSRGPPPVNTKPEGIS
FT                   LQQKTYNMSEDTHLFQPPSSYPEAPKNMWYEVPAKPEPKPSTVFPWERHAPKPTRVFAE
FT                   EAPVELVGAPVISDEPEQPSIPSESAPPGPSPSYTRVPFEPSAESWQTYTRSNAWDEDP
FT                   EIQRYIETIQARCTKSQATSPGAHSNSPGKSPPTPGFRPSTKITDFPTEVERPSLPVTP
FT                   APVHRTSYGDEASGTAALPAAEGVPSQEEWVGVTVDVFSSLLNATYLLWRSTESPGSAR
FT                   GAASSALGGLGASRAAV"
FT   CDS_pept        join(complement(496168..496315),complement(495641..496119),
FT                   complement(494791..495594))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210623" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942351"
FT                   /orf_name="Pc18g02130"
FT                   /product="Pc18g02130 protein"
FT                   /protein_id="CAP94437.1"
FT                   /db_xref="UniParc:UPI000183163C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCQ8"
FT                   /transl_table=1
FT                   /translation="MGKSLSRALVGAAVYVYGFLTVVSYGLIAFAKGTYLKRPTEIEKR
FT                   DLQLARARLWDLSKAFEGLSHQVLTLQSGFKFHFVSNDIPNTPEAIKSDKPLVILIHGF
FT                   PDSWAIWRHIIRDPGLQEVVSLVAIDLPGYGGTESLEEYNATNVLEKLTELIVTLRTQY
FT                   GVDSGNESNKKRTIIVAHDWGCVLSMRLAAEAPSLAHRFILSNGPSMKLVESNIRRLLF
FT                   SANKMLGNAWRSPLHARVPLMQALRTLIPLARQLVLSGYIFAMQLPTPIVCYFLSGGHQ
FT                   SFLKKCHLASFNKDEYTPLDIANTMASTMGPSAAESDTKTSSGDTYPASVSERAFAHVM
FT                   HMAGYYRDRAATARWVKSAETVASLHSIASGKRLASTGGGLFDEGPPGTLKASTTIFWG
FT                   KDDIALDQRICLDGMGDYLVHGSHIMLLPRTGHWTPVERESGTALINAAEWAAQGEEGD
FT                   LGTVITESYPGVQVTFSR"
FT   CDS_pept        join(complement(496804..498530),complement(496698..496749))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210612" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942352"
FT                   /orf_name="Pc18g02140"
FT                   /product="Pc18g02140 protein"
FT                   /protein_id="CAP94438.1"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniParc:UPI000183163D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCQ9"
FT                   /transl_table=1
FT                   /translation="MRIQRLIVLLAIGVLACLSLLLLRSSNAPEQHPIDLPPPEPIQHP
FT                   QLHAGQNTYLPEKEHPITRLIGNAQKDFNHAQSRQSKTLAEAVSEYKRRYNMHPPPFFD
FT                   KWFEFAQAKNVQLVDDFDSIYHSLLPFWGVEPKTIRERARETLGFDNAVLGVLIRDGKV
FT                   SLTDGGGDDRKWQRDATAGMMGAFVKYLPDMDLVFNTHDEPRVILPSEDLQRLVQKAKD
FT                   FTIPAAFKRTPTNAWSPRASDLNKGDRIDEVRTTRFNRFAHQPTWTNSRVSCPVDSPAR
FT                   SLDEDPSDDVDPYAYGELGFIYNTTAASDICNTPSLRYTYGFFDRPNAFDVVHDLFPVF
FT                   SQSKISSFQDIIYPSPWYWADKVPYNPAKDYAWEAKSDRMYWRGSTTGGFSRAGGWRRQ
FT                   HRQQFVDNVNGLGTTKVLARQGDSWVSQVTNRDAYRDSFDVKFTLIGQCDPDDCNAQTE
FT                   YFGVFKQAGQQDAWAHKFLVDIDGNAFSGRFHAFLHSNSFVYKIAIFREWHDEWLKPWV
FT                   HYVPLSLKGNEYVESMRYFTSEEEGKKAALQIANQGQRWAQQTLRNEDLEVWFFRLLLE
FT                   YGRLVDDNREQLGFVL"
FT   mat_peptide     join(complement(496804..498446),complement(496701..496749))
FT                   /db_xref="UniProtKB/TrEMBL:B6HCQ9 "
FT   sig_peptide     complement(498447..498530)
FT                   /db_xref="UniProtKB/TrEMBL:B6HCQ9 "
FT   CDS_pept        join(complement(499956..500208),complement(499358..499899))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235086" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823032"
FT                   /orf_name="Pc18g02150"
FT                   /product="Pc18g02150 protein"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94439.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="UniParc:UPI000183163E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCR0"
FT                   /transl_table=1
FT                   /translation="MSWPYHFISLSEDDKLHRREMLDLRGCYAQWSIIVVIVAIRIFRF
FT                   SSKSTTRWNGLVSGKARQYIVCGLWLLWLLSLSIWNSGDDYLHLTKALGRVGLSQLPLQ
FT                   VLMSPAYVSQPAASSVLSLLTGIPQPMLTPYHRLFGRAVVSLLLAHAALYTLFFVQSSH
FT                   PESGILLYKRVRDLDVQCGLVAIFLAVLLVLFVRPASQKGLQAWLVQGTFQERRKMFYF
FT                   GHVSLVVVLCVAVYFHVKQAQQYILQTLAASVLNWLCSWALR"
FT   CDS_pept        join(complement(502916..502978),complement(502760..502865),
FT                   complement(502549..502700),complement(502014..502502),
FT                   complement(501847..501961),complement(501654..501798),
FT                   complement(501505..501605),complement(501100..501437),
FT                   complement(500721..501056))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000078539" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942353"
FT                   /orf_name="Pc18g02160"
FT                   /product="Pc18g02160 protein"
FT                   /function="binding"
FT                   /protein_id="CAP94440.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI000183163F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCR1"
FT                   /transl_table=1
FT                   /translation="MEGQNENDELYPIAVLIDELKHDDVLLRLNAIHRLSTIALALGPD
FT                   RTREELIPFLDDSVEDEDEVLTALSEELGNFTEYVGGPEYGHVLLSPLENLAAIEEPLV
FT                   REKAVESLNKVCEQLSESQVEEYFVPLVLRLSKADWFTSKVSATGLYSTPYKKATPLQQ
FT                   SLRQHFGALVHDETPMVRRQAANNLAKFVKEMQSQVVIDEIIPLFQYLASDDQDSVRLL
FT                   TVDILIAIAEEIPKEQQPSHGVLLTSLRNLFEDQSWRVRYMVADRYEKIAKAVHEEVVT
FT                   RDMVPAFVKLLKDTEAEVRTAIAGQIPGFCHLIDRDTLLNEIMTSVEDLVSDPSQHVRA
FT                   SLGTQISGLAPILGKEETIAHLLPMFLQMLKDEFPDVRLHIISKLEQVNKVIGIQLLSQ
FT                   SLLPAIVQLAEDKQWRVRLAIIEYIPLLASQLGVEFFDEQLSDLCMGWLGDTVFSIREA
FT                   ATENLKKLTEVFGVEWSKASIIPKVMAMGQHPNYLYRMTTCFAVSTLTPVVNLEIIENS
FT                   LLPILERLVTDEIPNIRFNVAKSYAVLIATLRRLPADKTLVEVEKSEESIAPSPQSLEL
FT                   IQSRVVPSLEKLQEDDDVDVRYFATTAGGNPDEMQTSP"
FT   CDS_pept        join(503605..503657,503704..503744,503793..503812,
FT                   503863..503939,503996..504119,504176..505478,5
FT                   05525..505688)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000105095" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942354"
FT                   /orf_name="Pc18g02170"
FT                   /product="Pc18g02170 protein"
FT                   /function="ATP binding"
FT                   /function="RNA binding"
FT                   /function="magnesium ion binding"
FT                   /function="phenylalanine-tRNA ligase activity"
FT                   /biological_process="phenylalanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP94441.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004826"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006432"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniParc:UPI0001831640"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCR2"
FT                   /transl_table=1
FT                   /translation="MPTISVDKAALFQELGREYTTEEFDELCFEFGIELDEDTTNSDRP
FT                   IVDGKQEPPQLKIEIPANRYDLLCFEGIALMLNIFLGRNPLPEYKLTQPARMEQIIVKE
FT                   DTTKIRPYVAGAILRNIKFDQARYASFIALQDKLHQNLARQRTLVSIGTHDLDTVKGPF
FT                   TYEALPPKDIKFTPLNQTQEMDGEELMNFYEKHQQLGKYLHIIRDSPVYPVIYDSNRTV
FT                   CSLPPIINGDRSKISLDTTNVLIEITALDKTKLDIVSKMMVTMFSQYTLEPFTIEPVEI
FT                   VSEHNNETRVTPDIAPRTAEAEVSYINQCCGLSLSPAEICTLLKKMAFRAKPSTTSPDI
FT                   INVEIPPTRADVLHQCDIMEDVAIAYGFNSLPRAFPNISGTVAQPLPINKLSDIVRVET
FT                   AMAGWSEVLPLILCSHDENFGWLNRKDDGNTAVKLANPKTLEFQVVRTSLLPGLLKTIR
FT                   ENKHHSVPMKIFEVSDVAFKDLSLERKSRNERHFAAAFYGKTSGFEVVHGLLDRVMAML
FT                   KTDFLAEGETPKGDSYYIKELDDPTYFPGHAASIHVRIGGKDKVIGSFGILHPTVLEKY
FT                   ELKYPVSSLELNVEAFM"
FT   CDS_pept        join(complement(506499..506747),complement(506380..506451),
FT                   complement(506136..506331),complement(505958..506088))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823033"
FT                   /orf_name="Pc18g02180"
FT                   /product="Pc18g02180 protein"
FT                   /function="cysteine dioxygenase activity"
FT                   /function="iron ion binding"
FT                   /biological_process="L-cysteine metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94442.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0017172"
FT                   /db_xref="GO:0046439"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR010300"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI0001831641"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCR3"
FT                   /transl_table=1
FT                   /translation="MPFLNGSESTTEKPAFEKLVEDLSSVLGPSSGLDSSDVDPMEIQL
FT                   LMEKYISNSDEWAPYALGDASRTYTRNLIDEGNGKSNLLILVWSPGKGSTIHDHANAHC
FT                   VMKILKGKLQEDLYSWPDQEQIKNGQSSPPQLTKQTTYGENQVTYMSDKLGLHRISNPD
FT                   QDNFAISLHLYTPPNAAIHGFSIYDERTGKARHIKQTNYYSFRGQRLDDGQK"
FT   CDS_pept        join(507239..507259,507323..507386,507439..507513,
FT                   507564..507600,507647..507717,507764..508101,
FT                   508151..508507,508555..508728)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942355"
FT                   /orf_name="Pc18g02190"
FT                   /product="Pc18g02190 protein"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP94443.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniParc:UPI0001831642"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCR4"
FT                   /transl_table=1
FT                   /translation="MSTTIEKIKEIESEMARTQKNKNTSYHLGQLKAKLAKLKRELLTP
FT                   TGGGGGGGSGFDVARTGVASVGFIGFPSVGKSTLMNKLTGQHSEAAAYEFTTLTTVPGQ
FT                   VMYNGAKIQILDLPGIIEGAKDGKGRGRQVIAVAKTCNLIFIVLDVNKPLVDKRVIENE
FT                   LEGFGIRINKKPPNIVFKKKDKGGIAITATQPLTHIDHDEIKAVMGEYKISSADISIRC
FT                   DATIDDLIDVLEARSRSYIPVIYALNKIDAISIQELDLLYRIPDACPISSEHGWNIDEL
FT                   LEMMWKKLKLRRIYTKPKGRAPDYTAPVVLRSYACTVENFCDSIHRTIKDDFKHAIVYG
FT                   RSVKHQPQRVGLSHELADEDIGNYTNRKTNMNFEADQL"
FT   CDS_pept        join(513752..514181,514235..514256,514312..515452)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217088" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127328"
FT                   /orf_name="Pc18g02200"
FT                   /product="Pc18g02200 protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="chromosome, centromeric region "
FT                   /protein_id="CAP94444.1"
FT                   /db_xref="GO:0000775"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR004906"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR006695"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI0001831643"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCR5"
FT                   /transl_table=1
FT                   /translation="METEPHSGPEGEFPHSPWVEIGTFTSPQHSPPMPEYSGFDYGPSQ
FT                   LMAVDSYGMSIPPPYASMPLPMPSHSWPSMLTTHSPFAASGLPVCTTPTSVSPSAPMPP
FT                   VRKTSTGGSTPRRTLTDDDRRQMCIYHEENKTAKQTDIGALFGVERSTVSKVLRQKEKY
FT                   LNPEDGSRSPIKRPKGRVPDIEKALSNWARNYQRQGYPLSDEMIKEKALFFATTCGCPE
FT                   GKEKVCTAAWLEKFKHKNNLLGAKVRRGSTEIRSGSNSPTQLNTDFGSALQSPTGPSPT
FT                   SPIDGFGSPLSPTSQEGIKRDMAELPDLTGGYQHGYSKSTTSLDTSSAGMVSPTSTLVS
FT                   DSPFTPTSQSRLPAANSNNRPRSQTFPSVPIDPTLLSADEVTGPHPQKRELQESLSVSI
FT                   LQSPLEMDDPKPATCPVHQTNVIKRNRSNPEITTKSMPPPSKSTTISPISSPGSPTQDE
FT                   ARRALELVINYFDHQPSGLAAQEYMTIGKLMERLELAKSQAGFLLGGLPRIDEHEDVPI
FT                   PRMTKKRSIHNLG"
FT   CDS_pept        join(complement(519320..519830),complement(518428..519229),
FT                   complement(517653..518138),complement(517124..517411),
FT                   complement(516354..516979))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670278"
FT                   /orf_name="Pc18g02210"
FT                   /product="Pc18g02210 protein"
FT                   /function="DNA binding"
FT                   /biological_process="DNA integration"
FT                   /protein_id="CAP94445.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0001831644"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCR6"
FT                   /transl_table=1
FT                   /translation="ITRYYSPGGYRKLFSIXKLLEEXDISYNTRTRYLIDSKGDIIGYV
FT                   DTSSSVLYLVSPKDKDLNEVLSNSDSNLDKEDIDIVNKVIAYEVYRRLGYTGKARIAST
FT                   LXYIEXLGDDKXYSIEYFNYNAYFRGKSKXKISREPXARVXDVVXKFYINTXPIKPIGL
FT                   NRENYXLLVINNTTRLIEGIILKNKSDTFYKLTTFYKKIKLITSRYPRIXRIDSGTKFK
FT                   EFIKXGEAKGITFEIIPPYIVELNGTIERFGGYINNIXRTIIINTGILEDIXLYVTETT
FT                   IYIYNRLVNLKTKISPLTHXREELEIENPEPSLKHLRPXGSTAYVYIPKVKRVXVRKAA
FT                   PRAXKGKLVGYEGDGGYIYKVWDPTTKKVMTSYDIGFLXPRDKDDIGLMLVQPYPDPKG
FT                   LTDDSDNTVGFMLISLINDKEDSIPKK"
FT   CDS_pept        join(520083..520140,520189..520196,520245..520449,
FT                   520498..520814,520869..521414)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000218839" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942356"
FT                   /orf_name="Pc18g02220"
FT                   /product="Pc18g02220 protein"
FT                   /protein_id="CAP94446.1"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="UniParc:UPI0001831645"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCU6"
FT                   /transl_table=1
FT                   /translation="MLDPATQYSPTPLWLDCDPGHDDAFAILIAAHHPSLELLGISTIH
FT                   GNASLEKTTANAGSVLEAIGKPDIPVYPGSNKPFSRPALHAPNIHGESGLDGTDLLPKA
FT                   TRAPITDKNAILAMRDALLAQPKGTPWVVATGTLTNIALLFATFPEVAEHIQGLSIMGG
FT                   AIGEGFTDAPMSRLPGEKTRIGNVTPWAEFNFYCDPESAESIFSNPVLASKTTIMALDL
FT                   THQVLASQAVQTRILHGSIHSAEGPTILRQILHALLNFFAATYENAFGLTTGPPLHDPL
FT                   AVAVVLSTLNPAFASKHPNQALAFDDKGGERFALSIVTDGQHGKDVSKTGQLGRSIATP
FT                   VDGPGVAVPRGVDLDAFWNMVLQCVQIADGCNAARMV"
FT   CDS_pept        join(522284..522301,522357..523863,523926..524116)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127329"
FT                   /orf_name="Pc18g02230"
FT                   /product="Pc18g02230 protein"
FT                   /protein_id="CAP94447.1"
FT                   /db_xref="InterPro:IPR018618"
FT                   /db_xref="UniParc:UPI0001831646"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCU7"
FT                   /transl_table=1
FT                   /translation="MPPPNSHSTPLSSTTATPDPPRRSSIPTPAPVETDNAHDDNVNFL
FT                   RSRPALFNPLLPSLSRQRRRRYPTNPPQNEDRMEVDDPANPRTSVELNRRIPIVRRQER
FT                   STDMPNYEGRVPNSRSLYGWAPGSDDEDGAVREESEDDQMEPFLHSTSSRDTPPARPPR
FT                   NEVPGPAQLIPHEYATLPGSSQARPSISAVAALLQSARRQPRLSRSRTLENYIIDRYSD
FT                   ATPDEDAENTIGVASRGYRYRPAARGDSHHTNLTHNDLRARAAAHRQLHSDTCLSNVLG
FT                   ETIHYLDRIRYSNSLEDSMLVLADSRLSFSMDTKSWRDTDFILYTPNIAPPPACSWLRS
FT                   GMAFSGCQRAASAGCSVLSQRIPSPNAPSEPVIVNGSDSTRISVSTTSGRRYLANNRDE
FT                   NWPVKVTIHQINHDDMTLSGTMEAYNIPDKTSPTHDAHIVTFLEGEIIDFNNHTLETKN
FT                   FKADADIDSTYWRELQPFKDLTDAEMARNLVSRKWIAEELSKGWILMRWKERCFITPTD
FT                   ARQGLTISGFYYISLRREDGHIEGLYYDPGSSPYQQLSLNPEVSKMVRPSYGFR"
FT   CDS_pept        join(525896..526019,526077..526171)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976248"
FT                   /orf_name="Pc18g02240"
FT                   /product="Pc18g02240 protein"
FT                   /protein_id="CAP94448.1"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831647"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCU8"
FT                   /transl_table=1
FT                   /translation="MQIAKSYCRGISLSMPMLIAARFLTGIGVSGLVDVISSLLNDLVS
FT                   PSEVAVLRSYLSVASTLGISSGDPIGP"
FT   CDS_pept        join(526995..527113,527164..527194,527243..527380,
FT                   527435..527485,527553..527805,527860..528872)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000174927" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942357"
FT                   /orf_name="Pc18g02250"
FT                   /product="Pc18g02250 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94449.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI0001831723"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCU9"
FT                   /transl_table=1
FT                   /translation="MHLHHLSLLAAIAGTTLPVIGAPHQARTEGTCKKTKVAILGGGVA
FT                   GITAAQALTNASVHDFVILEYRDTIGGRAWHKPFGKDKDGKPYNIEMGANWVQGIGSEG
FT                   GPQNPIWLLAQKYGLKTEFSNYDNVSTYNKDGYFDYSHLIDAYDEAYEIANAKAGEILT
FT                   QNLQDQNAKSGLALAGWTPKVHDMEAQAVDWWSWDFEAAYSPIESSFVFGCAGDNLTFN
FT                   YFSDHDNLVIDQRGLNFIIKRIASTFLRDNDPRLHLNTEVTNITYSDHGVRVHNKDGSC
FT                   VEADYAITTFSLGVLQRGAVNFSPELPDWKLEAIQKFNMGTYTKIFFQFNETFWPSETQ
FT                   YHLYADPVTRGWYPIWQSLSTPGFLPDSNIIFVTVTNEFAYRVERQSDEQTKKEAMDVL
FT                   RKMFPDKDIPEPTAFMYPRWTSEPWAYGSYSNWPPATSLEMHQNLRANAGRLWFAGEAT
FT                   SPTFFGFLHGAYFEGLDAGRQIAAIMQHRCINADSAKLRECGPRKHYETLHGTSPYSDY
FT                   TMLNGWAVDSSIDNNPE"
FT   sig_peptide     526995..527057
FT                   /db_xref="UniProtKB/TrEMBL:B6HCU9 "
FT   mat_peptide     join(527058..527113,527164..527194,527243..527380,
FT                   527435..527485,527553..527805,527860..528869)
FT                   /db_xref="UniProtKB/TrEMBL:B6HCU9 "
FT   CDS_pept        join(complement(529806..530129),complement(529553..529741),
FT                   complement(529017..529505))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115352" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942358"
FT                   /orf_name="Pc18g02260"
FT                   /product="Pc18g02260 protein"
FT                   /protein_id="CAP94450.1"
FT                   /db_xref="UniParc:UPI0001831724"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV0"
FT                   /transl_table=1
FT                   /translation="MKGFTYLTTAFLAILPALAIPTGSTLQKKADSSKVGYLAVYWTTE
FT                   DNSVYFALSSNDDALGFKSINGGKPIVSPTLGTKAVRDTSIIAGQGKSAGKFYILGTDL
FT                   NIDATNWEASTRTGSRGLFVWESTDLVTWGNERLVTVEDETAGMAWAPDAYWDSSKGQY
FT                   FVHWASQLYSADDTDHTGEPTLNTSMRYSYTSDFKTFTTPETYVSLGDTTVIDMAFLED
FT                   ENTLTRFYVTGGGPVEQTSTNGLFGDWTTAKGTIENSSGYEAPYAFWDNVENGLAYLLC
FT                   DKVGSVTGNHAWQSTDQASGTFTVNDTHDLAFMRHLSILPVTQGQYDALSAL"
FT   mat_peptide     join(complement(529806..530072),complement(529553..529741),
FT                   complement(529020..529505))
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV0 "
FT   sig_peptide     complement(530073..530129)
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV0 "
FT   CDS_pept        join(complement(533030..533154),complement(531972..532958),
FT                   complement(531780..531911),complement(531509..531716))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670279"
FT                   /orf_name="Pc18g02270"
FT                   /product="Pc18g02270 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP94451.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831725"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV1"
FT                   /transl_table=1
FT                   /translation="MHEKSIGANNALSAPLSNPASYVDFKGADDPEHPQNWRLSKKLFN
FT                   SILVCSGTLIVSLTSAIFAPGIDKASQEFRVGTVVGTLGTTLYVLGFASGPVIWAPASE
FT                   LRGRKWPLTIGMLGGGIFTIASAVARNIQTSVICRFFAGMFGASQLTVVPGVLADLYSN
FT                   TTRGAAISLYALTVFVGPFMAPFVGGFIASSYLGWRWTLYIPAIFSLANGLVSVLFLDE
FT                   TYSPCILVAKAVAIRKKSQDCNIRARHEDIEVSIPDLVEKYFTRPLKLLFTEPIILVVS
FT                   VYMSFIYGLVYALLEAYPFVFEHTYGMTPAFAGLMFIGLIIGVVLACAFILFGQLAYAK
FT                   KLEENKGTPVPEWRLAPTLLGAPVFTIGLFWFGWTGFTSQIHWAVPAAAGIFIGFGVLC
FT                   IFLPCFNYIVDAYLPIAASAVAANIILRSAVAAGFPLFSRQMFQNMGIQWAGTLLGCLA
FT                   AIMIPIPIIFRAYGPWLRGKSKVFP"
FT   CDS_pept        complement(533464..535128)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942359"
FT                   /orf_name="Pc18g02280"
FT                   /product="Pc18g02280 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94452.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831726"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV2"
FT                   /transl_table=1
FT                   /translation="MPQSESKRKRSRVACEPCRERKRKCDGAEPCSTCTQWGYDCHYGR
FT                   RPRQRHHAPQQPPRGIIPNPTSPQHINPVDTHGLDRRLWANSGAAFVRRMGLNIDPAKA
FT                   PKLSLFGWNIGKRQLSSESQPVYPVLSITDITSLEHMRALAQIYFAKIGPCYGFIDSSQ
FT                   FFERLEARWKPPMVSSLYDSVLGGVAALGCLFSERNMTITELHLIGSALSILDSHILGG
FT                   APPVELLIGWTLRVIYMRMTDLPHSTWIASSKLMHLVEAAGFHLESTDSVFPRSIDTEF
FT                   DPNTQRRLFGVALHLNMWTSYDLGLSRVSFQKNDLPLLPSTIEGDFTHELLELIPLSAS
FT                   LDPGKPKEDEIDLEETLSQILERVHDEPPSAMAQCNLVLCILRRIHTEKLEISAHLSEK
FT                   ALALLKKGLGCSRTMASTCNPWQHMANVPFHIICVLLVMDTRQSLAMLPEAMQTLKFVA
FT                   SIYDTNTMREAWSAALLLVMLHQQRRKDDLAIFNNIMNMEEQERSAGPSAQEFPSAEEY
FT                   SWLGALVADLPGLQRDDLDQFLNSDMIDTSNFLGGSG"
FT   CDS_pept        536505..537557
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000123285" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127330"
FT                   /orf_name="Pc18g02290"
FT                   /product="Pc18g02290 protein"
FT                   /function="nitronate monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94453.1"
FT                   /db_xref="GO:0018580"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001831727"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV3"
FT                   /transl_table=1
FT                   /translation="MAASLLSRYPWVSGPFVVSAPMKVMSSPALAVAVSRAGGLGFIGP
FT                   GAKTQDTSDDLEKASSLMRQEASIIPPLGSTLPVGIGYQLWADDITVAVAAIQKHKPCA
FT                   AWLYAPRQGPKEYDDWSSKIRQASPDTQIWIQIGTLKEAKELLQNRERPDIVVVQGAES
FT                   GGHGRAKDGMGLMALFPEVADAMADSKIPLFAAGGIADGRGVAAAMCLGASGVVLGTRF
FT                   LAASEARISRGYQDEVVRAVDGAASTTRTLLYNQLRGTFGWPEEYSPRTIVNKSFVEQQ
FT                   EGKPFEELQRLHDEAVKTGDKGWGPEGRLATYAGASVGLIHGVKGAEDIVNEIRGDAMG
FT                   IIQRLCPQKV"
FT   sig_peptide     536505..536615
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV3 "
FT   mat_peptide     536616..537554
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV3 "
FT   CDS_pept        join(complement(538848..538925),complement(538693..538796),
FT                   complement(538565..538639),complement(537942..538531),
FT                   complement(537803..537843))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942360"
FT                   /orf_name="Pc18g02300"
FT                   /product="Putative uncharacterized protein Pc18g02300 "
FT                   /protein_id="CAP94454.1"
FT                   /db_xref="UniParc:UPI0001831728"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV4"
FT                   /transl_table=1
FT                   /translation="MSSLVNILGLVPLALAASPIMLVPNQSMIFKENDYAVNAGRKGIP
FT                   IASDGNCMNFENIPDYRMNVGSIYVPCPSEVKQDVMCSMYSAKSSSSSDNSCNNELFTF
FT                   TRPHANLLRRAVGDGVGRHVRSVKCMTVNSPADRQGHIFSSDHVSTKSPSNCPNDSCSS
FT                   ELNCQSSHPDYGMYCSSGSMTCQRTSVAGALCREDGQCVAGHCQSGMCMAAAENLHCKR
FT                   GSECPSGLRCRPNRVRNSSGASSVEMVCMKDEDVRGTQCSAEKPCKEHMSCSLQHETDT
FT                   YFFVEDVEFEGNGI"
FT   mat_peptide     join(complement(538848..538877),complement(538693..538796),
FT                   complement(538565..538639),complement(537942..538531),
FT                   complement(537806..537843))
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV4 "
FT   sig_peptide     complement(538878..538925)
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV4 "
FT   mat_peptide     join(complement(540190..541260),complement(539968..540140),
FT                   complement(539666..539918))
FT   CDS_pept        join(complement(541348..541368),complement(540190..541296),
FT                   complement(539968..540140),complement(539755..539918))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000166635" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942361"
FT                   /orf_name="Pc18g02310"
FT                   /product="Pc18g02310 protein"
FT                   /protein_id="CAP94455.1"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI0001831729"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV5"
FT                   /transl_table=1
FT                   /translation="DVDLLSTYKXAXKSPFXTXXEDTIXKXLDDLVVKGIXSLILKPLK
FT                   AKILPRXWRFTIKTNTRDEVYGFKARXVIYGNFXEKDSRETYAPIVAEYIIKIVFTLIA
FT                   IYGLKWRXVDFTVAYLNALREDIETVYMRXPTGFEYADASSDKNXXVCTLNXALFGLRD
FT                   LAYLXNKEIDSKLRXIGFHPLKDNPYIYMKGKGMNLTIIIIYIDDFIIAALXDEDIXXV
FT                   VDTLRXFYDIKDLGEPKXYLNCVLYRDYTNRTITMSXIVYIXKVLRTTNVSRXKDTPLL
FT                   AIXREDIANTTNVLNDKAFNXYXSIVGILNWLAIKTRPNIRFAITRLXYRLVKLTFSDY
FT                   KVMLYIIKYLYSYIGLAIVLGRTDELRFHAYTNTSYTNWEDSKSTEGSVWYLASSPVMW
FT                   ATKKQIIIANLTTIAKWCALDQLYRDTIWLKKVANSFXLPLCCPKIYTDNINSQLLLSK
FT                   KGGKSANRWLTLRYFFVKDVVAQGHVDIKRVDTKRNAADGFTKALGKEQFETFTNLLGM
FT                   V"
FT   mat_peptide     join(complement(540190..541260),complement(539968..540140),
FT                   complement(539756..539918))
FT   sig_peptide     join(complement(541348..541368),complement(541261..541296))
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV5 "
FT   CDS_pept        join(complement(543718..543833),complement(543070..543663),
FT                   complement(542800..543021),complement(542575..542753),
FT                   complement(541852..542456))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127331"
FT                   /orf_name="Pc18g02320"
FT                   /product="Pc18g02320 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94456.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000183172A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV6"
FT                   /transl_table=1
FT                   /translation="MESAQIPGGTPAPYGSACMNCSRAKCKCIIPETGTGCERCQRLSK
FT                   ECRPAQTVRKRNKPKSSSNTAHLEAKIDWIMSAFENGGAAPSLPPDWQPVNLGQSQRHD
FT                   PRQSASITQTPTSVSSSNAEEGQYPAQFLPSYDRDILGLVYVRPAMAQKYLDQFRTRNL
FT                   QYLPFVYIPSNVTSDQLREKYPFLWVCIMEVITCTNPEKGDSFGRITNHIHQRVMLDIA
FT                   PSMDLLLGIMTFISWSLCRVTYSKRPFLNVYAHILMAVVAELGINKSVPNEYSAMHSFK
FT                   VAIGMKQTPPTARTLEERRAVLGCFLISSSCITSAALAMSRIDAMRWTAHMEESLSVLT
FT                   EAKECPEDELLIALVKIHLVLDRVYQLRRDVSTDMTNKTKGVLLMYLYNAEIVINELSI
FT                   GAAAMPHSPDLHRLDSLYTSLRATKGWLDVWLELEGEEYLQVSCVIFFQFTRAIVNLYK
FT                   LTILEDPAWSKSMVRDTANVLEYLNRNEAIIRKCPEYITFDQSREMNILEKGLRIVQGM
FT                   RMNWEPKLTEMWRPYMPANNGVDSGTIQSDAILSDVMPFGGIDEAWMMDFLGSL"
FT   CDS_pept        join(complement(545254..545256),complement(544687..545005),
FT                   complement(544494..544618))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210688" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670280"
FT                   /orf_name="Pc18g02330"
FT                   /product="Pc18g02330 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP94457.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000530"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="UniParc:UPI000183172B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV7"
FT                   /transl_table=1
FT                   /translation="MSDGEEPTSPVAPAEEVEVSADAGSGQMSVLDALKGVLRVSLIHD
FT                   GLARGLREAAKALDRREAHMCVLNEGCEEEAYKKLVVALCSEHKIPLIKVPDGKMLGEW
FT                   VGLCTLDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ"
FT   CDS_pept        join(complement(550052..550146),complement(546050..549653),
FT                   complement(545786..545998))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670281"
FT                   /orf_name="Pc18g02340"
FT                   /product="Pc18g02340 protein"
FT                   /protein_id="CAP94458.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000183172C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV8"
FT                   /transl_table=1
FT                   /translation="MLSGDFLEANPLDRIWSSRAGMFAAFATSELGKSNIRTSSTIPYR
FT                   SRTPERYCPRFKTLFAGETRGRGSAFAHNCWRCRPRLFCRSRFPPQNDERHFKSSSAIA
FT                   MSDVEAVSLPAALDVGQNRLATVKPDPVDASSPGKARANSYPRVDSDGLTRVHSEGEED
FT                   GPPSPRADSEAETIIQSGRESLSPEKKRKHIKHDPSRHELNGTDGHQRKKPRVFGDTRE
FT                   REREKERSLSPSHRATSPSVVKIEKDDSHMSETEGVANGIDRASEIARAFRKRSLSDSA
FT                   EEQRDRRRANSHTASHPVGELKHTNNTRLSRPPSNTRSLSPSRPSHQRSASGSQFPTKK
FT                   KAPTPVLTGSGRQSSEDRQSTSSSQSGSPLPGAHLRKLGSGVGASASPAKQMGPKKLRD
FT                   KSGRTPLARACADRKHDQVMMRHAERPEDINIPDNAGNTPLQIASLAGEAEIVKFLLDA
FT                   GCEINTKNIDKDTPLIDAVENGNVEVVKLLLDAGANPRTVNAEGDEPYELVPSFVDDDE
FT                   YDEMRKALADAKANLRPGRRSEEHTRPESKEPSSRRTSAVRGSAASPRDSPPMRSPPPV
FT                   GASNRRKGGRSEATRNDLLWTKPTFENLREFAAKGDEAGVVSILNILQKADNASLIAAA
FT                   KGGHHDVLSLLYAMGNADADPNPLRGQKPGYNTPMLAAIGRGNSAVIQLILNQPGFNPT
FT                   RRLFEDRTYFELSRGRQGENWEDEYQILKEAYERFAGSDKGRKDDSPRRARGKEKEEKR
FT                   PPRRGSSSPVARKKNNSPNANRNRDSLKDMDPTKEKRRQKEHDLSRPSDSSKPKSSSSA
FT                   RRDSESSGMAPNEDIRKRRLIAGRRPQERRPSLFSSDSLSGREEAPKPRVDTATDNALS
FT                   LKRIRTDGSPERSRSRGTDGDRLSPESRKKKRRVISEDKSSGATHGAPRQPDDASKPHP
FT                   RRPYDDSTRTAEPQPHKSTETSKKPPTRPTSPRHDPTTRQDPIKKNGDTKRESHEPRVD
FT                   TVEDTMAVAKRMELEAHERRRAQAKKAQEERAANEKRVAEEAERDRLAKEEAERVAQVE
FT                   KAEEEDRKRKEVEQRRAKQAEDDRLKRLEQERARAAKMRRDQEAAEHRRREALPSRLRV
FT                   AANLVGSNNPRAKSHDWLKSFMPLVTALTRQIDPSCGLDVADEKWIPNYLVAPLLATND
FT                   LQLSQYASWEKRRATPTQRVNLWRVTRRMLTHTDDVGFQSSSIAQIMQKDCDTRPKYFE
FT                   MEHVFWIRLSDFTDLVPHIPHLHGLELQFLSMHVDPEPPMAGAGFSTPQLNGHGLGASV
FT                   DTNGTGLNGYGSSRSSTYV"
FT   CDS_pept        join(550508..550606,550687..551562)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210700" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670282"
FT                   /orf_name="Pc18g02350"
FT                   /product="Pc18g02350 protein"
FT                   /function="oxidoreductase activity, acting on the CH-CH
FT                   group of donors"
FT                   /biological_process="lipid metabolic process"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94459.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016627"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="UniParc:UPI000183172D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCV9"
FT                   /transl_table=1
FT                   /translation="MSLISQWVDSTLEATGMDAVDALRAFFLLAAATTISISIPTSLRS
FT                   RFLTYGPRATSGSISTGSAPPRAQDPSTENKGFLDYLATWQVPHSYFTHFYVASVLSSV
FT                   FWVAQLLSRGVVFQAIASRVSEDHQRHSMSLTQLVICCVLLAVQGSRRLWECFVFSKPS
FT                   SSQMWFMHWLLGLAFYLAAGVAIWIEGSGTLLTENLSIAHLQMTNAPSLRTFFLVPLFL
FT                   VASGLQHDSHHYLYSLKKYTLPEHPMFRGIVCPHYGAECVVYLSLALLAAPRGELVNKT
FT                   MLSCLAFVAVNLGLTARNTKQWYAQKFGKDSVQDWWFMIPYVY"
FT   CDS_pept        join(complement(552439..552543),complement(551613..552275))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210721" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127332"
FT                   /orf_name="Pc18g02360"
FT                   /product="Pc18g02360 protein"
FT                   /protein_id="CAP94460.1"
FT                   /db_xref="UniParc:UPI000183172E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCW0"
FT                   /transl_table=1
FT                   /translation="MGFDLEAARITALPEDAFYISDFITEDEEDWLLQKVKSAPLPRWT
FT                   QLSHRRLQTWPSALTKSNSLLESPLPAWLRSPIIEPRFEALRIFNNAPHKGPNHVLVNE
FT                   YQPGQGIMPHEDGAAYYPLVATVSLGAPIVLDLYHKPTQGDREENGAPAEAGRDVAGIP
FT                   DPNRRPQYRILQERRSLLITRGKLYTDLLHGIEETTRDEDLGPYSICNWELLREREPYQ
FT                   SGWYERQTRTSLTYRDVLHVVKMGNTLKFLGGR"
FT   CDS_pept        join(552897..553028,553151..553253,553306..553460)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000275330" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127333"
FT                   /orf_name="Pc18g02370"
FT                   /product="Pc18g02370 protein"
FT                   /function="isomerase activity"
FT                   /protein_id="CAP94461.1"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniParc:UPI000183172F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCW1"
FT                   /transl_table=1
FT                   /translation="MAPKNNAKAAKGKGKDASADDAKGKGGKGGAVKGAQSINVRHILC
FT                   EKHAKKEEALEKLRNGTKFDEVAREFSEDKARQGGSLGWKTKGGLDPAFENVAFELETS
FT                   TTGNPKYAEVKTAFGYHIIMVEGRK"
FT   CDS_pept        join(complement(554778..554935),complement(553646..554711))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000091197" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942362"
FT                   /orf_name="Pc18g02380"
FT                   /product="Pc18g02380 protein"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94462.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI0001831730"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCW2"
FT                   /transl_table=1
FT                   /translation="MPQNTASGNTDTPSTANGNGNVSGKASATLETVAESPGLTQLVIC
FT                   VLGIYAAFLSWGVLQEAITTTSYPVRPATVAEPNPPTERFTYSLVLNTVQSSFAAITGF
FT                   TYLLFSTPSGQKIPSVFPTRRIIFPLLLVAISSSLASPFGYASLEHIDYLTFILAKSCK
FT                   LLPVMVLHLTIFRKRYPLYKYGVVLMVTLGVATFSLHHPGTSKKVAAKGQSGSSGWGIF
FT                   LLSINLLLDGLTNTTQDHVFSSPKLYTRFTGPQMMVAQNVLSTILTSAYLLIMPHLSQS
FT                   GILHNLLPLPIPPSTETELFGAFSFLSRHPEALKHVLGFAACGAIGQLFIFHTLSRFSS
FT                   LLLVTVTVTRKMLTMLLSVFWFGHSLSGGQWLGISLVFGGIGAEAVVQRSEKKAKERSK
FT                   IEAAKKEL"
FT   CDS_pept        555493..556155
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210722" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942363"
FT                   /orf_name="Pc18g02390"
FT                   /product="Pc18g02390 protein"
FT                   /protein_id="CAP94463.1"
FT                   /db_xref="UniParc:UPI0001831731"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCW3"
FT                   /transl_table=1
FT                   /translation="MANTQEATKRPNASAITEHIAEKGYDSPHLATSAQVQHNLEHQHL
FT                   WTSIIGDVIPGQAGNSNTLSKDPRQPPREPIPLLSGYPPHRVYTHPDEQLYMLENGIRE
FT                   DDLKPERMFVVPTTQGQPWSLRHMAAVFDRLPEFKQKAEEHDRSVDATSMQPGAESLDP
FT                   EKAEKLAQYYDKKEKTRVTKEWGTQRCLLAMADKGMGGDGTVAYYVVHEGDVKPRQN"
FT   CDS_pept        join(complement(560463..560846),complement(557904..560403),
FT                   complement(557766..557852),complement(557491..557712),
FT                   complement(556444..557429))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210733" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942364"
FT                   /orf_name="Pc18g02400"
FT                   /product="Pc18g02400 protein"
FT                   /protein_id="CAP94464.1"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI0001831807"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCW4"
FT                   /transl_table=1
FT                   /translation="MAMSISSPVGLKEAALDSPTFRATTLHFSDQVDFIEKWLDGYAKA
FT                   ATKLSYELTALESVVSNFLSYSTHPLVVSEAVVDHDYTLLAMRRCGEGSKDLWSGLVAT
FT                   TRKLESLISEPIRDFIQEDLRHFKEIRRNLEQSQKSYDYLQARYASQSKSKEASALREE
FT                   AFQLHEAHKAYLKAAMDYSVQGPQVRNALDRLLVKVSCDQWREFRGFHNHNGGTFSKWS
FT                   REMDRIKGWLHEMEGSEKSSKRELLSTRKHIEEAAELAARPSRELEDYNISTVPYLGSR
FT                   PISTLNVSKETRPEKQGWLYLRTLSGKPTRTIWVKRWAFLKHGIFGCLVQGSRTGGVEE
FT                   SERIGVLLCSIRPAFQEERRFCFQVKTKNNTILLQADNQKELMEWIGAFEAAKQKALEN
FT                   PASTDLSVSGKVTVQDPAFSISQPPATEFAADPADSLTPHANDEPGAGDRSVTLPVPDR
FT                   DGHIMRNSTDIGSSRRPTGLDNESSAREHAREHTSRLIQKLDLHRKSNNAAPISPAIPG
FT                   PAGGIASLISASHNILPYSNTGPLNVSADDKRGRSLSNVDESGSSLAPATLANPPAPTS
FT                   MSKAAVVVSNERGIGLGVSDSTGGMPSGMMANLWGTSNWGFMNKLQREQRQIDGVSDDT
FT                   PEGRPSSTLSDGSTHAIAAQPDAAGSSAAPRQQSGPRHRQTVSLDGDDVKLTQVALGVG
FT                   HEYPSYYPQQLKIQDAQFRLLFPDVKRAEALVLVFRATWSPNDQQEFPGRAYVTTRNIY
FT                   FYSHHFGLVLTTGVSLESIKEVTAAPGRDCDFLFLHTIPPLGSDIPGRVTIKTFLEPLR
FT                   LLQKRLNFLIQGSIAVEQLTLESLIKALIKMDTGSPARTSSADSWEDLSSGLADIKHDG
FT                   SKATDLGHAKDIRLPIYIDKDLEMDGGRTGRGRDIARFRLPTQPVEYVPQGDLVLVTEK
FT                   ILDISPKALFHILFGDKSAVWQLLLHERQAREIKQGPWASTEQRHLKRDFHYNIATTDI
FT                   LGRTHENAISDYQIIDVLNDHLCYVITDKKTPWHLPFRRSFRLVSKVVITFQAKSKSKL
FT                   AIYTKVEWLWSPYGLKNVIDKKASDDLEQDSLDLVDLVSDQVRRLGAHSRTKKAITIFG
FT                   HVGRQSHVSQFSGAGSNLKLEPRKPRTQRAMHELLLETLLSFLETSVSFFMMWAFGIVR
FT                   WSWKTVSAHKIILTMLGISAILNGYYSSRDSWDWWHERHAGNFMARLGVQPNLVMSKSI
FT                   YMRDIDDAVANSTIWPGTGNASDCFATFHEQTMRYSEMPLSLSPSGPRDALTKSATKRF
FT                   QQTRERLGMYRHNLLVALRVVNSIEKEVIQTEWERWLREEVRRCRQVEVLLGGEATQGD
FT                   DSQPGQTAKAERVFAEHADNVKQWYEGYCSSCRMEQEQVIFNDRGDLVP"
FT   CDS_pept        join(561320..561497,561561..563206)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210744" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942365"
FT                   /orf_name="Pc18g02410"
FT                   /product="Pc18g02410 protein"
FT                   /protein_id="CAP94465.1"
FT                   /db_xref="InterPro:IPR007851"
FT                   /db_xref="InterPro:IPR018034"
FT                   /db_xref="UniParc:UPI0001831808"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCW5"
FT                   /transl_table=1
FT                   /translation="MEPPSKKMRKLLDDDSDSDSGDDAGGVLLGKQSSDTGFKVNEDYA
FT                   RRFEHNKKREEVARLEAKYGKSSSLGNRPGEDSEDSDSEEEDDDAELATLALDAEISAT
FT                   LNAIRSKDPRVYDKDSSFYTEFNPEEAAAGKGPKEKSMTLRQYHTENLLSGVNPAEEEN
FT                   TPKTYAQEQADLKNAIVKEMHGAADKSDEEMEDGDDFMVRKPGQDVSLPKSEIKLDIEN
FT                   ADKDPETFLSNFLSARAWIPTDKQELHPFDSDEDDDVDRAEAIEEAYNFRFEDPNKMNE
FT                   VIVTHSRDLTNKQSVRREEKSARKKLRDAERALKEEEKKQRETEKNRLRKLKTEELQKK
FT                   VEQIKEVAGLRASEFTDEDWSRFLDASWDDSNWEAEMQKRFGEEYYAGEEGGDSENEGG
FT                   KKKKLPKKPTWDDDIDIKDLIPDYEDEEEQPTLELSEAEAEDDDEASGSKKKSKAEEKR
FT                   IQKREARKDRLRIEDAVERNLDLDITLLPGATKKNATKFRYRETSPQSFGLTARDILMA
FT                   DDTQLNKFAGLKKLATFREEEQKRRDQRKLGKKARLREWRKDTFGDENGPVFKFGGDAR
FT                   PSQPKEADDEDKVDIREGDGTRKKRKRSKKH"
FT   CDS_pept        join(564915..564968,565117..565138,565223..565299,
FT                   565516..565761,565817..566365)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000165727" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976249"
FT                   /orf_name="Pc18g02420"
FT                   /product="Mitochondrial ADP/ATP carrier BAC82547-
FT                   Penicillium chrysogenum"
FT                   /function="binding"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP94466.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR002113"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001831809"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCW6"
FT                   /transl_table=1
FT                   /translation="MGFGGDVNQAEKSVFGMPGFVVDFLMGGVSAAVSKTAAAPIERIK
FT                   LLIQNQDEMLKQGRLDRKYNGIVDCFRRTAAAEGVVSLWRGNTANVIRYFPTQALNFAF
FT                   RDTYKSMFAYKKDRDGYAKWMMGNLASGGAAGATSLLFVYSLDYARTRLANDAKSSKGT
FT                   GERQFNGLVDVYRKTLATDGIAGLYRGFGPSVLGIVVYRGLYFGMYDSIKPVLLVGPLE
FT                   GSFLASFLLGWTVTTGAGVASYPLDTVRRRMMMTSGEAVKYNSSMDAARQIVAKEGVKS
FT                   LFKGAGANILRGVAGAGVLSIYDKAQMLLLGKKF"
FT   CDS_pept        566986..567762
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942366"
FT                   /orf_name="Pc18g02430"
FT                   /product="Pc18g02430 protein"
FT                   /protein_id="CAP94467.1"
FT                   /db_xref="UniParc:UPI000183180A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCW7"
FT                   /transl_table=1
FT                   /translation="MSAPTGIPTYNSAPVNPNKEGEGTHATTSQPEPATAIESLASAPS
FT                   QPPAAPATTTAAATAPSNPTIYTTTKPSSAPAPPQPGATAAQPTQTATATPTTSSPETA
FT                   TATSTTQTPPAPQPGAVPSPSTAYTGAAHQTSTFPPPPKAGEAISQPPAQPTQSYTQSY
FT                   SYNQTLGAQTALPNSTTSPYSSVYPTQAGSHRPQTLPLHYGAGAGAGSGGGASSIFPEE
FT                   EEEGFMGAAKGWLRWSGNKLAEVEKGVWKKINDVHD"
FT   CDS_pept        complement(569042..570142)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210766" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670283"
FT                   /orf_name="Pc18g02440"
FT                   /product="Pc18g02440 protein"
FT                   /protein_id="CAP94468.1"
FT                   /db_xref="InterPro:IPR018818"
FT                   /db_xref="UniParc:UPI000183180B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCW8"
FT                   /transl_table=1
FT                   /translation="MAFQTNSSIAMALAGKTASVDIPKRRSGLNGDRASTRPGLPAMLP
FT                   TPPNSISPTLPPQTFKHRARLSPGSPLSTVPQLDSDIDLEDAEHGNGHHVSLPVDDLDS
FT                   TGAITPAMLAKYHLPEILLEQGPLAIRHVMGHLTTSVPGFSHIPPAKARRLVVAALEGR
FT                   GAGGVQGDVVFEKIGWGRWDARRRGEPARDRDLNASSSPPSSVAGSFQQRGLQIQGQSS
FT                   WQGGNRHPYRMSFAESTAFSYTDDYGMHGDLDMLEHEADKMSLDGDDGEYCSSSEAPDE
FT                   MQENEWVEGDDTDEEDWAQIGADALRARSMNNNGSFINGHVAARAKPQPAGIFPATCPS
FT                   VAKVPPRTFDTQERAAVEALLRLGSM"
FT   CDS_pept        complement(572120..572575)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157638" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976250"
FT                   /orf_name="Pc18g02450"
FT                   /product="Pc18g02450 protein"
FT                   /protein_id="CAP94469.1"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="UniParc:UPI000183180C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCW9"
FT                   /transl_table=1
FT                   /translation="MSPTVLKMRTTSPSHFFQSQTRPQDQGPAPTGPYFFYGSLQDQSL
FT                   LIDLLDLKHSFHLRPAYIKGYKCKLWGPYPALVSGDPGDTITGAVYEVPTVEDAEKLAA
FT                   YEGLSYTTVACSIWYVDGQSPLQAEGYAFLFVGNTRDLREGSFDLKH"
FT   CDS_pept        join(573053..573158,573210..573579,573631..575173)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196087" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823034"
FT                   /orf_name="Pc18g02460"
FT                   /product="Pc18g02460 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP94470.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI000183180D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCX0"
FT                   /transl_table=1
FT                   /translation="MVYGLAFLCLAIAANAVSPKSLNSDISILIHNDLLESQSPLSDSG
FT                   ILVLDARPWQEATESCQKIGETLWGAGSSYKDIQNDLDYLVFQGKYTRNQRFWTASDRR
FT                   KLSTIDTNGRVNKASANEKLPVVCTQSAPLSNSTFQDTSAQWQVTVHSNDEYLTGFRDR
FT                   FSFRFLGIRYAKQPRRWDYSQVHKGTGKKASALDYGSDCAQGTTGSEDCLFLNVWTPYL
FT                   PKSNKVQKSHLKPVMLWIHGGAFTGGTGSDPTFDGGNLASRGDVVVVTVNYRLGTLGFL
FT                   ALDDGKTNGNYGLADQITALEWVRRNIQDFGGDPDRVTIFGQSAGAGSVRALLASPAAR
FT                   GKFTGAIMQSNLGGLAYGTTYSKYYTIAQAMDVVGNTILNETNCTDAVSPVECLRQLPA
FT                   STIANLADSARYLVVDGVYLRSSEQDLTNPASTASVPLMIGTMRDDGAAMIEYPAVGQT
FT                   LKSFLNDSDLPDSVAPSPLFPVPSTANATLDIFNTSSRIATDGMFRCIDEATAHTASRT
FT                   HIFPDIYYYEFNRSYQMPGWSPNAPVCNAPITDEFPNGDPSQEYFKCHSGELFYVFGSF
FT                   RRQGLPFRDEFDLPYGQYVLDSWASFARVARPTPDLAFLKARGYVNTTREIEATGSWEP
FT                   FGKESQLRLLQWPSGMRDLDELEQCRALELPLDYFAS"
FT   sig_peptide     573053..573109
FT                   /db_xref="UniProtKB/TrEMBL:B6HCX0 "
FT   mat_peptide     join(573110..573158,573210..573579,573631..575170)
FT                   /db_xref="UniProtKB/TrEMBL:B6HCX0 "
FT   CDS_pept        join(575696..576014,576770..576833,576885..578274)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127334"
FT                   /orf_name="Pc18g02470"
FT                   /product="Putative uncharacterized protein Pc18g02470 "
FT                   /protein_id="CAP94471.1"
FT                   /db_xref="UniParc:UPI000183180E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCX1"
FT                   /transl_table=1
FT                   /translation="MDLVRKSGITARDYLANLDPRYLECFWQKGKWRQIHGDGKAETYG
FT                   AYVARSMETTTAIPEYRIQVLYLKKPMLNFTLPGSINKDGTSNPPTPQEVIDALAIELT
FT                   NIGVYHFFCLMMEEDAKMIDEVTECPYVVGNKIILQLEGRPVQATIVKTFEPWTQSCAM
FT                   VLSFDSDLSSLGIKGNVVLKIYDRRFSTKLRSIYKITGPWTPEIERDLYEFLCSDKGME
FT                   FTIEYEKACIKQREEDYCFMPTIVEEDTEEQDQQNTCEQEGTNGNDNVSSKGNWYNLSM
FT                   ISNKLLSPLLYAYKMASRGLFCAIRLFLTGVTAVVPWGRHKIIDIETQDINRKNEVKGD
FT                   NSTKNHGTTGEQQTNNLDAAVGDAGGSEDEEGKWDHRREEIDAYVHKQFYYESELEAYE
FT                   TMKDLQDISIPRMFARTKILGPKCTQGQPFSRYFEHPGILMEYIEGFPLPELPKNAPKK
FT                   AWQPIVDKAIEIVNEIMRHGVLNDDTNVRCFIVQPDPANDPDLDSDSEYKFKLAMIDFG
FT                   HTRFRRQYLPGEDWRWWEAQNDAEGAIGLIMHRRLGEVCEGVYLYEETPYCKSLQHDYM
FT                   REECSQERPTPRTE"
FT   CDS_pept        join(578900..579080,579189..579418,579479..579508)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976251"
FT                   /orf_name="Pc18g02480"
FT                   /product="Pc18g02480 protein"
FT                   /protein_id="CAP94472.1"
FT                   /db_xref="UniParc:UPI000183180F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCX2"
FT                   /transl_table=1
FT                   /translation="MSYQIAYDKTRAPPRGAALVAFMEDFYRTSDTEPLHEKYVQSFTE
FT                   DATLIMGPKEAKGASAILTLRHGLWTHVASRRHTPTQIYFGGDDEIMLYGGVNYRLKAD
FT                   PDNEVYVPWAGRVVFAPQKGDEDIKMRFYQVYLDTAAQSGKK"
FT   CDS_pept        join(complement(581076..581105),complement(580533..580657),
FT                   complement(580172..580466))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942367"
FT                   /orf_name="Pc18g02490"
FT                   /product="Pc18g02490 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP94473.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="InterPro:IPR018277"
FT                   /db_xref="UniParc:UPI0001831810"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCX3"
FT                   /transl_table=1
FT                   /translation="MGGVTVRDVDAQKFISAYSAFLKRQGKLPIPGWVDTVKTSASNEL
FT                   PPQDADWFYVRAAACARHIYMRKTVGVGRLRKVHGSTKNRGSRPAHHVDASGSVDRKAL
FT                   QALEKIGVLETDEDKGGRRITQSGQRDLDRIAKTTVDEEEESDEE"
FT   CDS_pept        join(complement(583343..583790),complement(581531..583290))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212056" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942368"
FT                   /orf_name="Pc18g02500"
FT                   /product="Pc18g02500 protein"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /function="protein tyrosine/serine/threonine phosphatase
FT                   activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="CAP94474.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008138"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="UniParc:UPI0001831811"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCX4"
FT                   /transl_table=1
FT                   /translation="MGSDAISALCDSLTTRSKSVAAVLRFFHSARAAFQNASFASIASS
FT                   FRGLYRNDNVNWGQVVFLTTCLIAMTGCGLLSSLVKRRQSGSKAPRAQRPAVGKRSNKS
FT                   SKSLSSSEEDYEDEDYDSNASLRHGTNPNYKKKEWPSDTQRQSSDAYETDPGILRKFTT
FT                   YNSYTTSFATYPAIRTFYSPHPHLARLPTKPTPVPLVVVVHGLGGSLAQFHHLLTSLSN
FT                   VASCFGIDLPGCGLSKFAPTDWNAYTVEALSELLAEAIDQHRDRESGQEVILVGHSLGC
FT                   SLSALLASSTSPIGAKVKEHILGLVAVCPRAEPPSVEDTTKFRRALYVPDLIFDLWRRW
FT                   DRRGGEQSASVMRMVGVAADMETRNLQVRFNKQSRTPVWRRMAWGTLPTYDNDGHPIGG
FT                   LPGQQVWAGIRMPVLLVAGETDAVTKPVEVQKLLKFFGDASAHTTVDTSDSSIIPDASR
FT                   VHDHMSPPAGDLVNEKVFGVEVSEKHLEVGQRKRVVKSAILPAPASHALLYDRATYRTL
FT                   AGVIQDFFSSNVDKRLGLGWQLQHMNTSGKWDVKNLAKWKKVAPVSERIANTFAALKML
FT                   REVDEEHNPATFSAKYRGRIHAVIDISHESPVYNPAELEKGGVRYYKHPTISKIPPTPD
FT                   ETRDFIALVNSIQKDIDEKMEQRTDEEKLLPRPVVGVHCHYGYNRTGFMIACYLIEHLG
FT                   FGVQDAIDEFNRCRPPGIRHGHFIDTLFVRYCVGLKRAPTL"
FT   CDS_pept        join(584642..584746,584868..585077)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        586005..586829
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942369"
FT                   /orf_name="Pc18g02520"
FT                   /product="Pc18g02520 protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="CAP94476.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR004906"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI0001831812"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCX5"
FT                   /transl_table=1
FT                   /translation="MPKTNKEIEIQIEKAIDSLSDQSKPNISKTAREFAVPESRLRRRW
FT                   KGGKSLFQRPPNGRKLTPAQEAALCEYIEHFNTVGASINRRQIAAAADSILQEGHHNSS
FT                   EDPPKIGEHWLQRFLKRHPEYCTQRREAHDESVAQRWSNDYERVVHEHEICHQDISRIS
FT                   LELNQCGPTTQRLKEALEKLAKGAEAQAALAYQLQKEFDRTQAIQGAFRARYDTSRHAD
FT                   STGIINSSRMKETERREHELSEKADQEKTRRKWKKVLIEIRKRGRAKKRSGK"
FT   CDS_pept        join(complement(589147..589305),complement(588885..589098),
FT                   complement(587375..588828))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173155" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670284"
FT                   /orf_name="Pc18g02530"
FT                   /product="Pc18g02530 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94477.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI00018318E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCX6"
FT                   /transl_table=1
FT                   /translation="MASPRDEFVGRDEHVEGSTKERRGTKSPSLTANYLRILSYGSKNG
FT                   GIFAMILGLICALGSGIALPLMNIVFGQLVGDFNQYFVPGSGLSEQTFRSEVNKSRQVI
FT                   AASPSLAASSXWLSSLYIVYLFIGKFALTYISMICFRLISLQASAALRLEYTHALLGLP
FT                   VKKLDEISVGSVTHTITAQSNTIQQSVSDRLAILFQSLALLISAYAIAFRYSWALTLVV
FT                   SAAILFVIIGFSITVPFLVKAQQSIEKAEHKHASVAADTFGSIRTVISLGAENSLYRKY
FT                   SQWAEEAQRRGLRMSPMTGIHLGMLFFAMYVSFALAFWFGLKLYREGHIENIDTVITVF
FT                   FSVLLVVTVLGSIASPLMIISKAISASGPFFDVIDAEHRTSFSGLRDPDISTQADIEFN
FT                   NVSFAYPERPSKFVLNNFTARFQTGKTTALVGSSGSGKSTVVGLIERWYQLSSEREAAQ
FT                   GEILVDGHHINDLDVKWWRSQIGLVQQEPCLFNDSIYSNVAFGLIRSKWENESESVKME
FT                   LVAAACKEAFADEFIERLPMGYATMIGEYGTNLSGGQRQRLAIARSIVKQPVILILDEA
FT                   TSSIDVRGEKVVQAALDRVSQNRTTIMIAHRLSTVRRADNIIVMKDGTNIEAGSHHDLT
FT                   LKGGVYHSLVHAQKLDSWAEPKESLGDILDIGHKEIRAQADDYSLSDQDGMDGELEKSG
FT                   KKPKTVGFFRSFGSVAYKHRGHWFLYILIIVGAVGAGCKISSPRILDKANFFKAGFSLQ
FT                   SWLFAKLVQVFQYTGQKLSDAANFWSLIFFILALAMAVFYFILGWASNSLSMFVVSSCR
FT                   KDYFFNLIRKPIEFFDRDENASGSLTSRLSTDPRQLQDLFGPTGVFPLISIFNIMGCVA
FT                   ISFAFGWKLAAVTFFAAMPFLFLAAFMRIRYEIMFESMNAEVYKDSSKFAAEAIRAFRT
FT                   VTALTMEDHIIQRYSNLLKQQRQKAIRKAWYATLVFAFSDSVELCAMALTFWYGGQLLA
FT                   SREYDTVAFFVVYIAIIQGGQSAGQFFSFGPNIAQAKASASRIIQSQCASEYQLQSQPT
FT                   AQLSAANPNASVELKEVTFNYPTCNYPTVFNINLTIQSGQFIAFVGPSGCGKSTIISLL
FT                   ERFYEPTHGAILFGGRDIRSIELSSYRRALSLVPQEPKLFEGSIRDNLLLGLEGTDDSL
FT                   LEEQLVQACKDAEIHDFIISLPQGYETELGVSAQTSLSGGQKQRLCIARALIRKPSLLL
FT                   LDEATSSLDSQSEKLVQDAMEQLAAKRDMTIISVAHRLATIQKADRIFVIGEYETSQGS
FT                   GILEQGTHQELLQKRGPYWQMVRILSNVMFKQLTVSSVKPKLWINRPNFGASRGKRNQG
FT                   I"
FT   CDS_pept        join(589732..589792,589837..590408)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000189880" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942370"
FT                   /orf_name="Pc18g02540"
FT                   /product="Pc18g02540 protein"
FT                   /protein_id="CAP94478.1"
FT                   /db_xref="InterPro:IPR013901"
FT                   /db_xref="UniParc:UPI00018318E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCX7"
FT                   /transl_table=1
FT                   /translation="MATDVRIAQAIGTLGCTAAAIYQGGIATLSIMSIPNLILPARRPP
FT                   SATLPFHDTPGTSTAHLTHQWFDLYNRGSRIFPGISAASSLANLYALWALRDSPTPAPD
FT                   VFGSSWPICYLLAVGFTLGIAPFTGIFMQKTNAKLMAHAKRDDAAMAEGTEDMVLSSQE
FT                   KAKRAREDSEVIELLQHWSQLNLIRAALPLVGAGIGFYAAVSSWIIP"
FT   sig_peptide     589732..589788
FT                   /db_xref="UniProtKB/TrEMBL:B6HCX7 "
FT   mat_peptide     join(589789..589792,589837..590405)
FT                   /db_xref="UniProtKB/TrEMBL:B6HCX7 "
FT   CDS_pept        join(complement(591945..592253),complement(591618..591881),
FT                   complement(590669..591541))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212045" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976252"
FT                   /orf_name="Pc18g02550"
FT                   /product="Peroxin-2 Pex2-Penicillium chrysogenum "
FT                   /function="zinc ion binding"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="CAP94479.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00018318EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCX8"
FT                   /transl_table=1
FT                   /translation="MSSTNFAAAQERVLERRRQREAEARTRHAAQQRTSPISPATVQRL
FT                   PYPLNRLPSSGWQLWNSIKGRDGTRPAFRVGQVDAELLDEELLGLLKGQVGDALKYFGP
FT                   QMREDWSHEILFALRAILFKLSIWDHNASYGAALQGLKYTDSRSKGPVYASPTKWQKGI
FT                   YGLLTVGGRYAWDKWESWLVGQEGGYDEMLSGLTGILSTSHSIAAFVSFLVFLVNGRYR
FT                   TLVDRILRIRLAPPSAQASREVSFEYLNRQLVWHAFTEFLLFLLPLVGIGRWRRWIARA
FT                   WHKMVNSVRSSGDDDEIPEKQGELAFLPERTCAICYRDQNPTTTTESDAIAASASGGIV
FT                   GSAQTDITNPYETVPCGCIYCFVCIVQKIEAEEGQGWSCLRCGEVVKKCQPWNGDVLEE
FT                   ARSQPGTGKIVGFAMDGEPNGEARGTDLHEAESLDKSSPLQEISADEALQHSEQWSTIE
FT                   KEPTEGDSARGTNEDEDLKPAST"
FT   CDS_pept        join(592855..593287,593346..593639,593677..593840,
FT                   593896..594207)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942371"
FT                   /orf_name="Pc18g02560"
FT                   /product="Pc18g02560 protein"
FT                   /protein_id="CAP94480.1"
FT                   /db_xref="UniParc:UPI00018318EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCX9"
FT                   /transl_table=1
FT                   /translation="MGPKRKASSTKSSPESEPHQHATPSKSSKSRKDSAPSSSSGGAAL
FT                   KAPRIPHRTTGLSPLSTDVEDAADWEIMKENAKLRIDSYVPVGEAIRNAENILKPSLHA
FT                   LLEWLPPGGRDHHARIILNARSDKDLWEHFWNVCCYLAAPMKTSTRYSSTVDSAETKSA
FT                   HHSAVASTLTEPQGRLKEFSQPLLRRDNHCCVVSSIINYQYAEETGLSYDIPAALTEGA
FT                   HITPYSYASWKTLVYTLPIRMRTKRTSAWTFLYESFPALRNTIHAESINDPVNGMTLLT
FT                   DLHTWFGDFRLAFEATDRPNEYKILTFGRPLATAGHIPEKVTFTNAAPDDISLPSPVLL
FT                   HCHCVMAKIFHVSGMGETVEKFMRKWDDLKQGPGSHALRGDGKSDLDKFLSAALWEYIR
FT                   G"
FT   CDS_pept        <595196..>595546
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(597314..597499),complement(597187..597248),
FT                   complement(596017..597130))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000212034" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942372"
FT                   /orf_name="Pc18g02580"
FT                   /product="Pc18g02580 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /protein_id="CAP94482.1"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="UniParc:UPI00018318EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY0"
FT                   /transl_table=1
FT                   /translation="MKAVLAVLMGVAALAVAQTATTSEPALADIHAAAATIKPEVTVSD
FT                   VKGLAFDRFYQIWLENIDYDDSAADTNMQWLASQGILLTNFYAVTHPSEPNYCAAAGGD
FT                   TFGMDNDDFKQMPENISSIADLLDTKHISWAEYQEHIPYAGFQGYNYSNQETYHPDYVR
FT                   KHNPMVLYDSVVANDSRARSIKSFDDFENDLRDKKLPQWAFITPNMTNDAHDTNITFAA
FT                   KWERPYVAKLLENEYFYNNTLLLLTFDEDKTYTNDNRIFSVLVGGAIPEHLKGTKDNTF
FT                   YTHYSSIASVSANWGLPSLGRWDCGANIFEIVANKTGYVNYEVDKTHLTLNQTYPGPMS
FT                   IGDESIGNTSTFTPDWPVPITDANEKCSAGHGVLDAIKKTYGHLNATYDTKPYPWNAET
FT                   HYNDKVTAKRSNGTATKTNSTAEDSGHKSAGVAVKAPLSPAVLAVLLAVAVYSF"
FT   mat_peptide     join(complement(597314..597442),complement(597187..597248),
FT                   complement(596020..597130))
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY0 "
FT   sig_peptide     complement(597443..597499)
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY0 "
FT   CDS_pept        join(598565..598729,598791..598891,598947..599084,
FT                   599132..600147,600202..600674,600725..600913,6
FT                   00971..602047)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212023" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942373"
FT                   /orf_name="Pc18g02590"
FT                   /product="Pc18g02590 protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAP94483.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018318ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY1"
FT                   /transl_table=1
FT                   /translation="MTFAIEAQGETNPLSPQNVLNTLVLAASSSQQQVQTGTKQLQNWE
FT                   KQGMYYSFLQDVFLDHSVPNEVRYLAIIQLKNGIDKYWRKTAPNAIKPEEKEHIKTRAL
FT                   AAGIVEPAPLLALHNSLVIAKIMRFEFPHDWPDAISYIISSLRSSVQPGANPLQLPRTL
FT                   LILLQIIKELSTARIQRTRHNLQSASPEIFQLLGGIYVDKINQWGAILDQGGASEGELL
FT                   ETLELSLVSLKVLRRLIIAGFEHPSRSHEVQGFWELTHSHFSKFHSLVDGSANLPEPIH
FT                   RAIEKHLLQMSKLHVEMAKTHPASFALLPDSVSLVKSYWSLVVKLGEKYDSLGAEGEDE
FT                   GKSLTEKIGLRALLLIRACAKMAFNPAQTFKYQTPEDKEERKQSVQLVKTQLFTEEFVV
FT                   NVMELLVTQFFRFRKIDFQDWEEEPEDWEKREEENADAWEFSIRSCSEKLFLDLVIHFK
FT                   DLLIPRLLTVFYTFASTDNHNVLLKDSLYSAIGLAAASLEHHLDFNAFLEHTMIAEVQS
FT                   QEPEYKLLRRRVALVLGQWVPVKAGELNMNAIYQIFQHLLGKHDPLNDLVVRITAGRQL
FT                   RSVLDSYEFSPNAFMSFAPTILESLMSLVQEVESSDTKMGLLETVRVVVVKMEDQITPF
FT                   SDRIVSLLPPLWESSGEEHLMKQAILTLLSSLIQSLGQESVRYHSLILPLIQSSVEPGS
FT                   ETIVYLLDEALDLWHAIIQATPSPASPEIISLLPSLFPILEAATDSTPQAVHILESYVF
FT                   LAPQEILSDRFRFQILVILEVLLKSTTKQRLGVIPRLVDLMLRGAETVDGGSEATYGVI
FT                   SQSLLDSSFLASLLEGLYSAHEASQTSGPNRKSSPVVGVVESDHYSVLARLALASPTIL
FT                   ASSVAAATNSSEEQSLTWILTEWFLHYDNIGSINQKKLHVLALTQLLALPGEPLDPSLP
FT                   PPPPAYILSHLQSYLTAWTDIITELADGGTDPNADYLVCWNAPAGSATAMPESNQEVES
FT                   PEIIRRRDWQSGDAIHRFMIRDFVRHRLQEVITGCGGAQRFQDEWLVNVDTEVVAAFGA
FT                   LGLL"
FT   CDS_pept        join(complement(604143..604225),complement(603684..604063),
FT                   complement(602842..603632))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000114462" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823035"
FT                   /orf_name="Pc18g02600"
FT                   /product="Pc18g02600 protein"
FT                   /function="actin filament binding"
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /function="protein binding, bridging"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP94484.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030674"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="GO:0051015"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00018318EE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY2"
FT                   /transl_table=1
FT                   /translation="MPTMSKFSQKSLLGLSLLAALVQATPTVSLNFDYRGDKVRGVNLG
FT                   GWLVTEPWITPSLFDAAGDAAVDEWSLCATLGPDQCRSVLSEHWSTFITADDLTQIAGA
FT                   GMNHVRIPVGYWALKHLEGDPYVDGQLEYLDQAIGWARAAGLKVMLDLHGAPGSQNGFD
FT                   NSGKRGAIQWQQGNTVEDTKDALEALAARYEGDGDVVTAIEALNEPSIPGGVNQDGLKQ
FT                   YYYDSWGLIRKASQDTTLVLHDGFVPTESWNGFMSESAGVWYVMMDTHHYEVFDNGLLA
FT                   MDTQTHVSNVCSFAQDHLVTSDKWAIVGEWTGAMTDCAKYLNGKGIGARYDGTFSNSQH
FT                   IGSCEGKSTGSVAAMSEEERSNLRRFIEAQLDAYEKGNGWVYWTWKTEGAPEWDMQQQI
FT                   AGGVFPNPVTSRQFPGQC"
FT   mat_peptide     join(complement(604143..604153),complement(603684..604063),
FT                   complement(602845..603632))
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY2 "
FT   sig_peptide     complement(604154..604225)
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY2 "
FT   CDS_pept        join(604295..604412,604519..604576,604656..604833)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976508"
FT                   /orf_name="Pc18g02610"
FT                   /product="Putative uncharacterized protein Pc18g02610 "
FT                   /protein_id="CAP94485.1"
FT                   /db_xref="UniParc:UPI00018318EF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY3"
FT                   /transl_table=1
FT                   /translation="MRNQDPGMIILEMNGWRSAVISNSMSMGADQVAGCRQMKGGVAGS
FT                   SGGSEASGVLGVLGYEYGSTIRKCGDEDENLNLRFVTEFFVALSLCHFVTMCSTGNCDP
FT                   KEYPGKLYFIYSR"
FT   CDS_pept        join(complement(607127..607274),complement(606583..607073),
FT                   complement(606308..606520),complement(606024..606248))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000256364" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943382"
FT                   /orf_name="Pc18g02620"
FT                   /product="Pc18g02620 protein"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="CAP94486.1"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniParc:UPI00018318F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY4"
FT                   /transl_table=1
FT                   /translation="MVPVLKKYKAAAVNAEPGWFDLQESVRRTIHWIDEAGKAGCKLIA
FT                   FPELWIPGYPYWAWKVNYQESLPLLKKYRENSLPSDSDEMRRIREAAKANKIWVSLGYS
FT                   ELDLASLYTTQIMISPAGDVINHRRKIKATHVERLVFGDGTGDTTESVMDTEIGRIGHL
FT                   NCWENMNPFLKAYAASLGEQVHIAAWPLYPGKETLKYPDPYTNVAEANADLVTPAYAIE
FT                   TGSFTLAPWQTITAEGIKLNTPPGKELEDPNIYNGNGRIFGPDGQNLVPHPDKDFQGLL
FT                   FVDIDLDEIHLTKSLADFGGHYMRPDLIRLLVDTNRKDLVVHEDRVNGGVAYTRTIDRV
FT                   GLSAPLDASATEAQSESV"
FT   CDS_pept        608758..608975
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(610646..610982,611035..611492,611549..611952,
FT                   612011..612226,612285..612425,612478..612888)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127602"
FT                   /orf_name="Pc18g02640"
FT                   /product="Pc18g02640 protein"
FT                   /protein_id="CAP94488.1"
FT                   /db_xref="UniParc:UPI00018318F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY5"
FT                   /transl_table=1
FT                   /translation="TPGTSSARSKRKVACSRSLHKTALLAQGNANLRAANEKKRQKRNW
FT                   SSSKLAYKGGLTVEEGLXLGQQLDQPVEGDAQVSHTQGELPIFSTISQPKGLWQMRSDW
FT                   A"
FT   sig_peptide     610646..610717
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY5 "
FT   mat_peptide     610718..610960
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY5 "
FT   CDS_pept        join(complement(613766..613993),complement(613497..613643))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943383"
FT                   /orf_name="Pc18g02650"
FT                   /product="Putative uncharacterized protein Pc18g02650 "
FT                   /protein_id="CAP94489.1"
FT                   /db_xref="UniParc:UPI00018318F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY6"
FT                   /transl_table=1
FT                   /translation="MDLSEFESRFRSLAVDIRSSATGSTVSPGTRDEVGSVRVRLGCDL
FT                   VTFGRLRVYIVFMGGIYALTDENLALDQRLEECTVCRRTAIYYRRQSELIGNSVEKSGN
FT                   TCMSSNTLAAVESIIMTCVV"
FT   CDS_pept        join(614800..614914,614974..615247,615344..615803)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158748" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976509"
FT                   /orf_name="Pc18g02660"
FT                   /product="Pc18g02660 protein"
FT                   /function="heme binding"
FT                   /function="oxygen binding"
FT                   /biological_process="oxygen transport"
FT                   /protein_id="CAP94490.1"
FT                   /db_xref="GO:0015671"
FT                   /db_xref="GO:0019825"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniParc:UPI00018318F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY7"
FT                   /transl_table=1
FT                   /translation="MERKMGSAADPMHVDRKMLYTSLEERIKYLHNFLDFNSADIEALL
FT                   TGNKYIKQLIPAVVNLVYKKLLQYDITSRAFHTRTTVDEREPEEEYLHEETPKIQRRKM
FT                   FLRWYLTRLCQDPTTMDFWRYLNKVGMMHSGQVRMSPLNIEYIHLGACLGYIQDIWIEA
FT                   MLSHPHLSLRRKIALVRAVNKILWIQNDLFARYHSSDGEEFADEMSEFNYTEDQEGYLG
FT                   DKRILGSSSGSSTEDDRSSISSGVAPSIDSAAPSTTPKVSACPFADMGKNSSTETKIWA
FT                   N"
FT   CDS_pept        join(616383..616837,616915..617308,617367..617809,
FT                   617900..618044)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943384"
FT                   /orf_name="Pc18g02670"
FT                   /product="Pc18g02670 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94491.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI00018318F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY8"
FT                   /transl_table=1
FT                   /translation="MAQSNKPVTPLIINNESIETDIKFEVHAPATGELSGYCAGVSVDD
FT                   ANRAVDSAQAAFPAWSKTTANDRRDILLKAADIMASRKEELIQYQREETGAGRPFSEAT
FT                   FNMGVLFIKDFAGRISTIEGVVPNVSQEGEGAIVYKEPYGVILSIAPWNAPFILGTRAV
FT                   ALPLAAGNTVVLKGSELSPKCFWALGDIFRQAGLPAGCLNVVFHQPSDAPAVTNALIAH
FT                   QAVRKVNFTGSTMVGSIIASTAGKYIKPVLLELGGKASAIVLDDANLDKAAMNCAIGSF
FT                   MHSGQICMSTERIIVQRSIADEFRQKLAETAEKLFGKDAPALFLVNAAGVAKNKKLVTD
FT                   AVSRGATLLFGDANSSESVNTGMRPIVVEGVTKEMDMYATESFGPTVSLMVVDTEDDAI
FT                   ALANDTEYGLTAALYTNNLFRGLRVAKQIESGAVHINSMTVHDESVLPHGGWKSSGFGR
FT                   FGGVSGYDEFLQTKTVTWHE"
FT   CDS_pept        620210..620968
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000174973" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943385"
FT                   /orf_name="Pc18g02680"
FT                   /product="Pc18g02680 protein"
FT                   /protein_id="CAP94492.1"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniParc:UPI00018318F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY9"
FT                   /transl_table=1
FT                   /translation="MRFSVATAFSALVAVAAAYTSPDYSQNPSGNAIVAPGLNEIVPEG
FT                   KTYTIKWQPSTTGPISLVLLRGPSNNVVPLKTLAESIPNSGEFKWTPGSDLEADTTHYG
FT                   LLLVVEGTGQYQYSTQFGISAAAGSGSSSSAVTIETTETTTICPETETPVPASSTVYSS
FT                   VEITTTICPESETTAPATTPGPKVTPTGVSPVGPPSSTPLSSIRLTTSAVPSGTASASP
FT                   SASSPVFNSAGRNAASFGAVMAGVLAAFAL"
FT   sig_peptide     620210..620263
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY9 "
FT   mat_peptide     620264..620965
FT                   /db_xref="UniProtKB/TrEMBL:B6HCY9 "
FT   CDS_pept        join(complement(624474..624554),complement(624335..624413),
FT                   complement(622332..624226))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235032" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943386"
FT                   /orf_name="Pc18g02690"
FT                   /product="Pc18g02690 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94493.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018319B8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCZ0"
FT                   /transl_table=1
FT                   /translation="MEQETCLLQKPLRTPRACDRCRRQKLKCESSRPCVLCTRAGHKCE
FT                   TSQRTGRRRSEISYAPETSTSYPERSPKEPQSGANASAIDFARRVFNEEEAGRTLTGAS
FT                   IPGDTGDPTLDNSLWHLTEVELPPEAVMLALIDVYFDRMQWFILLFHEPSFRQTARRII
FT                   SQTSWRRQDLSPTMAVLAVAMIGLNSALPDQRWPGHELLREHSVDGKKLIRGLINEIRR
FT                   NLLDISIDCRIEAVQVCFLVASYYVYHSSPSIAWTVSGMAVRSAYALRLYTKSARCESP
FT                   VVDEIRSRCWNHAIVGDTFASIIYGRPSSIDTGLVALHSLRDMDDLAIDPLLLKNEWIS
FT                   GDGMPTTTAEFFAMKYEIYNIIRHILSRFRRLQLRKETIEEDLLAIAEAAQDSEEQLVS
FT                   WRKRVPRLFDFEFWSRDNCLEQFQQQIEGLPQRTKYQAETIILQAATLQLTYDGALIQA
FT                   HRPLLEQKITGSCSPLVVDAIHESLRVATTAALRISCIPVLRFKHHFAESFASLQQFTA
FT                   GVILCILPTSQPFTTAAHEAKAGIMRIIHASTALGPHNRIAKQTAQLLTELLRVTIERE
FT                   MSSALRGGLETNLPKDIERGAISSVQAARIDHTGRYSPYSQDVRDHPPMSPIHAPSRSR
FT                   EPSHMPQATHDHGRTNDRPDRAPVEPSEYPSANIFEQLDDTFGAFGERE"
FT   CDS_pept        join(complement(626797..626937),complement(626468..626585),
FT                   complement(625893..626404),complement(624783..625829))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670529"
FT                   /orf_name="Pc18g02700"
FT                   /product="Pc18g02700 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94494.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018319B9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCZ1"
FT                   /transl_table=1
FT                   /translation="MSKSGTANYHHENPSDPRKCGAPTFPTDDADDSRIPFILRAILQH
FT                   SVQRKKQPESVPMDLPSSLSLLEAFSNAEDVDRLDRGGDDPDLFGQFIASGIKPISGQP
FT                   HMTLTHNVPQTYPLDSYLTTINELLSPRTPDLILGEHNPPFELQRTFEARLPSLSEESK
FT                   EYLQLKGALRIVSIDLRNELLAAYIKYVHPLLPVIDLQWFLLNVMVEDESRFPSPLLHQ
FT                   AVMLAGSAFIEQETAVKAGFSSRKALRRTLFGRAKLLYEFETEPNAYTQIQALLLMMQW
FT                   HGSGSGHKDPTYWFDLAYSTAQRVDLLGSLETGSFSHKHRMWWCLYVRDRILSLGFRRP
FT                   LRIPNSDVTMSLLDSTRYYSSELYHELVLVMLGEASAMLSWENQERMMLLFIQEIKLAH
FT                   CVGVIINLLYQDAWSPSPSGECEYSMVPRSNVSQAAITGCEQLLKTWIQDLPAPAHYFP
FT                   PSLLRDCHAESPEIVLLVHQAFLYLLHLTAMSILYQAASRKGDGIQTTLISEMRGLTLQ
FT                   VNEILNELHDCRMLHFLPGSTITILIIILEASLPDLKVPDSIVRMQAMSNLYACEEAAG
FT                   HLLQTYPAAEIVLSQAQNARGHLLGLAVT"
FT   CDS_pept        join(complement(627994..628019),complement(627136..627855))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670530"
FT                   /orf_name="Pc18g02710"
FT                   /product="Pc18g02710 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP94495.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018319BA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCZ2"
FT                   /transl_table=1
FT                   /translation="AIFVKTDVSEAPDVRRLVQSTVERFRCLHVLVNNTGIVKSRGPRL
FT                   VHETDESTYTKTMDDNVKSVFLGCKYAVEQFRRQNLDSVGNKHAVLDHNLPIGLEVAWV
FT                   CGFK"
FT   CDS_pept        complement(628992..630458)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189482" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127603"
FT                   /orf_name="Pc18g02720"
FT                   /product="Pc18g02720 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAP94496.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniParc:UPI00018319BB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCZ3"
FT                   /transl_table=1
FT                   /translation="MSQDSRRAGSLSRDVAQTDDRASDNDRAFTTRNPARRPPNRPRPQ
FT                   SWHPYGPVEPPLESISSRPIGVHAILNHPQATADLSALAREPVSLPGPSSSPRPQGTPP
FT                   IRSGYAMASQPLSPKSHPRPLMNPASPSARFVGSGRASGQSSVAQSPLVPHEPLMGPRV
FT                   PVTSSPLPLETGLRPIEPLTGTQPPLTSLHSTTSLHSRQTSAGRGPLTNPNSQETSPST
FT                   PHSTFSPYGRASPAVASISLAQSAASYATAPSYMTVDPLARPIPATKGPRRQPEPAPTR
FT                   AGTPQGSPLPLGMIPCLLDMRSGSSSQAEKRKANSDASRRFRNRKRNEMQLEQRLNAQQ
FT                   EEIQRNVETVRRQSEELRSLVQQRDHYRSERDFYRDHLGRTMSLSALPPRPSSPRSAQP
FT                   TLLPASEPGTTSWSGADAARSASGTQPTSAAPQGRMLDSAQSQPAWPASPPYSSTPVAP
FT                   AGRAVAGPPSGSPSVTGGTLPPLQGSWPRP"
FT   CDS_pept        complement(632414..632929)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670531"
FT                   /orf_name="Pc18g02730"
FT                   /product="Putative uncharacterized protein Pc18g02730 "
FT                   /protein_id="CAP94497.1"
FT                   /db_xref="UniParc:UPI00018319BC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCZ4"
FT                   /transl_table=1
FT                   /translation="MFDSTSQNHWMYQTAIVFQLWTMIRSKKKKRKKKRKHTIAGTLLQ
FT                   QKTDSSPFKLCRKRRRILCMTTHPKKIYRKYFVSAYLPTSGVRSTEYGVGNTQIRIRGD
FT                   HGTIPTTPSHGRRISNRCECQEEALQLRQQGRLSYGPVYGVKLFSISRTHFSTVSFDWT
FT                   LKRSPLLI"
FT   CDS_pept        join(complement(635440..635472),complement(635085..635245),
FT                   complement(634868..635014),complement(634199..634787))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000220627" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943387"
FT                   /orf_name="Pc18g02740"
FT                   /product="Pc18g02740 protein"
FT                   /protein_id="CAP94498.1"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniParc:UPI00018319BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCZ5"
FT                   /transl_table=1
FT                   /translation="MSEIQRWTVNEPYLDIPGTLLEGPFYDVAKNEFRFVDIWDHKLYR
FT                   LDLAKGPESLKVIDTEVSLGVTANIAKTSNQLIVAAKYGFARLDQTTGNLSYIHGVREL
FT                   WGEDEGKAERMRFNDGAIDSQGRFWAGAMNDPKIKKPEAEGVLFRLDPDQTVHHMLAPV
FT                   TIPNGIGWNLTDDVMYLTDSPTGKIFAFDFDANTGAISNRRVHFDIGNALEPDGFAIDV
FT                   EGCIWSAIYGGGKVLRISPAGKVIGQIDLPTRNVTCPVFVGTELFITTAKDDRDDDHLP
FT                   QSVRYGGRVFRIDVGIRGVPKNEFQFQD"
FT   CDS_pept        join(complement(637883..638126),complement(637616..637782))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943388"
FT                   /orf_name="Pc18g02750"
FT                   /product="Pc18g02750 protein"
FT                   /protein_id="CAP94499.1"
FT                   /db_xref="UniParc:UPI00018319BE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCZ6"
FT                   /transl_table=1
FT                   /translation="MGSLPNITVRYGNPRSRIDSYVPVGEAIRNAENILKPSLHALLEW
FT                   LPPGGRDHHARIILNARSDKDLWEHFWNVCCYLAAPKTKPAHHSAVASTLTEPQGRLKE
FT                   FSQPLLRRDNHCCVVSCLLTILANYLGTYLGS"
FT   CDS_pept        join(complement(641002..641129),complement(640753..640952),
FT                   complement(639513..640693))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943389"
FT                   /orf_name="Pc18g02760"
FT                   /product="Pc18g02760 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94500.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI00018319BF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCZ7"
FT                   /transl_table=1
FT                   /translation="MSDISVQLTAPNGRSYTQPIGLFINNEFVAAKSGEKFATVNPSDE
FT                   TEITSVYAAGEEDIDIAVKAARKALKDPSWKLLPATDRGVLMLKLADLIEQHKETLASI
FT                   ETWDNGKPYQVSLNDDLGEVTNTLRYYAGWADKVYGQTIGTTPAKFAYTLRQPIGVVGQ
FT                   IIPWNFPLAMAAWKLGPALACGNTIVLKPAEQTPLSILYLAGLIKEAGFPPGVINIVNG
FT                   HGRVAGGALVNHPGVDKVAFTGSTLTGREIMKMAAGTLKNVTLETGGKSPLVVFEDADL
FT                   EQAAKWAHIGIMYNQGQVCTATSRILVHDSVYDKFVELFKEVVRTTSKVGDPFSDDTFQ
FT                   GPQVTKAQYERVLSYIEAGKSEGATLASGGVPHKNVGDGRGFFIEPTIFTNVKDSMRIY
FT                   REEVFGPFVAIASFTTEDEAVTRANDTTYGLGAAVFTRDIERAHRVASDIEAGMVWINS
FT                   SNDSDFRVPFGGVKQSGIGRELGEAGLDAYSQVKAVHVNMGTKL"
FT   CDS_pept        join(complement(643055..643331),complement(642742..642993),
FT                   complement(642666..642683),complement(642485..642601),
FT                   complement(642130..642425))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000263533" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943390"
FT                   /orf_name="Pc18g02770"
FT                   /product="Pc18g02770 protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94501.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR000116"
FT                   /db_xref="InterPro:IPR000637"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR020478"
FT                   /db_xref="UniParc:UPI00018319C0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCZ8"
FT                   /transl_table=1
FT                   /translation="MQGLIVASRGFSTQTVGTGLTYMEQVDAVPQTGEKRGRGRPRKYP
FT                   QSSTQKPASDAPKRGRGRPRKIVSELEPEAVAPSGPKRGRGRPRKDSGNATPVAPKIKK
FT                   KDGRGRPRKNPMPNGEAETTKSKATPAVDIIPETGRSFWLMKAEPESRLEKGKDVKFSI
FT                   DDLAAADSPEPWDGVRNHVAKNLMRDMKKGDFAFFYHSNCKVPGVVGVMEIVEEHSTDE
FT                   SAFDPKHPYYDPKSKRDDPKWVVVHVEYRRKLGKQVTLQDLKSHGQTGKPLENLQMIKQ
FT                   SRLSVSSVTPAQWKYILELAGEEPQEEFTKKESSDEEE"
FT   CDS_pept        join(645671..645690,645745..645870,645928..646003,
FT                   646058..646387,646457..646539,646594..646624)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000022346" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943391"
FT                   /orf_name="Pc18g02780"
FT                   /product="Pc18g02780 protein"
FT                   /function="antioxidant activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAP94502.1"
FT                   /db_xref="GO:0016209"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="UniParc:UPI00018319C1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HCZ9"
FT                   /transl_table=1
FT                   /translation="MADRAAPLRLGSTAPNFKALTTQGEIDFHEWIGDKWAILFSHPAD
FT                   FTPVCTTELGAFSKLEPEFTKRGVQLIGLSANALDSHEEWIKDINEVNSTQLKFPIIAD
FT                   AERKIAFLYDMIDEQDLTNVDSKGIAFTIRSVFIIDPAKKIRLIMSYPASTGRNTAEVL
FT                   RVVDSLQTGDKRGVTTPINWLPGDDVIVPPTVNNEAAKEKFGEFREVKPYLRFTTLKE"
FT   CDS_pept        647536..650211
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189471" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943392"
FT                   /orf_name="Pc18g02790"
FT                   /product="Pc18g02790 protein"
FT                   /protein_id="CAP94503.1"
FT                   /db_xref="InterPro:IPR011498"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI00018319C2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB48"
FT                   /transl_table=1
FT                   /translation="MSRSQSSLGYMDSGREDSASGGSPSLNQPSTSGPINLSGLVCNVR
FT                   RTTGKEPRPLVGATTTILGDKLYVFGGRILSRSRPQLTSDLYELDLIRRHWTKVEPAGD
FT                   VPPPRYFHSVCALGDNKLVCYGGMSPAPTTPKDPENPAEPQSQSQSEVVVMSDIHIFDV
FT                   PSRAWTRVAAHESPQGRYAHCATILPSSACFTSASAPLSAIHNNPESSTHQGTLGVDID
FT                   GFGGAEMVVVGGQDSSNHYIEQISVFNLRSLKWTNTSPLGRSCGAYRSVVAPLVGMDVS
FT                   EIGSSAPDRDQHEPIQDSTESPGCPMLIYSNYNFLDVKLELQVRLPDGRLVERPMQSQA
FT                   SPPGLRFPNGGIINGHFVVSGTYLTSSKQEYALWALDLKTLTWGRIDAGGSVFGQGSWN
FT                   RGVLWPRRNSFVILGHRKRSLVDDYNHRRINFSHVCLVELEAFGLYNNPCRTSPTSGYK
FT                   SYSSSSVPASLQKKLVQLTSGGRPLSAASDELGKLAQSLPEMADMELQAVGGERISVNS
FT                   RVLTRRWGPYFIQLLRESSEGGIADVATLRPAQIHPSRNSSITITPSIGSDATTLVNQS
FT                   VPSKSLLENLEAPSAHSLAPTSRPRVLYLPHTILTLQVLVQYLYTSALPPAGNSLCTPQ
FT                   ILCSLLQLARPYQIDGLLEATVERLHQVLDGRNAAAVFNAAAMAAGGGRGTGFNGGPGG
FT                   TLEALNGAYTSHNGTAPTIGENSNSQHGALTSDSSDTEHGGASASAASSTGDLTNFARG
FT                   IPSLRIDTSVSQHSRQRSAHRDREDSISNPSTATSASSASFSQSDSEWVSGDEGRSQSR
FT                   STHHRRDTDAELRRPQRELWTGDLSSVIGLQKRGLRGLMEGRRMRERSAKPASTGSNSI
FT                   SMPPSAGSGDQHVPFQGVAS"
FT   CDS_pept        join(complement(652260..652390),complement(652136..652203),
FT                   complement(651907..652103),complement(651710..651877),
FT                   complement(651182..651654),complement(650977..651126),
FT                   complement(650792..650856),complement(650665..650717))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823309"
FT                   /orf_name="Pc18g02800"
FT                   /product="Pc18g02800 protein"
FT                   /protein_id="CAP94504.1"
FT                   /db_xref="UniParc:UPI00018319C3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB49"
FT                   /transl_table=1
FT                   /translation="MYYLSGFHQGAVITIEGLFSGQILMSHFEGISFLGCILLSSSTAQ
FT                   RKRHDTVLSLTPQIPISTPECKRLSEFPQILLRRDNHRCVASAYMDMDFWEEARLSDDI
FT                   PVGLTGTLVSFHIHMPGGKPPYVSFLFRQTMINRVNVWTLLYKTFPALRNTIYAETIND
FT                   PSNRMTLLTDLHTWFGDFRLAFEVIDRSNEYKVLTFKRAPTTVEPLIPDKVTFMNAAPE
FT                   DISLPSPVLLYCHCVITKILYASGMGKVVEKSMCEWEDLKQGPGSYALRKDGKSDVDKF
FT                   FGCQTMGLWRIFFDNLNGYTIEPIYLMFIEPYGSITSPTESYASGVNTSPNLPSQNSHP
FT                   PNQQKIIMSSLKDQHRYRSVDPKTRPPRPVQQPAPRLPKGVDDIRKTKEYKAAARRWTS
FT                   TIVGLPIVMYTSWILYERLYGGKSPKRLGDQGQKD"
FT   CDS_pept        complement(652839..654758)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976510"
FT                   /orf_name="Pc18g02810"
FT                   /product="Pc18g02810 protein"
FT                   /protein_id="CAP94505.1"
FT                   /db_xref="UniParc:UPI00018319C4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB50"
FT                   /transl_table=1
FT                   /translation="MPPKKGQRKSMPARISKAPTLTPSRRSPRVPPPSKSTNENVQPAK
FT                   TLNHTSSSPKDSPINIRFYTPNPPVPSNPSVSSTSSRGTSPETPSSRRRAFQSRPSRLS
FT                   TVYTPALEAPATNQGSRRTRRTAALETPKKEVSDIDFPESTGTGSWTFDQYMGSFESEG
FT                   TAEGPSSPTSASDMRNSSRVRKPTMRALESFESTKKKSRRKNTTVSTPTVETPPATTAA
FT                   PAPSVATKVAKNNVSKQPMRKTRKSKRMSNLNMQKTAVLIGFDIDAKVAGQKLYDLSMQ
FT                   ALSPDFTIPFDFPVFLEQQRSEYFRRQDEEKYGVDMPATMATTPTDVDMDVDMMDQDVP
FT                   APVIACSPSSSTPTAPMPATPPAAITNGATNEITNGITDRSSILSYKKQSDTKVGSDGW
FT                   IQTGYVNSSGEEVTLIPEECHPYYPSHTYGYEGLPFPPVRARTTQQAEADAAHSFAPLM
FT                   GGRNLPVEATVPFVAENVEEEKARALARTPVLAPATKKPRARKRRQTAAADATGEPAAA
FT                   TPATTTAETGARKSQRRRRQTAPAPTVPSPTSLTSPTSPPTTATQVQSSGPAAAVAPAA
FT                   TEGDKPKVQRLRLTLKPAPKTEASGAGASASKKGPAVQSPSSPALSRAPSSAPTNKRRR
FT                   RRGM"
FT   CDS_pept        join(655287..655432,655488..655686,655740..656024,
FT                   656077..656316)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000189515" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943393"
FT                   /orf_name="Pc18g02820"
FT                   /product="Pc18g02820 protein"
FT                   /function="dolichyl-diphosphooligosaccharide-protein
FT                   glycotransferase activity"
FT                   /biological_process="protein N-linked glycosylation via
FT                   asparagine"
FT                   /cellular_component="oligosaccharyltransferase complex "
FT                   /protein_id="CAP94506.1"
FT                   /db_xref="GO:0004579"
FT                   /db_xref="GO:0008250"
FT                   /db_xref="GO:0018279"
FT                   /db_xref="InterPro:IPR008814"
FT                   /db_xref="UniParc:UPI00018319C5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB51"
FT                   /transl_table=1
FT                   /translation="MHLWQATVPFCLLAAAALPGAAATAWGFTDATVAVQPKGAGVNGG
FT                   FKEQLAASKPLSKPISLFGADTLRVTLTAQEDSSPKRPDQAFLLLKDAQTGLDISYPFN
FT                   VKDNGKSRVELSQKDLPIQFLSLSGPVDAHIVIGGFGSSDAYDNSVFKLSIDRNPEEAV
FT                   PTVETERYGKKPEIHHIFKDSASSPPIVITLAFVAMVGAAIPALAGLWLFLGANINHLP
FT                   SAFKSAPLSHATFLGSLIAFEGIFFLYYTSWNLFQILPAMAVVGAIAFVSGSRALGEVQ
FT                   GRRLAGLR"
FT   sig_peptide     655287..655355
FT                   /db_xref="UniProtKB/TrEMBL:B6HB51 "
FT   mat_peptide     join(655356..655432,655488..655686,655740..656024,
FT                   656077..656313)
FT                   /db_xref="UniProtKB/TrEMBL:B6HB51 "
FT   CDS_pept        join(657094..657346,657433..657818)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943394"
FT                   /orf_name="Pc18g02830"
FT                   /product="Pc18g02830 protein"
FT                   /protein_id="CAP94507.1"
FT                   /db_xref="UniParc:UPI00018319C6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB52"
FT                   /transl_table=1
FT                   /translation="MGSAASKPAKSAAGAAARRQYPKQPAPPPRGPRKAPNETKAASAP
FT                   TPTPAPKPKAGPPPSQTPSPPSQGPTYHSKEKASGVKSDAIDMDGRDPDFAASLRSIGP
FT                   VNPSPTFSNSSTFNRPGSMQTVFPQASNPALLVVTARQRLTEAADKEAEHFGRAGHPGR
FT                   SFLDALTIQQVLTMRDKQGMRRGDIERFLGLKKGVLERLGKDEIVSRIT"
FT   CDS_pept        659187..659972
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000218797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943395"
FT                   /orf_name="Pc18g02840"
FT                   /product="Pc18g02840 protein"
FT                   /function="FMN binding"
FT                   /protein_id="CAP94508.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI00018319C7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB53"
FT                   /transl_table=1
FT                   /translation="MYLRAVHAEGQLPVLQQFIRDNPLGILTTAIKSPIYPFIQSSHIP
FT                   FVLDVPSSTESNDTIPPGILRGHMAKQNPQAKALMEALAEQNAAGNNKLELTDEVLILF
FT                   NGPHHHYVTPKFYTETKPASGKVVPTWNYSAVQAYGKISVYCNSKAEETGAFLQKQIQD
FT                   LSQQSETGIMGYTGGDKKSAWNVSDAPVNYVELLKKNIIGIEIRVERLQGKFKMSQEMG
FT                   EGDREGVVQGFEELGTEVGKGIADCVRERAALKDQQKSA"
FT   CDS_pept        join(661389..661642,661722..664134)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076597" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943396"
FT                   /orf_name="Pc18g02850"
FT                   /product="Pc18g02850 protein"
FT                   /function="sulfuric ester hydrolase activity"
FT                   /protein_id="CAP94509.1"
FT                   /db_xref="GO:0008484"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI0001831A97"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB54"
FT                   /transl_table=1
FT                   /translation="MSIFALLPPLPPFLFSTLVVSGLASKALHIALHIRSLPFLYFVLY
FT                   SPTLILRDVLVIIFVRVLLRFHAPDSRWQWLSTGLGGALSLITWGASSIQFGFFMQTGA
FT                   EVAWAAGGSFRSDPAAMKILLSGISTVSAAATVLGLIAWLLHSHLYNITGLGLQAIRDL
FT                   CVGGYKARYTLISAPSKSCMASIDLRTFRRVIPAVAICVSLIFLELTRPAIPYDHLSGA
FT                   LPLTLLDAFQKKTATVEGCREPARPFPLSVTDDNGVSRPQFQPDSSLVEQWSRATWLPE
FT                   NPPPGFSRWDLSPSDRAEKDNHYSFVCPGDEGAFYNPKNDPLMITNLGGEIYEPLQKAF
FT                   KEHSIEVNHVVLLTLESGRKELFPTQQGTPLFDGLLASHKKENIDEAIDRLVNMTPVAQ
FT                   QLTGEYATDSKGNKLDLSYSPWQTPPQEGMGGLNVRGAVTGSSLTLKSILGSHCGVNPL
FT                   PVDLLEESMLEIYQPCLPQIFDLFNQGKSESGKLPQNFSSESKSAALQNPWKSVFMQSI
FT                   TDDYDRQDVLNKNMGFKHKVAKSNLESPHAKHKAQGEEINYFGYAENEIRPYLLDLFEE
FT                   AANNKTRMFLSHVTSTTHHPWSTPDDFEREPYMSDQGNINHDLMNNYLNAARFVDIWLG
FT                   EILNMLDQTGIANETLVVVVGDHGQAFGEDNKDMTGTYENGHISNFRVPLVFHHPHMPR
FT                   VDITANATALTIVPTILDLLVQSNSLDEHDSEIASSLLPEYQGQSLLRPFLSSMEEPPH
FT                   RRDHHHHHHRPPPDEQPEHEQDTQLEARSHPENPAKRIVWNMGLINAGGSMLSVMAADV
FT                   PYRLILPLKDGFEYTFTHLGEDPGETHLTKAWTLKALLEEVKPKFGKESADWLEDAELV
FT                   GKWWVSEQKRIWGYREA"
FT   sig_peptide     661389..661463
FT                   /db_xref="UniProtKB/TrEMBL:B6HB54 "
FT   mat_peptide     join(661464..661642,661722..664131)
FT                   /db_xref="UniProtKB/TrEMBL:B6HB54 "
FT   CDS_pept        665309..666037
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000201365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976511"
FT                   /orf_name="Pc18g02860"
FT                   /product="Pc18g02860 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP94510.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001831A98"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB55"
FT                   /transl_table=1
FT                   /translation="MDSSPSFSRANSFIAAGTVSIVYAADHNNVIKIRPTSGEFEQQAY
FT                   EIEIRSYKRLGHHKRIASCEVTEEGLILERGTCLRGMLQSVSAIPWAMKLQWALEAAEG
FT                   LAYIHSKGIIHADVGCHNMIVDNAKHVKFIDFAGSGIDGEDPLVCYEWCSFKPGLVIGI
FT                   YSDIFAFGSMLFELETGCVPYHELERSLDMGKLVAVVERLFSQYKFPPVDTLAFASVIS
FT                   GCWNGKYSSLDEVGRDIALL"
FT   sig_peptide     665309..665380
FT                   /db_xref="UniProtKB/TrEMBL:B6HB55 "
FT   mat_peptide     665381..666034
FT                   /db_xref="UniProtKB/TrEMBL:B6HB55 "
FT   CDS_pept        join(666567..666591,666771..666864,667182..667452)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943397"
FT                   /orf_name="Pc18g02870"
FT                   /product="Putative uncharacterized protein Pc18g02870 "
FT                   /protein_id="CAP94511.1"
FT                   /db_xref="UniParc:UPI0001831A99"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB56"
FT                   /transl_table=1
FT                   /translation="MGKIGKKKGTKSDSERQNKSGGQDRKVPPSRGKHYVAVHSFLPGI
FT                   RIVGVSSARPYRAQISHRRRILEVCRLDTDRIVMTSRESFGIEISRDQKSGNLGISPLS
FT                   KELGEWKILMVTRCVLWLMNISAGL"
FT   CDS_pept        join(668686..668898,668992..669327,669518..669829)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20670532"
FT                   /orf_name="Pc18g02880"
FT                   /product="Pc18g02880 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94512.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001831A9A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB57"
FT                   /transl_table=1
FT                   /translation="MSVAIETTTAPTAPMTAQPVVLGQKARMPEFSLAGKVVLVSGAAR
FT                   GLGLTQAEALLEAGAKVYALDRLEEPAPEFEQIQQRAIQLGTELHYRRIDVRDTELLNS
FT                   VIETIANEEGRMDGLVAAAGIQQETPALEYSAKDSNTMFEVNVTGVFMTSQAVAKQMIR
FT                   FGNGGSIAMIASMSGTIANRGLICPAYNASKAAVIQLARNLAAEWGTYNIRVNTISPGY
FT                   IVTAMVEKLFVEFPERRDQWPKENMLARLSRPEEYRGAAVFLLSDASSFMTGSDLRMDG
FT                   GHAAW"
FT   CDS_pept        join(672339..672621,672681..674290)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161421" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943398"
FT                   /orf_name="Pc18g02890"
FT                   /product="Pc18g02890 protein"
FT                   /function="transporter activity"
FT                   /biological_process="oligopeptide transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP94513.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006857"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="UniParc:UPI0001831A9B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB58"
FT                   /transl_table=1
FT                   /translation="MAAQTTGLDSNSLAVNDVGLVDTISQGAPVPTENNKGIIPESYDL
FT                   GVGDEDPTTDELHGPNALRRVSAPIPWVVYTVAFVELCERFSYYGTQVLYSNFVNHALP
FT                   LPAPNGPPGSNHATGAGGPSSQGVSGALGKGVETASAINTFNTFWCYCLPLVSAYIADE
FT                   YWGRYKTISWSIAAAILGHIILVISAIPPVITNTDASFAVFILGVIIMGLGTGGFKPNI
FT                   SALVVEQIPVVNLRVRTLETGERVVIDPTITQSRIYHYFYLFINVGALTGQIGMAYAEK
FT                   YIGFWLAFLLPTLMFLTTPFVMWWGRKRYRQSDPAGSVTYKAVKTFWFCMRGRWHYNPY
FT                   ILWKRTHDGTLWDTAKPSNIEPRLRPKWMTFDDAWVDEVRRGFAACAVFCYFPVYWLAY
FT                   NQLTNNLTAQAGTMTLKGVPNDVVNNIDPLALLIFVPLCDTLLYPGLRRMGIQFTAIKK
FT                   ITLGFWLASLSMIWAAIIQYYIYMTSPCGYRANNCYNDDGSVNPSPLIVWAQTGSYVLV
FT                   AISEIFAVITSMEYAYSKAPRNMRSLIQAINMFTNAISAAIAEALITLSRDPLLIWNYA
FT                   VFAILTFVGGTLFILQFWGLDKEEDELNNLPEGHVEASQTQAEVEHVENGPGRG"
FT   CDS_pept        join(675331..675373,675490..676162,676216..677416)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000189547" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943399"
FT                   /gene_name="plb1"
FT                   /orf_name="Pc18g02900"
FT                   /product="Lysophospholipase phospholipase B plb1-
FT                   Penicillium chrysogenum"
FT                   /function="phospholipase activity"
FT                   /biological_process="phospholipid catabolic process "
FT                   /protein_id="CAP94514.1"
FT                   /db_xref="GO:0004620"
FT                   /db_xref="GO:0009395"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI0001831A9C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB59"
FT                   /transl_table=1
FT                   /translation="MKTFALISIALGLPGAIAVPGALDTDDITFAGVQRALPNAPDGYV
FT                   PTSVSCPASRPTVRSAAKLSTNETSWLEVRRGKTLSALKDFFGHVKVGDYDVGAYLDKH
FT                   SGNSSSLPNIGIAVSGGGWRALMNGAGAVKAFDSRTDNATATGHLGGLLQSATYISGLS
FT                   GGSWLLGSIYINNFTTVDKLQTHEAGSVWQFGNSIIEGPDAGGIQLLDSAGYYKDLADA
FT                   VDGKKKAGFDTTLTDIWGRALSYQMFNASNGGLSYTWSSIADTPEFQDGDYPMPFVVAD
FT                   GRNPGELVIGSNSTVYEFNPWEFGTFDPTIFGFVPLEYLGSKFEGGSLPSNESCIRGFD
FT                   SAGFVIGTSSSLFNQFLLQINTTSLPSFIKDVFNGILFDLDKSQNDIASYDPNPFYKYN
FT                   EHSSPYAAQKLLDVVDGGEDGQNVPLHPLIQPERHVDVIFAVDSSADTDYFWPNGTSLV
FT                   ATYERSLNSSGIANGTAFPAVPDQNTFINLGLSTRPSFFGCDSSNQTGPSPLVVYIPNA
FT                   PYSYHSNISTFQLSTDDAERDNIILNGYEVATMANSTLDDNWTACVGCAILSRSFERTG
FT                   TTLPDICSQCFDRYCWNGTVNSTRPESYDPAFYLADNSMASVSLPTMLSTVVAAGLAML
FT                   ILV"
FT   sig_peptide     join(675331..675373,675490..675500)
FT                   /gene_name="plb1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB59 "
FT   mat_peptide     join(675501..676162,676216..677413)
FT                   /gene_name="plb1"
FT                   /product="lysophospholipase phospholipase B plb1-
FT                   Penicillium chrysogenum"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB59 "
FT   CDS_pept        join(678438..682642,682698..683262)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189548" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943400"
FT                   /orf_name="Pc18g02910"
FT                   /product="Pc18g02910 protein"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP94515.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="UniParc:UPI0001831A9D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB60"
FT                   /transl_table=1
FT                   /translation="MARAAVIPEYPAKRVGRASTKSTAAADAKKKAPRRATPAARAATP
FT                   SVDAESDDELGFITSKPAKPSARPPGRPATKPKATSTATARRKKAAPESLADKPKPRNN
FT                   ASEDELEQQTEVPKKRVGRPRKNPLPAEAPATKPEAAPKTRGRPRAGTTAKAPQTRETA
FT                   TTGRRTRAAAGTADETKSTQIRIATNSTTMRSNLLRGPAKKKTVKFQDVSDSEAEEVVP
FT                   EVPAAGRRRVATKGAGAGKPGLGATPVRKPATTGTRGRKPAAAKKDASQPLSPKKAKQV
FT                   AKSLSSYASSDGEDDELNTIKDDTKDPVRLVVHSPVKHGSETTGLSSPVRRINFTPKKA
FT                   SSFMDENGDPKLPSPKHGSDGIGLNSPVRKINFTPNRSQNAVADNGHLALPPGNSVVFS
FT                   DSMIMSSPARRPAPSSPFQFSMRETPNRGGLFRDSVNPISAPDFTPGRTSPLKMSPKKG
FT                   FLGASFLQSPSKDSTSAAPARTPLFQSPAKRIASPFKNSIFSAHASVGSCKATDNGGAS
FT                   YETVEPTQPATPKSLPRESQPDEAAFEKDTEMVEDVARDIFGIELSSARKASSISPIQE
FT                   DIAASGVARDSFDDGNTDSLSPEVEAEGESDMEEDEIEYIQDETQPEYEEPETICFDVM
FT                   EEANMATEDDLYDQEPQENSGPGASEQLEDQAQFDREEDDTICFGAMEDAQLAVHNLHD
FT                   QQVQEASDPEEGEDRQDESESEFEYEELETICFDKMEDAELAANDLHRQQVHEASDLEE
FT                   GGDFHDEDEFEYEEPETICFDAMEDAHLAENDLHDEEGQVGDSVMEDTNYPEEELAVPE
FT                   HEIEVEEPQYLDTGSQSEESTADASQTTEMQELDMEEQPSAVASPSTLPLHLTRGDEAQ
FT                   PSAPLDYSSESEREWQEEAIHQPEEVEHVLSEDNEMEETEPEFATISSKPASSHESGHV
FT                   EDIATPPQRTQATPSPRPSFTGSESIRLALNRPDNSENDYDSTPDAKNASNVIVDTPLH
FT                   EENSWTPKTQIDSPALMAPSLFNTPSVADQSQPHAEASLGFTPLAQRFDRWEQNTPSQA
FT                   RSLRPRRRGVFSLVGPLDRTNTGPPTNSESVSYPDLTKSPLAQNPSLFAESPLQPQSND
FT                   TCISPEYERTPRRSSIYEDHQVIDSPRTSTDIFEDPDSGVIEQEHTSAAEVPQDQDQES
FT                   HLLEDKENLGPSILPSTPMKAQIQPDELRTIHTVSKVPLKAEGDVSPLKLSRKRGLSLS
FT                   STSPTRSSPRVRKPTLMALNDTVPILSPSRKSPRVSRSPTPKRRSITSRRISVKAPVMA
FT                   ASNTPVATGSPAKKQRRSISTEQKALHGAVVHVDVHTTEGEDASGIFVELLQQMGARCV
FT                   KSWSWNPRSSLSPADDVEPKDLRVGITHVVYKDGGLRTLEKVKKAAGLVKCVGVGWVLD
FT                   CERENQWLDETPYAVDSSIIPRGGAKRRKSMEPRALSNVNGTLVRISESPAPSAGGRRS
FT                   GVNPGAVEGFRKITPPTHQREMPSTPPQQSSADSYQFPATPGYNFANLDAIGMSPATPG
FT                   FLGNRSKLVQQSCPPKQSNRGLFPSAKPASIMLDDGQDEESRRQRRFRMEAARRKSLVY
FT                   KPAVGSPLAP"
FT   CDS_pept        join(complement(685212..685233),complement(685042..685151),
FT                   complement(684927..684990),complement(684780..684872),
FT                   complement(684673..684724),complement(683583..684621))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000242917" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943401"
FT                   /orf_name="Pc18g02920"
FT                   /product="Pc18g02920 protein"
FT                   /EC_number="2.5.1.54"
FT                   /function="3-deoxy-7-phosphoheptulonate synthase activity "
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /protein_id="CAP94516.1"
FT                   /db_xref="GO:0003849"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="InterPro:IPR002480"
FT                   /db_xref="UniParc:UPI0001831A9E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB61"
FT                   /transl_table=1
FT                   /translation="MAEWSPSSWTQKPIKQDVIYEDLEGLKESLQKLQKLPPLVTTREI
FT                   VNLKKNLRNVALGKAFVLQGGDCAELFDYCTQEMIEAKVKLLLQMSLVLIWGANKPVIR
FT                   IARIAGQFAKPRSSPTEVVNGVEMPSFRGDNINGFAADPVSRQPDPSRLVSAYFHSAAT
FT                   QNYLRASLSSGLADLHSPLDWGLGHVITPSIKEQYAKTVGAVKDALRFMHTVGIDKDRG
FT                   FETADIFTSHEGLSLEYEQSLTRLLRHPVQQGTSTTTPETGYYATSGHFIWIGDRTRQL
FT                   GGAHVEFFRGIANPVGIKIGPSMAPDELVQLLDVVNPDSEIGKVTLISRYGASKIANFL
FT                   PGHIAAVQASGHIPVWQCDPMHGNTQSTPSGVKTRHFTDILSELKQALEIHRAAGSFLG
FT                   GMHLELTGEAVTECVGGAAGLTEDGLGERYTTFCDPRLNEKQALELAFLVAGFYRDESQ
FT                   E"
FT   CDS_pept        686798..687472
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202757" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943402"
FT                   /orf_name="Pc18g02930"
FT                   /product="Pc18g02930 protein"
FT                   /protein_id="CAP94517.1"
FT                   /db_xref="UniParc:UPI0001831A9F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB62"
FT                   /transl_table=1
FT                   /translation="MQYKALATLFFAATALAAPADSTSTSSSPEFVDSNDLYDDYIEDM
FT                   YDDIYEAVPSSILTVLATAIPATWYNDLFDPASRDSIVSEAMAGTYPAWYNSLPSSVKA
FT                   WATNEAFIGISATATQTETADGSTFKTGSTAAASQTSFASETSVASQTPAKTTSASTTS
FT                   SSSSSQSSSQFSSESSSDLSSSSASSSPSPSQSTGGAPAPTGGITMGVAGAAGVLALAL
FT                   AL"
FT   sig_peptide     686798..686848
FT                   /db_xref="UniProtKB/TrEMBL:B6HB62 "
FT   mat_peptide     686849..687469
FT                   /db_xref="UniProtKB/TrEMBL:B6HB62 "
FT   CDS_pept        complement(688074..688490)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943403"
FT                   /orf_name="Pc18g02940"
FT                   /product="Putative uncharacterized protein Pc18g02940 "
FT                   /protein_id="CAP94518.1"
FT                   /db_xref="UniParc:UPI0001831AA0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB63"
FT                   /transl_table=1
FT                   /translation="MSTTDIPSSDAVSTWEQAYHDAWRHFHGCIEEILSRLTWDNPSPE
FT                   DRQVTIEKLGRLTIEIDNIRNLGQIMFEHVPGCETIRERPLAYFVTDFIRECNAMNYKI
FT                   NMLTWRLLNRQNSERLVHSRLFRLLESVRDRAPA"
FT   CDS_pept        join(689918..690226,690291..690401)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943404"
FT                   /orf_name="Pc18g02950"
FT                   /product="Pc18g02950 protein"
FT                   /protein_id="CAP94519.1"
FT                   /db_xref="UniParc:UPI0001831AA1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB64"
FT                   /transl_table=1
FT                   /translation="MSDTIPSASAGQDTVENAIPSNAEDRKAAAALSSLNTNEIATEGA
FT                   SAGAPLTVNQEALGRAMSRLEIAAGQDSGNKKTAEGPKTDEVLKKKTVKVAPADVTLLV
FT                   DHLDLSKTKATDLLKAHDGDVTQAMKAFIAPSMRV"
FT   CDS_pept        join(complement(691831..692549),complement(691531..691777),
FT                   complement(690573..691478))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189570" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976512"
FT                   /orf_name="Pc18g02960"
FT                   /product="Pc18g02960 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP94520.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831AA2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB65"
FT                   /transl_table=1
FT                   /translation="MGASPQTPNHGQDLEEDRENVHLASQDASNLIGHHADSSSTESDT
FT                   DLESDDTVIPQSDSRSRRLEFAPLMTNHRRFPSINEDDRDHDHDGVLGPADGDEEKPVT
FT                   WSSLPKKGQLAILTLARLSEPLTQTSLQAYMFYQLKSFDPSLPDSKISAQAGILQGSFT
FT                   AAQFITAVWWGRLGDAEWMGRKRVLLIGLMGTCLSCIGFGFSRSFATAMVFRTLGGILN
FT                   SNVGVMRTLIAEIIAEKKYQSRAFLLLPMCFNIGVIIGPILGGSLADPVNSFPQLFGPG
FT                   SLLGGKEGVWWMQRWPYALPNLLSAIFIFASFLAVFLGLDETHEIARYRSDWGRKLGKR
FT                   ITRAWTRRPRHYRPLTRSRDDGSIYTDGSVGTWSTPSSPARSRVHPRPRKKIGFRQIWT
FT                   RNIILTLVAHFLLAFHTSAFNSMTFVFLPAPRAPENSRQGLFHFGGGLGLPSSRVGLAT
FT                   AIIGFIGLPLQIFLYPLIQTKLGTLTSFRTFLPFSPIAYMLMPFLVILPRVPWIVWPSF
FT                   TFVVSLQVISRTFILPAAIILVNNCVTDPSVLGTVHGVAQSISSGARTLGPFLGGWGLG
FT                   LGLENNMIGAVWWALAVEALLGWAMLWSIYEGKGIERKKDEVEGDEE"
FT   CDS_pept        692901..694548
FT                   /pseudo
FT                   /gene_family="HOG000234520" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(694731..694900,694941..694976,695076..695687,
FT                   695769..696051,696107..696307)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943405"
FT                   /orf_name="Pc18g02980"
FT                   /product="Pc18g02980 protein"
FT                   /protein_id="CAP94522.1"
FT                   /db_xref="UniParc:UPI0001831AA3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB66"
FT                   /transl_table=1
FT                   /translation="MGHSHLNSITTIIHIGTCEIDAENNSLSRNGRFPPVALDGELYCT
FT                   AAYSAEDTILARPKLTEAPTGDAEYLGSSQTCSSSPAFQLSTSLSPHLHVSSSLHHFHH
FT                   PLNQSRRVSTPSIMSSQPVNPPVLQDHDALRKMFEEKADSILEWLESKSQVSYDCDTLR
FT                   EIGVLLHHMDVTDDQESLDFKLLSEKEYSTYKIDSARMPNHVRHHYDGFDEAFHSSFSY
FT                   PLSDPLPATELVYQKAFQIARYIHILQDYSKKDDPDNSYSIEKNSNWYEILAEDSFEDG
FT                   PQGMLYGLHIGHSKPLDLSRWRALSSRQWQEDPEDLDTIRPHVMLMICTGAVAKSNNLL
FT                   HGEIGPIINTIQCRLLQEEFKQTSSFPVLVISLFGPRQGRILYARFNIDGTLIVRASDI
FT                   FDFEKKNQEGFDLFMRYYNCQPEDIPYSLPLIRP"
FT   CDS_pept        join(complement(696925..697197),complement(696562..696720))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943406"
FT                   /orf_name="Pc18g02990"
FT                   /product="Putative uncharacterized protein Pc18g02990 "
FT                   /protein_id="CAP94523.1"
FT                   /db_xref="UniParc:UPI0001831AA4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB67"
FT                   /transl_table=1
FT                   /translation="MMFQVEARGEGDLIGPACFVLTGLQSGTTKGTRVSSVPPLRLAPI
FT                   RNTNRNLFATSSRSCSGITRAEAVRANRSGFLLARSEGNGQDQLRESDRYPLFSRQLRI
FT                   LCGTAVVWWNLKGRVISLVLVVLTGVTIYETGSNMGFSV"
FT   CDS_pept        join(697250..697492,697554..697883,697947..698333)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000283048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670533"
FT                   /orf_name="Pc18g03000"
FT                   /product="Pc18g03000 protein"
FT                   /function="carbohydrate binding"
FT                   /function="isomerase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP94524.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniParc:UPI0001831B6B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB68"
FT                   /transl_table=1
FT                   /translation="MDRSNKPSAIGVGASLPQPTLSIKDNVVEASLPTGQSVAVHLYGA
FT                   TVTSWKTGGQEQLFVSETAHLDGSKPIRGGIPVVFPVFGPPPQNHATSSLPQHGFARNS
FT                   NWEFLGKSSSEAPGRDSDQTDLTVKLDFGLSHSMLTDEFRAAWPYEFGLVYSVTLTTNS
FT                   LETALQVRNEGQQNFEFKVLMHTYLSIADISDIRVKGLESKTYVDKTLQGTSHTESSPA
FT                   LAITQETDRVYQQLDPAVPIVVASAKDDQPLFSITREALTDVVVWNPWIEKAKGMADFG
FT                   PDEAYKNMICVEAGSVSAWQTLEAGEAWEGGQSIKSRL"
FT   CDS_pept        join(complement(700209..700369),complement(699519..700147),
FT                   complement(698614..699461))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943407"
FT                   /orf_name="Pc18g03010"
FT                   /product="Pc18g03010 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94525.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniParc:UPI0001831B6C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB69"
FT                   /transl_table=1
FT                   /translation="MVFSKQPSADTEKPAKHDAAMDEVRLESALGHKQELSRNFGLWSL
FT                   TSLGIVIANSWASTGGTIVAALQNGGPMAVLYGLILVSVFYTAISASLAELASSMPSAG
FT                   GVYYWSSVLSRKRGRTVGFFTGYLNACAWLLSASSMSSMLGNEAVAMYLLNYPTVKWHS
FT                   WQVFIVFQIVNWTCCAIVCLGNRFIPLINRVALTLSMCGLVTTVVVLTVMPKKHASNAQ
FT                   VWTEYHNNTGGWSDGVCFMTGLLNAAFAVGVPDCISHLSEEVPKPEIKVPQGIMLQMLT
FT                   AFVTSFVYLIALFYSIQDLDAVFENNIGFFPTAEIYRQATGSNAGAIGLIAVLFLATFP
FT                   TLIGTFTTGGRMWWSLARDNATPFANYFAQVHPTLHSPVRATVGMSALVTCLGCIYIGS
FT                   TTAFQALISSFIVLSSLSYFGAIFPHVLSGRGNMVPGPFYMGQKLGMAVNIVSLVYILV
FT                   TVIFFCFPLVLPATVQNMNYTSVIVVGLMVLTAFWWVFRAKRQYHGPQYSFEAAEQLAA
FT                   CQEGKEGRRSFIDAVGVSPDGIEDGNDS"
FT   CDS_pept        join(complement(703790..703900),complement(703461..703608),
FT                   complement(703078..703146),complement(702563..702648),
FT                   complement(702406..702515),complement(702108..702310),
FT                   complement(702022..702083),complement(701849..701941))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670534"
FT                   /orf_name="Pc18g03020"
FT                   /product="Putative uncharacterized protein Pc18g03020 "
FT                   /protein_id="CAP94526.1"
FT                   /db_xref="UniParc:UPI0001831B6D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB70"
FT                   /transl_table=1
FT                   /translation="MASEKSWFGVGDTSPILEDKATSAMQAARELYKQVFHQGPGDGFK
FT                   DANRDRAVASWVLAREMSVQADKQGRMGRRRKGLFPSKRQSVPPMHVADSFGISMPRAR
FT                   TNSLTGSSLIATQPYLITSESTGTTLDDRLRIKPTKHLHAVDSQTRVAFGRIVWSRFER
FT                   RLEVQSVISAKRTDGCAYKVETLVYYRGRMLGWHCSYTLHVNAISGRLELATCKAAKAK
FT                   ILRSRKWWNTYSGLFPVLSEVQRYTEDNVVNGIGVTIVGLKLSLSNDHCRMGDDWELRH
FT                   CVRDPRMSRIFS"
FT   CDS_pept        704204..705211
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187054" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943408"
FT                   /orf_name="Pc18g03030"
FT                   /product="Pc18g03030 protein"
FT                   /protein_id="CAP94527.1"
FT                   /db_xref="UniParc:UPI0001831B6E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB71"
FT                   /transl_table=1
FT                   /translation="MLVLIQISARYATNLMDPRDYDEVLADPKQVRDRIYGSKIVIGLE
FT                   QCMLISTWGVKTCMLMLYWRITQNLKSNFYIKILSIYVAIGFVVIMVTYYAVYCRPFSQ
FT                   YWAMPVENMQCATYQHYSITQAVFNISSDAVMFAIPIPLLIKAQLKRRRKVVLIGVMSL
FT                   GLFTIIAAILNKYFNFASPLTTTYQIWYIREASTAIYVANLMCWWPLLRKLFGVKAFQY
FT                   NSNRAQQPGNPDNQNNDSNGSYSNNSQPRPSFAFPRSWRSPFRLGNKSTTPGKYIGDKR
FT                   SSTEPINRYNDEFGNDTHRVDAVPLENWTAKGHLRTGTSTTKGSLNSLEKQCDV"
FT   CDS_pept        complement(705879..706376)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823310"
FT                   /orf_name="Pc18g03040"
FT                   /product="Pc18g03040 protein"
FT                   /protein_id="CAP94528.1"
FT                   /db_xref="UniParc:UPI0001831B6F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB72"
FT                   /transl_table=1
FT                   /translation="MSGGAFQEVSYLRFFVLITKTLLLQSTTDGIYDQVSLPILLSDSI
FT                   ATLDTYMPEFNRPPLLVKSAALAEWSVCQLCPLAVNASGISTAQTLLRLIWHHLRRYQA
FT                   RLATSYIQPAAQIINDLRNCLSTAPNSGDHTPLKVFMEHDCSYQQEHWSSIGNRLSAKR
FT                   DL"
FT   tRNA            707210..707290
FT                   /gene_name="tRNA-Gly (CCC)"
FT   CDS_pept        join(complement(708058..709647),complement(707577..708005))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076709" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127604"
FT                   /orf_name="Pc18g03050"
FT                   /product="Pc18g03050 protein"
FT                   /function="neurotransmitter:sodium symporter activity "
FT                   /cellular_component="integral to plasma membrane "
FT                   /protein_id="CAP94529.1"
FT                   /db_xref="GO:0005328"
FT                   /db_xref="GO:0005887"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="UniParc:UPI0001831B70"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB73"
FT                   /transl_table=1
FT                   /translation="MVLAQYLKKAVAWIAPTPQKSEDGRDQWPSRAAFLLAAMGGCAGQ
FT                   GNLLRYPSVVYNNYGLQWFIPYLLAVFAVAIPALILEISIGQAYRGGTVIAFNNINHRL
FT                   KGVGMGPILVSFVVVQYFTVNLAWIMNYFRNSFRSPIPWEGRIEEFYMGNVVANIDPVV
FT                   GNLTAGNGAVAHYTVYPGVALIGETVGWSAFIWFLIWISIFRGVGLTGRVVYWTMGLPI
FT                   VTTLIIVGRSCSLENASEGVRLLWATWRGDQLASGTVWQTAVGQVFFSTGIGFGYFTSY
FT                   ASYNSKHSNAVMDAILICGSNILFENVAAFAVFGVVGYLRRWPQDGERLGAFVVGFLTL
FT                   PEAVLHMPGANWWAILLFFTLVVLGFSSAFVMLDAVATLAVDSGVKMSRPMIVTSLTIL
FT                   SFLMCLPYCTQFGFYLLDGIDRWINNVALIFVVWSELVGATTVYRWHDVVSQTGLPAFA
FT                   VYNFGYFGGQIAGVAVAHGTSNPAAGAGAGFGLYIVCSTISVLVATTPDIRAASFWGWN
FT                   PFLSRFWYLAFYSGNQLRRDLNAVVGGNGNWNIPRFWPILLRYVSAPVLAIVFSFAYPE
FT                   FYTLRYDPMMIAGFILAHFCLLLILLGLVFPRYYNVFIPPGRRTEGKEETTANQPKEQE
FT                   LLPEVGVLDCETGMQELVSGRKSSDGIDTGHSKVPKL"
FT   CDS_pept        complement(710413..711537)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250278" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976513"
FT                   /orf_name="Pc18g03060"
FT                   /product="Pc18g03060 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94530.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI0001831B71"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB74"
FT                   /transl_table=1
FT                   /translation="MATPGTQYMMQAGLAAGMSGTEGMHPPHAKPVDPHLSDPVNMLPA
FT                   DLTPDSKSRIALRGVNGKEVLVPYLSIGAWSWGDKTTFNYNPTRDLPRIHAAWEKLKSV
FT                   GLTFVDTAQSYGDGESERICGTLFRDMPRDSFVIQTKWLSTPDMTNTLMQAGGPKSKLK
FT                   DSLVRLQLDYVDIYLVHGPIHPSNISTVAKGMAECVQSGMARAVGVANYDTKEMIKMAD
FT                   ELAKHDVPLSVCQCEYSIVRRLPEVSGMIRECRKRSICFQGFASLAEGRLSGKYSRLNW
FT                   PQQSRRFSSYPMHLLEPTINVLKSIAEQRHVPLPAVALNYSINKGVLPLVGVRDAGQAE
FT                   QDMQALGWRLTEDEMKQIEGVSLQGGRSAFMQHG"
FT   CDS_pept        complement(712093..717327)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189659" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976514"
FT                   /orf_name="Pc18g03070"
FT                   /product="Pc18g03070 protein"
FT                   /protein_id="CAP94531.1"
FT                   /db_xref="InterPro:IPR022031"
FT                   /db_xref="UniParc:UPI0001831B72"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB75"
FT                   /transl_table=1
FT                   /translation="MVEILSARPPTPPRTASRIVIENTESPVTVQTPKEPAFSALGSVE
FT                   AAPSSRSSKKVNFSPWPKYIKPPTFASAMKSAPDVKTIPPSPNSKPTKSILKATQSPIP
FT                   VWSPNVDTFTTESLAMLLESVIQQLAGESMSSRLDAYMQFFGALRTYDGLPAGQKIAEK
FT                   LNLITEFIQRDVNRDLANGSPLDTNLANQALKLSAAFVWHPEISTQLSEEFKMFLVDHS
FT                   ITCLYEAKAPKSVLTHYMSILATQNFGPKIMTGARVARLLTVLQEITKNITGNAIVSHR
FT                   LNIYQRLLGQAKSAFISQASLWMEHLIFALLHHLRDTRSKAIALGFQVATEAGPNPILS
FT                   KNIRDLFDRPLEHDRRLVSEVRERMTRMMATVDSGEHVPQIWSIIILLLRSKRWNLEQW
FT                   GHFKEWVLVLQKCFNCSEPVIKAQAIVGWNRFVFAVNPNESTSRYLLKMLGKPVLSQFD
FT                   RKKTDKSGAPPTQLALTSYYNLLYYTFRPSASYQHLDVIWEEYVVTPSSGIFSSVPVLS
FT                   DCLSRILTNLLWSAQAKIWIENRINDNTKMEAEELPAADSRWVRSRITSILKVFEHLFK
FT                   ASVWVDDAVGQSHVALAWNSLSNALSLASSKEITPSGESMQAVASIWSLLHRLWTAGPP
FT                   SLNADDTDIFFERFRFLSTTMIVSIGGIPFTEKLLLRNADESDNISAHSHPNTTQESAI
FT                   LHLLRIISSTAGTIAPSESYTHLVLGNIEAACNGRFSRGSRLELLQQCAELSTTETSAI
FT                   PCAVQLSEVVWNATAQAAADALQSFPMESARGRDGSVSRDYENVIKILSFGLSFASAFK
FT                   EWSHLLETFVRVVRTEKGNQAVANMIVEPMAERLMHLSAENTYLPSTSLLGHSLSIPFM
FT                   QGTGLGIDRSGIQAAGHTIFPHKLLASVAQTLHGAYDNFNASQSYGLADFIEALTSFLG
FT                   TGVPQFQCQILQCLQSSLGLWLKDETHKIHVDRGVDSRILTACRALSSATINILQTSVS
FT                   HDLPALKIFEPILCAGLESSHVSTAKRYVELWGLTFGSHSFAMPVTVLQAVQTAESRVQ
FT                   TATLPPQDGDQDTDMLPPPPQDELDQPLHQPSQDTQLSSPVVRTEDSSLVLKPTEQFHE
FT                   PQLPSNILQPTDAQIVEGISMSHKRKSHREMFSMIESLQSSSPASTPRKLGFNTPPHLR
FT                   KLHGGSLAEIPLTPTLAPTENEEGFIGSSPTPGTRDPTPAMNSDALTSSHQPADLGIDP
FT                   PSSPPEMQSRSPSPRKPRSKSARRRAAKARKALVGTSGKQSTVNSPATSRLATENIDTP
FT                   MSDAHDYDNDNTNATPRANGITPSRRLRSGLGKGSDTADTADTADTADTADTPGPSLAP
FT                   LVDSDKTPVQQPTRKSKLSSSSKKKRKQSQSKPADNQLLQARDMPPDILPDSFMDSSEE
FT                   TESQIASQLGQDLELAVDMDDRDHLEQAKLTDEPSMKKRKRDQEEPSSSVRTDRRRSTR
FT                   LSMAKDVVNVESLQPDASHSHRANSQPVSPATSLSPTATRRSTRASQRKGGGNAPTDSI
FT                   PATQDLVAQESTQDGETPRPSKRSRKSSRLEDQSVSAAVDSTPKSVPRDTRSRKMRSQQ
FT                   HASEASQPQPSSIPSEEHGDTEDLPPHVGLDMVPESLITEDQAKQNTSIVSTEEATASQ
FT                   VSEMEQAIEPAVKPDTEMDIDMDGVQHGGIVEQTTSVATTGTQTQETHPEPKSDISERG
FT                   VVQSLKNLLGEMEMATLSPSAFREVDDLLFKLRCEAQNASTRHNTSA"
FT   CDS_pept        join(718083..718110,718179..718253,718318..718394,
FT                   718461..718619,718674..718793,718844..719685,7
FT                   19742..719841)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216872" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943409"
FT                   /orf_name="Pc18g03080"
FT                   /product="Pc18g03080 protein"
FT                   /function="binding"
FT                   /protein_id="CAP94532.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019318"
FT                   /db_xref="UniParc:UPI0001831B73"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB76"
FT                   /transl_table=1
FT                   /translation="MAFLQMQGTAKLQQVTQLLKSLEEDIQENNLSTADRIQTLLQLRQ
FT                   HGTNPTNAEPIYSQNGINTLMRYGVEGETPDVRRAALRCVANALLLDPKMRQAFVDTGY
FT                   SGKLAEKLKTEDSEDEMVTSRILFYATYNTTLDFKDLIKSHALGDNINYQLSRHAKQFP
FT                   KSGRRPLSQMDELALSDTLKLVYNISKIFPDLGPEFSPSIPHILKIICRIDIPAKPLDG
FT                   LVGGLLNTLSILDLEEKKGKIFESSPLFPAFDNNCNVDKLVSILDQATSIYSPTELEAN
FT                   AVPLLYSLIAIYEVAPDGPRKHMQSLLLPEDTDRSLPIGQSDTLSSRLLKLSTTHFANL
FT                   KVTISELMFVLSGKDAEKLTKNIGYGFAAGFLAARGIEMPQSATEASSAKDGPDTARNP
FT                   ITGQRWAAEPQDTGPPMTMEEKEREAERLFVLFERAKANGLLNVENPVTQALHEGRFEE
FT                   LPDDTDSD"
FT   CDS_pept        join(720230..720274,720335..720359,720445..720763,
FT                   720820..720877)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670535"
FT                   /orf_name="Pc18g03090"
FT                   /product="Pc18g03090 protein"
FT                   /protein_id="CAP94533.1"
FT                   /db_xref="InterPro:IPR008476"
FT                   /db_xref="InterPro:IPR021148"
FT                   /db_xref="InterPro:IPR023139"
FT                   /db_xref="UniParc:UPI0001831B74"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB77"
FT                   /transl_table=1
FT                   /translation="MSKPFNPEEAENLEDMEKQFAVKAVEHLMTYWAILEKVKGSQLRL
FT                   TKQDDDIYNSFMEAFPDFDPAGTLVEDEMKSKAGKEKWRNWMMKWNKIDDFNFGTMIRT
FT                   RADAEYDQDTTIFGVRMQFYAVEIARNRAGLNDWIYEKAQKASS"
FT   CDS_pept        join(721682..722139,722196..722859,722915..723746,
FT                   723909..724874,724929..725051,725101..725987)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189615" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943410"
FT                   /orf_name="Pc18g03100"
FT                   /product="Pc18g03100 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94534.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0001831B75"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB78"
FT                   /transl_table=1
FT                   /translation="MFTKRKTSDSSDTNKQNIPEGNPGWKSLFGFTTRRHLPTLIFGSI
FT                   FALVASCVTPALAVFLGNVFDSFTSFGADQIDAKGLHGQVITSCLGMIGLGVAGWFLNG
FT                   AYYALFVAFGEMQASVIRSQVFLELLNRDVEWFEAKSEGSGALLSGIQAHIHEMQMATS
FT                   QPLGLVLQYSCRSLASLGLGFYTSWSLSLVTLAGIPIFSAIIGFLSSKMKFSITAQQAE
FT                   LTEASKVANNAITNIDTVKCLNGQAFEHRNFSERIERSASHYLRQARLNSLQIAFIRWM
FT                   MFGMFVQGFWYGSSLARTGKLTSGEVLRTFWACLTAAQSIEQVLPQMIVMEKGKVAGAA
FT                   LKSIIQSRREDKIVSEAKATRYPEHCEGDIEVKNVSFSYPSQPDQCVLKPSSFFFPAGE
FT                   TTFVIGKSGSGKSTLSQLLMRFYLPTSGEILIDGTPMQQLDINWIRNNITLLEQKSVLF
FT                   NESVLTNIAFGRQDHATVTKQDVKEPIELAMLENTIDGLPKGIYTCVGPGGSFLSGGQR
FT                   QRVAIARAKLRDTPILILDEPTSALDHTNRVAVMKAIREWRKGKTTIIITHDMSQIMEQ
FT                   DFLYILEQGSIVKSGYRYAVEVSPGSEKYFHAKVDGGPETKTQNKRALDDMNIPWESSS
FT                   SESLDTLRPPTAFLGHQGPGPQWASKEPAIQIPTEEVEMVYIDDQSSRSDPSRMKRSRK
FT                   PHGRRKKSKEQQIPKERMTPLSQIMGTILSTLTTRQRIILFLGFAAALAHASATPIFSY
FT                   SLSQLFGTFYAGKKSEHLAMTWSLAVLGVSFGDGLASFFMHYFLELCGEAWLDSFRKNA
FT                   FQGILDQPRAWFEKDGNGSLRLTSSLDQNGEDMRNLLGRFAGYVVVAAAITVMAIIWSL
FT                   IVCWKLTLVALSCGPVIYVITRGFEGTNGLWERRCNDANNLAADVFTETFSEIRTVRSL
FT                   TLEGHFHRKQANAIARCLLLGLKRAIYTGMLFGLVESTVIFSSALIFYYGAVLAASREF
FT                   NVDDVMMVFSMLLFSIGYAAQILSWIPQINTSREIAAQLIRLSKLPQDGSHEHLGSLTV
FT                   SNLTPIKLTNVNFRYPSRPNTMVLKNVSISIPRNSCTALVGRSGSGKSTVASLLLSLYE
FT                   APASETGQPTITLGGADILRLHVPTLRSQISIVSQQPTIFPGTIQQNISYGLDQHSPLA
FT                   SSHSVRTAAQGAGIDDFISSLPRGYNTVIGDGGVGLSGGQKQRVVIARALLRQPQILIL
FT                   DEATSSLDPAGAEIVRQTVQQLVAVRQGLTVIIISHAKEMIEIANHVVVLDQGAVVEEG
FT                   PYQALAKMNGGKLNALLSDPEEVGG"
FT   CDS_pept        join(726396..726797,726866..727222)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000133453" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943411"
FT                   /orf_name="Pc18g03110"
FT                   /product="Pc18g03110 protein"
FT                   /protein_id="CAP94535.1"
FT                   /db_xref="UniParc:UPI0001831B76"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB79"
FT                   /transl_table=1
FT                   /translation="MSKPTLIFAAGAWYPPTIFDPIIKQLTDYTCHSVSFPSIQQASSV
FT                   VDLQPDIHAVRSITQQEADAGHDIVIIAHSWAGLPVSSALDGLSKSEREASNQKGGVVK
FT                   LIFIAAFLPSIGEGLIGAFGGMPPPWYVRDEEKGTVTASDALVLFFHDVVDGAEWVKLL
FT                   KPHSWATQNAPATGAAYMNIPSAYLLTEEDRATPVPVQQVLVERARRRGAQIETETIKT
FT                   GHTPWLAMPDQVVAYIKKHAGESGGGTSSS"
FT   sig_peptide     726396..726452
FT                   /db_xref="UniProtKB/TrEMBL:B6HB79 "
FT   mat_peptide     join(726453..726797,726866..727219)
FT                   /db_xref="UniProtKB/TrEMBL:B6HB79 "
FT   CDS_pept        complement(727418..728698)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000253368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823311"
FT                   /orf_name="Pc18g03120"
FT                   /product="Pc18g03120 protein"
FT                   /protein_id="CAP94536.1"
FT                   /db_xref="UniParc:UPI0001831C4F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB80"
FT                   /transl_table=1
FT                   /translation="MATLNFELKNNTGSNTVYAYITGQALDNNNALFLLRSDGKTPYYP
FT                   TSPPATGTDLSEDCAIPLGAPGNTTTITIPHLAGARLWFAQDNKLTFYLNPGPALVEPS
FT                   VSNPADPNYNLRWAFCEFTWNDFQLYANLSYVDFVSMPIAMTLTNGAGATQTVKGLPPN
FT                   GLDLVCDALKEQHSKDNAGWDQLVIQKDGVNLRAVSPNTGRTLNNSLFNDYYKSYVDEV
FT                   WAHYSTNNVLTVNTQADAGDVAAKVASDVLSFSVPDVSYVKPSTGDIFSNSTGSFAVSG
FT                   NGTKDAITARLAAAFNRSTLLINGNQPNGETVSNYYKNPVTNHYSRICHSVSIDTRGYA
FT                   FPYDDVAPNDGPDQSGSVFDGNPKLLTVTIGGGPSNSVKKSAVGVNAMPVQQPAENGQS
FT                   QENGRKPSRFHELRSFMDKLTHRKSST"
FT   CDS_pept        join(732761..732820,732868..734139)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189593" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943412"
FT                   /orf_name="Pc18g03130"
FT                   /product="Pc18g03130 protein"
FT                   /protein_id="CAP94537.1"
FT                   /db_xref="UniParc:UPI0001831C50"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB81"
FT                   /transl_table=1
FT                   /translation="MYIPQKRQNAQTNKNNIFIICAVSIIFAIALCVGTFFLFRYLRQR
FT                   NYQPKYLPGKYLKRKWKEWSPGSASYGQVPNQTGQDTSYRGAGTAPEMQSTDGVRRDTS
FT                   IRSIMTLPPYSQSPKPTEQVIAREGERAGMDMVVEYPETAEEQESRREEQMDAMYQIRL
FT                   QRRQELADREARRRERREARARGDSARLEQLNAETRARTQRRRAGTNSAADVSALLAEH
FT                   QSRERDRRISSVSYAELGRVRHDGSRLRADSHNSDFHDSDSRPLLQSDAVSSAAPSFEP
FT                   SSLDSRGQSIASSIMSEPHHSTELERLTLAPTTTHGSSRPVSQTDDGDLGTLNIPPPPD
FT                   YEHLDWGDAPAYQSPVTEQSEQARQLPPINRLPSIHVNLPSPMTVSPVTPTQSQFQSIN
FT                   ISNDEPPTPTEGTSGIRMVSAGSATTIRGPPSTLHDPTAPETSH"
FT   CDS_pept        join(complement(735826..735966),complement(735646..735772),
FT                   complement(735471..735594),complement(734936..735399),
FT                   complement(734561..734871))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166235" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943413"
FT                   /orf_name="Pc18g03140"
FT                   /product="Pc18g03140 protein"
FT                   /function="O-methyltransferase activity"
FT                   /protein_id="CAP94538.1"
FT                   /db_xref="GO:0008171"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="UniParc:UPI0001831C51"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB82"
FT                   /transl_table=1
FT                   /translation="MDAIISQIQALAQDTDEAGRLNIIQSLQIAKIDIQSPQDTFIELA
FT                   VPGLTSAMLRISADLGLFRSLAESDASLTVTKIAELTRASPQFLERILRYLAATHIIKE
FT                   TGINEYMANRVTHALADPMGEAMIYHGFDMIGPVVQAMPAFFSENNYQDVTVNTNTPFQ
FT                   KAHGTNLTPFDWLVQQPKHFDNLQKIMTALQGSEWTEGFTLLNDEARKVPSKGPSTIQT
FT                   SEKPFFVDVGGGHGHQCIELGKKYPNLLGHLVLQDLPEAVKNLAPIDGVKAEAYDFFQP
FT                   QPIIGAKFYYLRRIMHDWPDDKAATILRNIRAAMGPDSRVLIDDAVLPDTGANWKSAMA
FT                   DLAMMTFAGKERTKYQWESLAESAGLRVEQIHTYVASTYTAVLVLVAQ"
FT   CDS_pept        join(736234..737360,737419..738443)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670536"
FT                   /orf_name="Pc18g03150"
FT                   /product="Pc18g03150 protein"
FT                   /protein_id="CAP94539.1"
FT                   /db_xref="UniParc:UPI0001831C52"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB83"
FT                   /transl_table=1
FT                   /translation="EGLLAPQSTNLLKLDLGAFSSSGKWSCGAKCNIRGXSGPXYSYTG
FT                   LISSQPTQKEHICFANDPSVITGFINXXSSSIEPAFXYIDKVPDFATYIAFSIGAKGVD
FT                   NSELYIKTYEVYTXFLTLKLAFPRSIDKRIFRLFXYYYRTWKDSAATFRHELIKTSXDX
FT                   EALRLPGSCPFVLPTLEEISLHRKEYKRFKVAXNLKRDFSSLLKTISDRXVPLDNXEAI
FT                   KVGNEAIFNRMLEAILIDNDPDDDKPIRDKKDVRYIXPFDLSE"
FT   CDS_pept        739717..740025
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127605"
FT                   /orf_name="Pc18g03160"
FT                   /product="Putative uncharacterized protein Pc18g03160 "
FT                   /protein_id="CAP94540.1"
FT                   /db_xref="UniParc:UPI0001831C53"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB84"
FT                   /transl_table=1
FT                   /translation="MHVATFNRAVWTADSTSTSTSLLCSASDHCPCLQILLLSGETSIL
FT                   SHSILLHISMNWTSVQHDVVHVATHLAPAGSDLPLSTLRDQGIGPSEFFPTVNGMNG"
FT   CDS_pept        join(740316..740547,740613..742036)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216871" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670537"
FT                   /orf_name="Pc18g03170"
FT                   /product="Pc18g03170 protein"
FT                   /protein_id="CAP94541.1"
FT                   /db_xref="InterPro:IPR018620"
FT                   /db_xref="UniParc:UPI0001831C54"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB85"
FT                   /transl_table=1
FT                   /translation="MKNFIALAAFAAGSNALVGRRDTCCFQLSSSGGASGTLGQLGDGQ
FT                   NRIGDDSLQPAQYCIDDNGAITDSNGRGCILTPPTTQLQCDEGVAPAPGFSINSEGGLE
FT                   YNNSPDFVACATGQNGGMNIYTSPNKMDVTGCVNVLMSADACSGTGGPGPGPAPGPGPA
FT                   PGPGPAPGPGPAPGPGPAPGPGPAPGPGPAPGPGPGPAPGPGPAPGPGPGPAPGPGPAP
FT                   GPGPGAQTATTTITVTDCTCPTSGAPGVPGGGQASVPGPQPTAPGGGGGGGPQPSPSMP
FT                   APSGGAGVPPSVTEPAPGGGGGTQPGASASIPPPGGGGGGGTQPGASASVPPPGGGGTQ
FT                   PGVSVSVPPHTGGGGSATVPTPTGSPTGVRPHPTGGFGNTSVPVSPTSPATATGTSGGA
FT                   CPTTLTGNYEIPHLIVRVDSSSPDTSAGTGLNGTVTSTISTVFNFDIPNSDAGKTCSLV
FT                   FLFPRLEDLETSSYTFSGDGKIDFAKLSSTAVDSTSFSNVPSVSQDLGTITASPGNSYV
FT                   ISTFSCPAGQAVTYQMKNAGSTDFNFFEDWNPSP"
FT   sig_peptide     740316..740363
FT                   /db_xref="UniProtKB/TrEMBL:B6HB85 "
FT   mat_peptide     join(740364..740547,740613..742033)
FT                   /db_xref="UniProtKB/TrEMBL:B6HB85 "
FT   tRNA            complement(742508..742579)
FT                   /gene_name="tRNA-Glu (TTC)"
FT   CDS_pept        join(742926..742987,743045..743071,743119..743307,
FT                   743383..743609,743671..743682,743742..744466)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976515"
FT                   /orf_name="Pc18g03180"
FT                   /product="Pc18g03180 protein"
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP94542.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI0001831C55"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB86"
FT                   /transl_table=1
FT                   /translation="MEIPAKLPFSKRRLRPRVVISYIFDYVIIIACVAGFAILNTIEPY
FT                   HQHFSLNNISIQYPYAVHERIPMAYAVCISCGFPLVLIIVYTLFIDGLLWELNCGVLGL
FT                   LLAQGLAFVITQALKNACGKPRPDLIDRCQPRAGSKDLFPGLSNSSICTGDPHLLTDGF
FT                   RSWPSGHSSSSFAGLVYISLWLGGKLHVMDNRGEAWKALLVMTPLLAATLVAVSRIMDA
FT                   RHHPFDVITGSMLGIACGFVAYRQYFPPLSEPWRKGRAYPIRTWGTEPAGPDSVRIKGP
FT                   RGESMVALRNPEEERMNPPDIPSSEHTRPDASTYLDESNPYTSNVYNRRPHDHDDDGGA
FT                   WSSSEDDVTNGYEMRHGNTMGQNPGAGHHVPQYDPSNAYVSQTQPLTADAGIHVPDGMA
FT                   GQGRPLTGMPGRPM"
FT   CDS_pept        join(745240..745314,745388..745933)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670538"
FT                   /orf_name="Pc18g03190"
FT                   /product="Pc18g03190 protein"
FT                   /protein_id="CAP94543.1"
FT                   /db_xref="UniParc:UPI0001831C56"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB87"
FT                   /transl_table=1
FT                   /translation="MIGSVFFVFNRLVEIVFLIPIIGMLAYFVNGYLKVNQLTPSYILV
FT                   LFIVSVVAIFWALDTLIRFSTTKRSASFVAFVDLLFFGAFVASVYQLRFIANADCASWH
FT                   GGSVWISLGPFGSYGQHTDNPLSLDINKTCAMLKASFAIGIMETVFFFWTALLALFLHH
FT                   SHKPTVVKETTVRRRSHSSRRGHGSGSHSRHRSSSRRPAPYVV"
FT   CDS_pept        complement(746278..746943)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943414"
FT                   /orf_name="Pc18g03200"
FT                   /product="Putative uncharacterized protein Pc18g03200 "
FT                   /protein_id="CAP94544.1"
FT                   /db_xref="UniParc:UPI0001831C57"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB88"
FT                   /transl_table=1
FT                   /translation="MADDYHLWEKKGRRLQKWIENYRASGCPYPISTFTLTSKHRDYIV
FT                   DRTSVHIDLKLPTALNLSNANSTYRQVNIRLRDEGPPVRWIGRTGPGVIFIDDVFRSKR
FT                   SDDPYISEFTKAAYQMDFPLDSLRNVIVPNVDEVNTLSCLRKVYKSQGLHYPSSTEQTW
FT                   EPSLPEFNALLGTGIGKIVAAFVLCAWGQGRKRIARIVASHIGADVHKLYMRFDLEDM"
FT   CDS_pept        747389..748036
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179169" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943415"
FT                   /orf_name="Pc18g03210"
FT                   /product="Pc18g03210 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP94545.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001831C58"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB89"
FT                   /transl_table=1
FT                   /translation="MASKEEFVTVKAFLPTVPLPANSERPAITTDRLLVRALQSTDLEA
FT                   LHVLRTQEEVMKWTSAGCIDDSIEKTKSKLDPFLPPNDRVTANCAICLKETGELIGIGG
FT                   CHLYPGRHGWPEVGYMLRTEAWGKGIATEFLSAWLRFWSELPRTQREVRVQKEMVIGEG
FT                   IVDEHLIAITEASNSGSQRVLLKCGFERFREFVEVDDTKTVNLVAFRFLPKR"
FT   CDS_pept        748416..749564
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000236097" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823312"
FT                   /orf_name="Pc18g03220"
FT                   /product="Pc18g03220 protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP94546.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI0001831C59"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB90"
FT                   /transl_table=1
FT                   /translation="MEHFDVAVVGLGVLGSAAAYQAALRGKKVVAFEQFELGHVHGASH
FT                   DTSRIVRTANAAPQYVSLAKSAYKDWADLEEATDQKLLTITGGVMFFPKGASPPRVDFT
FT                   TSLDAKNMPYEVLDSKEVNKRWPQFNIPDTVETVYTADTGIAHATKTVLAMQNLARTNG
FT                   AILKEYTRVDRVMPKKSGSGVVIETSKGQFHAAKVILATDAWTNKLLAPLGIHIPLTVM
FT                   QEQVTYFKPTDESVWEPGRFPVWIWAGDPCFYGFPSFGEPTIKVARDTSNNFMTPEQRT
FT                   YVHSPQLLEQLCSFMGDFMPDKDRQPLRTITCQYSITPDRQFVISPLGNNQDIIVGLGA
FT                   AHAFKFAPAFGRALAELAMDGKSTEDLSKFGIPNNATPTIKL"
FT   sig_peptide     748416..748472
FT                   /db_xref="UniProtKB/TrEMBL:B6HB90 "
FT   mat_peptide     748473..749561
FT                   /db_xref="UniProtKB/TrEMBL:B6HB90 "
FT   CDS_pept        join(750241..750354,751024..751191)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823313"
FT                   /orf_name="Pc18g03230"
FT                   /product="Putative uncharacterized protein Pc18g03230 "
FT                   /protein_id="CAP94547.1"
FT                   /db_xref="UniParc:UPI0001831C5A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB91"
FT                   /transl_table=1
FT                   /translation="MAVCVNLDRTHIEAAHDLLQLRLLLTKSVQERHNQFLTGVVAKLR
FT                   TNGIDKETIFVAWATWRFDLSYLRLWLEDEKFEDILPGDENVCMRLKP"
FT   CDS_pept        join(complement(752547..752577),complement(752285..752488),
FT                   complement(751400..752211))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209871" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127606"
FT                   /orf_name="Pc18g03240"
FT                   /product="Pc18g03240 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAP94548.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="UniParc:UPI0001831C5B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB92"
FT                   /transl_table=1
FT                   /translation="MIIRKLCMRQSRQLLALSRRAPISSRFQSTLPESPVETLQTPIRD
FT                   EISRSENPLFEMVQAQSEASTPAQQEFTSDEPQRSNFKKLGTSVKSSYDPENVIRNPPK
FT                   PSQISLEMLLAAGTHLGHSTSRWNPQNSRYIFGIREGVHIISLDVTAAHLRRAAKVVEE
FT                   VAARGGLILFAGTRKGQKRAIVQAASLAKGYHIFERWIPGSLTNGEQILGHCETKVVNA
FT                   LDEELPDFKSDLADRPSLKPDLVICLNPLENVVLLHECGLNNVPTIGVIDTDADPTRVT
FT                   YPIPSNDDSLRATCLIAGILGRAGEAGQLRRLKMAQEGRTSYTPITAQELRLDPFTGLA
FT                   TGADGQKK"
FT   CDS_pept        join(complement(753406..753737),complement(753061..753352))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976516"
FT                   /orf_name="Pc18g03250"
FT                   /product="Pc18g03250 protein"
FT                   /protein_id="CAP94549.1"
FT                   /db_xref="UniParc:UPI000004EBFD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB93"
FT                   /transl_table=1
FT                   /translation="MSGYDQYNQGGYGQQGYGQQGYGQPGYGQPGYGGQPGYGGQGHDQ
FT                   QQQYGQPQHGYGQQGYGQQGGSSDYYAGQQHQQQGYGQQQGGSSDYYAGQQHQQHGYGQ
FT                   HDQNRQGGYEQQQHGAPDEAQDGERGIAGALAGGAAGGFAGHKVNHGFLGTIGGAIIGS
FT                   IAEDAVKKHRNSDNQSPPQYGGPPPSNSGSGGSMMDQLGGFFKK"
FT   CDS_pept        join(755619..755844,755952..756174,756337..756445)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823314"
FT                   /orf_name="Pc18g03260"
FT                   /product="Pc18g03260 protein"
FT                   /protein_id="CAP94550.1"
FT                   /db_xref="UniParc:UPI0001831C5C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB94"
FT                   /transl_table=1
FT                   /translation="MLLQSVLSALCFCLGITSAKSYPTVYMIRHGEKPRDPKDHGLASD
FT                   GIKRAQCLRHVFGQESEYNIGYIMAPHVKKNGAHGRAFETVLPLAKDLRLTVDTHCKRT
FT                   KARCVAKTIRSYDGPGNILIAWRHSTMGEIEKELGALEPIEYPDGRFDLIWTDPWPYGN
FT                   VTSIKSEECPGLDVATGLVDQV"
FT   sig_peptide     755619..755675
FT                   /db_xref="UniProtKB/TrEMBL:B6HB94 "
FT   mat_peptide     join(755676..755844,755952..756174,756337..756442)
FT                   /db_xref="UniProtKB/TrEMBL:B6HB94 "
FT   CDS_pept        join(756820..756942,757059..758540)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209849" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976517"
FT                   /orf_name="Pc18g03270"
FT                   /product="Pc18g03270 protein"
FT                   /protein_id="CAP94551.1"
FT                   /db_xref="InterPro:IPR007019"
FT                   /db_xref="UniParc:UPI0001831C5D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB95"
FT                   /transl_table=1
FT                   /translation="MPRKDGELTAFKERLRSHAQAFDGLLSLIPAKYYYGEEDTSDQWQ
FT                   RKKQTKEQAREAKRAKLNPDAAKTAKDVMDENARKRKREDGTLESDSSDGEMGTEAPKE
FT                   GLNRGNANMKKQKQVEKTDKLDAAKTAEAEARKKQKEEKKAQKKAAQMEKKKAKDAARK
FT                   EKAQQSKKPSTTPTEDSEKSATKPNGTAAKDTEASENEEDDDQEDDGVVEEGFSIEFNA
FT                   EEENPSSAPSTTDSPSLDASNSQSGTSSISSIVPPSTSTEAKSSEPKPLKHTPEELKQR
FT                   LQKRLDELRAKRHADGLNGKPARNRQELIEARRQKAEQRKAHKKELREKAKIEEEKKND
FT                   EAMARRFSPGGSGSLLASPRSPAESVGSGSNSFSFGRVMFTDGQQTDLAGTGVRETPKT
FT                   RGARDPASQLKAAEAKKARLEEMDPTKRADIEDKDLWLNAKKRAHGERVRDDTSLLKKA
FT                   LKRKETAKKRSEREWKDRIDTVAKSKEQRQSKREENLRKRRDEKGAKGGKKKSSSGKKK
FT                   AARPGFEGSFKGGGKKK"
FT   CDS_pept        join(complement(759904..760169),complement(759539..759804),
FT                   complement(759336..759466))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976518"
FT                   /orf_name="Pc18g03280"
FT                   /product="Pc18g03280 protein"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="electron carrier activity"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on NADH or NADPH"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="photosynthesis, light reaction "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP94552.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016651"
FT                   /db_xref="GO:0019684"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR012285"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniParc:UPI0001831C5E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB96"
FT                   /transl_table=1
FT                   /translation="MAATRSVARLVAYRRPTPFGLLGSTANFSSSTYRAASPAGPPQAG
FT                   FRLPPPKRWDQDSESALDKASKYFLMAEIFRGMYVVLEQFFRPPYTIFYPFEKGPISPR
FT                   FRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAEEREDGSRRTTRYDIDMTKCIYC
FT                   GYCQESCPVDAIVETSNAEYATETREELLYNKEKLLSNGDKWEPEIAAAARADAPYR"
FT   mat_peptide     join(complement(759904..760067),complement(759539..759804),
FT                   complement(759339..759466))
FT                   /db_xref="UniProtKB/TrEMBL:B6HB96 "
FT   sig_peptide     complement(760068..760169)
FT                   /db_xref="UniProtKB/TrEMBL:B6HB96 "
FT   CDS_pept        join(760454..760672,760760..760777,760881..760961,
FT                   761026..761074,761142..761188)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178184" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943416"
FT                   /orf_name="Pc18g03290"
FT                   /product="Pc18g03290 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="phosphopantetheine binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /protein_id="CAP94553.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniParc:UPI0001831C5F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB97"
FT                   /transl_table=1
FT                   /translation="MFRSAIARSLKASAPRVIKTPAPFHIRSSPIAARVPQFTPCFAQG
FT                   VRLYSAPAGLSKTEAEGRIVNLLKNFDKVSDASKINGASHFSNDLGLDSLDTVEVVMAI
FT                   EEEFSIEIPDKEADQIHSVEKAVEYILAQPDGM"
FT   CDS_pept        join(762166..762438,762522..762768,762834..763327,
FT                   763383..763433)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943417"
FT                   /orf_name="Pc18g03300"
FT                   /product="Pc18g03300 protein"
FT                   /protein_id="CAP94554.1"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="UniParc:UPI0001831C60"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB98"
FT                   /transl_table=1
FT                   /translation="MASAAGGLTRRRGAGRVAGADEQDDSRVSSPISRNGSAMDNRGPE
FT                   TSFTSAENGHKIAFDPRDISENEERGKQPKLTLMEDILLLGLKDKQGYLSFWNENISYA
FT                   LRGCIVIELALRGRISMQKDSSRRRFPLADRIIEVIDDTLTGEVLLDETLKMMKSSEKM
FT                   SVNSWIDLLSGETWNLMKIGYQLKQVRERLAKGLVDKGILRTEKRNFLLFDMATHPVAD
FT                   GGAKDELHRRVRNICSNRTVIIPPSPWLPEDAEYRYLRSITMVCAAYAANVLENALVTM
FT                   SHEARERAFAQVDELLAEYSQWPFGRKAGGSQAIGANLAQVVNEEINRNKDKELQMEIV
FT                   AACLSVFTRLDSLL"
FT   CDS_pept        join(complement(766604..767822),complement(765092..765847),
FT                   complement(763848..764452))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235088" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976519"
FT                   /orf_name="Pc18g03310"
FT                   /product="Pc18g03310 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94555.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniParc:UPI0001831D34"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB99"
FT                   /transl_table=1
FT                   /translation="MPHHKPDELSVADARKEVYEATASTSPTPVQEKRSSALLNFFSSF
FT                   LGPKNPLAHPANPRKHTVWLLDNTAYQPVNEERDESQPCWNAEVVACIFETEGRRDVGN
FT                   LVAAIADYIGLDGDVGGDVEARQRITERVQPFLNQVSPARTLTLQVPMFRRAQSHRLGP
FT                   SDRNGIISQTVDMGKVEMHDGVVVRPRLQHFGDEAVSMSTTFAAPEGWLVISDIDDTIK
FT                   HTMTLEPTGIIRTTFADIPEPVAGMPELYKYVHAELFPAWFYLSASPYNLYPFLHDFLD
FT                   EHYPPGTPVLRDYSWMDITGLIKSFTEKTQEYKVDRMEKIQRWFPRRRVLCIGDSTQMD
FT                   PETYAEMYSRYPEWIHAIIIRKVKDVAHMEEKNAPARFEKAFEHVPSHVWTVFEEPKEL
FT                   YNFIDGLEAMKQPPESPRDTSEAMKKQPESPKHISEDMKQPSEPPKRTSYAPKPTSSTL
FT                   NDSAFTPLSMRALYYTPDGADSDTPDGIPEGEISDAMSPDTSTGIVRQKGTNLIFDPGF
FT                   PTPQPSPQQYLLKISTAAFCHDEIRLAGLLNPPNTTPQIPLHSLCGTVISTPREDDERE
FT                   EGPKFKIGDVVFGVVSYTRDGGAADYAVATESELALKPDNITVAGAAALALPALTAWQA
FT                   LFRYAGLDPDVPGGLNEVSEELGVLVTNARDNDIGRIAVQILRADSLFPAPVRPWICVT
FT                   CTQVEADIIEKDWDVDEIVIIPHLPSREECNIEKVFRARRWEPVDIVLDCSGGEVFRAA
FT                   HAAGVVKDYGAVLTVVDGQVALQSPLVPENDVLGERRRGIKSRFVPVNPDGAAMERIAE
FT                   LVEESLVRGREITVVDIPRAADLLAAGAAGTAGNRRGGMVVVRVNSV"
FT   CDS_pept        join(complement(769451..769499),complement(769018..769396),
FT                   complement(768705..768914),complement(768581..768647))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000221683" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943418"
FT                   /orf_name="Pc18g03320"
FT                   /product="Pc18g03320 protein"
FT                   /protein_id="CAP94556.1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI0001831D35"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBA0"
FT                   /transl_table=1
FT                   /translation="MPDKDSGTPRVFLYRHGQTEWSKNGRYTGITELELTQDGINQVTA
FT                   SGKMIVGSGRLIDPAKLAHVYISPRRRAMQTFEIAFSDADKQALKDVQKISETDRLAEW
FT                   DYGLYEGLLTKEIRALRKEHGLDTESEWDIWRDGCENGESAQEVTDRLDNLIQEIRAIH
FT                   KDNMHGENPSDILLVAHGHLLRAFTKRWLGYPMEFPLSLMLDPGAVGVLSYQHHNIDEP
FT                   AMLVGYGYPLQE"
FT   CDS_pept        complement(771353..776323)
FT                   /pseudo
FT                   /gene_family="HOG000184689" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(777223..778671)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670539"
FT                   /orf_name="Pc18g03340"
FT                   /product="Pc18g03340 protein"
FT                   /protein_id="CAP94558.1"
FT                   /db_xref="UniParc:UPI0001831D36"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBA1"
FT                   /transl_table=1
FT                   /translation="MWHSIGLQLTTTQLTQPHILERVLTRATSDDQTPNADDSHANEMD
FT                   VTAILGLEVRNTKTARDPEEQRQDTNRFLLKEPKWTESAVNPQCMVNDIELSSSSTLSQ
FT                   HDLADKLKESREQNAKLRCKMKEQEDTIRNLRQSHKETIRWFVQRLANIPHKRQKQAKR
FT                   IADLKSQKERLVRDLEKQTKKTVDLACLRGMRLRDLKRNEEMIADLQWQKVTLVGDLEK
FT                   QKKIVADLYWQKEMLFHDLGEQGKIIAHFQWQKEMLVRDLERQAKTITNLHYQQGMLVR
FT                   HLGEQGEILANLQYQKGKLARDLGEQKKKTADLESQKGRLVRDLEKQTSIASALETRDM
FT                   KLEKFIYHIASMMYSELEYQEELISETKSADVESLELIRDTLKDLVETTISNDEHSDMM
FT                   LNIGDEPQFEQIYTDILSRFRCILAGQARKLDRQKGIIEEQTSTIFEHEAQKRKIASDL
FT                   AEQTGKLALTLEFFGEDSAEYACL"
FT   CDS_pept        join(complement(780319..780557),complement(780125..780261),
FT                   complement(779332..780059))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000227039" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127607"
FT                   /orf_name="Pc18g03350"
FT                   /product="Pc18g03350 protein"
FT                   /protein_id="CAP94559.1"
FT                   /db_xref="InterPro:IPR007177"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="UniParc:UPI0001831D37"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBA2"
FT                   /transl_table=1
FT                   /translation="MVRHKKDNFARGGKKFSNPRPRVPRGDEVEGATSSRPAYKAACWD
FT                   MGHCDPKRCSGKRLMKLGLMRELHVGQRHPGVIVSPNAKRIVSPADKDIMEQHGAAVVE
FT                   CSWVRVKEVPWSRIGGKCERLLPYLIAANTVNYGKPWRLNCVEALAACFAICGRLEWAE
FT                   DILRHFSYGPSFLEINKELLARYAACETEEDVKRTEEEWLAKIEREYEDNRIDGGDDIW
FT                   TKGNTNRLPARTDDNEDDESGDEDDENEGSDEEEDEDKDPFAISDDSEDEEQMAEIRRK
FT                   ILNSKSFQNPEEGKQQPEKISRPEQLYVDSDAESGSAGSEDEAFDNIINATTVTDRTGI
FT                   KAIQRRKANETVSASFSRAEISAPKKW"
FT   CDS_pept        join(780849..780915,780979..781066,781120..781195,
FT                   781254..781547,781599..781871,781933..782320,
FT                   782373..782941,783006..783206)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209783" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670540"
FT                   /orf_name="Pc18g03360"
FT                   /product="Pc18g03360 protein"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus part"
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAP94560.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="GO:0044431"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR004152"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR008153"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR018205"
FT                   /db_xref="UniParc:UPI0001831D38"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBA3"
FT                   /transl_table=1
FT                   /translation="MAARDRFGVYAEPGASPLQRAVRNACDPQNYEPNLALNLEVADLI
FT                   NSKKGNAPREAAFEIVHLINSRNQNVSLLALALLDIAVKNCGYPFHLQIGTKEFLNELV
FT                   RRFPERPPIRPSRVQHRILESIEEWRQTICQTSRYKDDLGFIRDMHRLLLYKGYMFPEV
FT                   RREDAAVLNPSDNLRSADEMEEEEREAQSAKLQELIRRGTPADLQEANRLMKVMAGFDN
FT                   RHKTDYRAKAAEEVVKVQQKAKILEEMLQNQQPGEALPEGDVFEELASALQSAHPKIQK
FT                   MCEEESDDPEAVHKLLEINDSIHRTIERYKLVKKGDLHAASQIPKGTLGTTTGVSKNAN
FT                   NELSLIDFDPEPEPSSNGNEAGPSQGGNSLENDLLGLSLGEQSPSPGGGISLGSSMNFP
FT                   SMSASPTPPVPSQPQQQAPTAFKPNYDILSSMNSSRPVSQSPTPVMGVSSQAQSTATPP
FT                   PAADPFASLVSASPRATSSPFQPPAQSQPAPASSSLLDLVGDTGPSPQPARQAAPVEDD
FT                   EWDFASALPASNALPSTNKIQVLNSQLRVDFAARRVPNQTRQIHIVAIFSNTTTQSIGD
FT                   LHFQVAVEKSYTLQLRPQSGRDIAPQQQNGVQQEMLIDGIDVGKGNSVKIRFKVFYKLG
FT                   GEAREEQGMVPALGIA"
FT   CDS_pept        join(786067..786134,786190..787441)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209794" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670541"
FT                   /orf_name="Pc18g03370"
FT                   /product="Pc18g03370 protein"
FT                   /protein_id="CAP94561.1"
FT                   /db_xref="UniParc:UPI0001831D39"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBA4"
FT                   /transl_table=1
FT                   /translation="MPLSDIDQDITPIPRSREENQERAFIAASRRKDRSLDARLESANR
FT                   ASLLHKKRTGKAFHITKEIVEKEAMYEEVDERYQEKRILMLQRQNKEIEKQFQDHLMAA
FT                   FAARAQFNSSIHSRRASHMTPRPSVNGGPRKMSLDLSNMRSSFSQGSGSGSMASPMPTS
FT                   DGYALSPTASYDPSAQSYMACMSGSQTPYSDMCSASTGPPGLPTYMSPQASAPAPAWNS
FT                   QVPAWAPMQQQNPTPGQTPTDTHAVQMWQQQMMQQSQVPDTATQMHQFRDRLASAPELP
FT                   LQHSAAPPIPSASISGPTGHSPTHGHSRGQSQPSNNFHNLSLLTQTTHHSHSQIAPSSL
FT                   SSPKIEALSAGTHSTPEFCPTPNTPLSPRTATANATMSPGGKVNSDGIMVSHEGMDPDF
FT                   TDFSQFAFHLGNSTVPLSDRDQPFGFDDLLAVDDFASVPC"
FT   CDS_pept        join(complement(789662..789757),complement(789321..789593))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823315"
FT                   /orf_name="Pc18g03380"
FT                   /product="Putative uncharacterized protein Pc18g03380 "
FT                   /protein_id="CAP94562.1"
FT                   /db_xref="UniParc:UPI0001831D3A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBA5"
FT                   /transl_table=1
FT                   /translation="MDRLLQPWKYPSKDKFSNRPIWAPRPDLNQTQLSHWALYPSQSPS
FT                   PPMDLSSALEVIPLSQSVNLTGHPPDPESHKTRNGKSPPITPPQVRTGPVLQSSPTGSN
FT                   YADPSANPHPGKHSLGGC"
FT   CDS_pept        join(complement(792656..793031),complement(792129..792585),
FT                   complement(791951..792068),complement(791722..791900),
FT                   complement(791187..791667))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976520"
FT                   /orf_name="Pc18g03390"
FT                   /product="Pc18g03390 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP94563.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001831D3B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBA6"
FT                   /transl_table=1
FT                   /translation="MADRLHSRQGSDTSLNSASIASPRSSTESRSPSARNHLRVSANHQ
FT                   HRQSLSESLRGPPGSPRARRQPSLPQSAVQSLIDNPPVPKTTNPAFVGRDWREISIGEL
FT                   VSPDDLKFVELDTGIEDATNVSAAVLLIRETPEATSAVGTFDYADLNSYLLLAAGLTHP
FT                   DEAHQASYEELAKKAHDGVPIPLRDVKKFGMEKEPLIKLPASANVLAAVEIFGGGVHRV
FT                   VVVNESNDQEVVGIFSQFRLVKFLWENVRSFPIIEELYPKALRELVIGSHEVISINGDR
FT                   PLSEALHMMNNEGMSSIVVVDNHFNVLGNISTADVKLLTRSSSLPLLQNTCTHFISVIL
FT                   STRGLMEGKDSFPVFHVNPGSTLAHTVAKLVATRSHRLWVTDPLSPTSSGPPTPSQSSV
FT                   HIPLSNSIGPTTGYIANSPPPSPSAPVTPSAQPSQYTAPHLPTPNPPYTYPAPGVSVPV
FT                   PSPISHSIPSSALDGARLSGRLVGVVSLTDILNLHARASGLNPADPAESRSRRRRSSSS
FT                   SQSVRRSGDIGRELFSRGM"
FT   CDS_pept        join(complement(793987..794795),complement(793364..793936))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(795418..795537,795588..795701,795742..797499)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943419"
FT                   /orf_name="Pc18g03410"
FT                   /product="Pc18g03410 protein"
FT                   /protein_id="CAP94565.1"
FT                   /db_xref="UniParc:UPI0001831D3C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBA7"
FT                   /transl_table=1
FT                   /translation="MDIELSSPLAVSALRESFGDRKPPDITRKITACVACRKQKEGQMP
FT                   YAGGSDAVFAVQEERSPLQCESKLADIIGRRCHVSRWKGAVVQKMRRLEEAVAKIAAKV
FT                   DMPELQYLQAAEIQDGSSGSPGEAINEEVTTGETSTSSQAPQPKDKENPEQPQTWEVVM
FT                   DPRGGPASIPASCVSESGKAGPPNSASTARRPDLISTGLISLRQAVALFETYHLRLDHF
FT                   LYRILGDHISLDSVRIASPLLTTAVCTVAALHSQSLGYLFETCYGEYKDLVAAQTFSRY
FT                   VNEDDIRGLCIGAFWLHELSWALIGNGMWLQYSGGTKLTELAVRVASEVNLHSGIYKAL
FT                   KGDRDGYLQARLYYLVYVCDHHFSIAYGRPPMSREGFIIESASRLLETKHATEDDARLI
FT                   SQVKEWSILGRVFDNFGVDVDTPIAPQTLPQLRRCSISLDTWFADWNDSFKVNRNVGNY
FT                   PQKGVGFHFHFAKLYLCSHAFRGVPSSESAPQYMSPELEEIANAGVLSAMSILRVIVND
FT                   AEFRSFMNGLPLYFDTMLAFAVVFLLKVATKYASMIRIDTGKILSLVTETVAALRDITQ
FT                   SMHKHHLLVVISEGLERLLSRCQLSTQTAHETMYRPSPAQEQPPVFDSTWMENMASFDF
FT                   QTNFPDVDDWFLHYNTSMGPPPCPEVSR"
FT   CDS_pept        join(798109..798396,798468..798900,798967..799073)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234548" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823316"
FT                   /orf_name="Pc18g03420"
FT                   /product="Pc18g03420 protein"
FT                   /protein_id="CAP94566.1"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI0001831D3D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBA8"
FT                   /transl_table=1
FT                   /translation="MTPLAPEQIVSYHENGYLLLRADEHKLVDPAELKRWTQEVQAWPR
FT                   VKGKWMPYDEININGERQLMRTERFIDYHPGFKSVVCGEQLAEILKAVSGDDMLLFKEK
FT                   INYKQPQGNGFEAHLDAPAYDHIGRIEHITANIAIDAATPEKGCLEVVRGSHKMKVEFA
FT                   EGGRITSEWEDAHEWISVPLETGDMLIFGSHLAHRSAENKTDESRSSLYATFHSRSDGE
FT                   DLRERYYKHRMEMFPPEHEREEGKDYSEGYETYGFAAPFTKAQDKVAATADVV"
FT   CDS_pept        join(complement(802001..802103),complement(800414..801947),
FT                   complement(799478..800363))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000029698" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976521"
FT                   /orf_name="Pc18g03430"
FT                   /product="Pc18g03430 protein"
FT                   /function="catalytic activity"
FT                   /function="molybdenum ion binding"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAP94567.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001831D3E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBA9"
FT                   /transl_table=1
FT                   /translation="MVESTFQGSTHSKYSQGYSADVDIIREQEYPLLNGTTYLDYAGTT
FT                   PYAKSTIESFSRDLTSNLFGNPHSMSVSSQLSTQRTEDVRVRVLRFFNADPDEFDLVFV
FT                   ANATAGIKLVADSLRDSDHRGFWYGYHIDSHTSLVGVRELAEMGYQCFQSDDEMEVEIS
FT                   KLASNQSKAPRLLAYPAQSNMNGRRLPIRWCEQVRSATKESGGNVYTLLDAASLVSTSP
FT                   LDLGPSSSAPDFTVLSFYKIFGFPDLGALIVRKSVARVFERRKYFGGGTVDMVLATGVQ
FT                   WHAKKETSIHERLEDGTLPFHNIIALDTALDTHERLFGSMANISAHTEFLAKQVYDRLS
FT                   SLAHFNERKVCQIYQPHTSTYGDSHTQGPIIAFNLCNSRGEWVPKTEVEKLATVQDLQI
FT                   RTGSVCNPGGTASSLGWTGPELRRHYSAGLRCGDNHDVLGGRPTGILRVSIGATTNMKD
FT                   IDSLLNFVEEFYMEKSPPIVALDPLTEDNEVVAPHFYVESLAVFPIKSCGAFKIPEGKR
FT                   WEVKKEGLAWDREWCLIHQGTGAALNQKRYPRMCLIRPSIEVERGVLRITCGAIAAPDQ
FT                   VSLEISLGWEDTSLISTSFCPSSSKKPTTVCGDRVSLHAYTSPVVSAFFSDFLGVPCTL
FT                   ARFPTQTSSRYSQMQRTPNTWKNRFRKLIMPGSFPPDFPPPIREGGQTQITLSNESPIL
FT                   IVSRSSVNRLNETIKANGKNGSSKTVAADVFRGNIVVAERLAHRGDVEQPYAEDRWSSL
FT                   RIGPDQLRFDALDACQRCQMVCIDQFTGIRRAEPFSTLAKTRNIDGKVRFGKYSALSPE
FT                   ELEGFDSELPDRRTVMVGDVVVPSYQDD"
FT   CDS_pept        complement(803376..804359)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670542"
FT                   /orf_name="Pc18g03440"
FT                   /product="Pc18g03440 protein"
FT                   /protein_id="CAP94568.1"
FT                   /db_xref="UniParc:UPI0001831D3F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBB0"
FT                   /transl_table=1
FT                   /translation="MSVSKQTGTLLENLPQRLVNFFARYPPQTHSAAVRRPAPANGKGY
FT                   VPTKVESPYTPDRDAKGAPGEKKHGWTPSRALLVTSKGVRNPFLPHKRFGKWEAPRYGL
FT                   RQQADLMKLAIKYNVEALLPPSRKSPEFKETRRAERGLQIKGTGVGHKVKGHKWERTME
FT                   SRLEDRRKAMEGMPEMVRLWKQVSTLLVLPDVIGAMLTRRNREVMAVAGDNGPSGKGNP
FT                   SGKGNPPPPTVASSSFPSLFWPVCSFWLFTALSIPTQTRSTRILVRVIAGAWDGVLSLK
FT                   YTINPICTIQSTVTSPNGAQGYHLHVSDQYYLSSSSAPIRNLLTPR"
FT   CDS_pept        join(804849..804917,804980..805195,805266..805369,
FT                   805837..807202)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189748" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976522"
FT                   /orf_name="Pc18g03450"
FT                   /product="Pc18g03450 protein"
FT                   /function="binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP94569.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI0001831D40"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBB1"
FT                   /transl_table=1
FT                   /translation="MSDYQYGGSEEENAEIRNLEAQLLDDPDNFETWEKLVRAAEALEG
FT                   GINRNSNPQAITTWRAAYDRFLAKFPLLFGYWKKYADLEFSIAGTEAAEIVYERGIASV
FT                   SPSVDIWTNYCSFKADTTHEAHIIRELFERAANSVGLDFLSHPFWDKYIEFEERIEAHD
FT                   KIFAILARVIHIPMHQYARYFERYRQLAQTRPLPELAPAEVLAAFRAEIEAASSQPAPG
FT                   PKAEAEIERDLRLRVDSYHLEIFTNTQTETTKRWTFEAEIKRPYFHVTELDEVQLVNWK
FT                   KYLDFEEAEGSFSRTQFLYERCLVTCAYYEEFWFRYARWMAAQPNKEEDVRIIYQRASY
FT                   LYVPIGNPTIRLHYAYFEEVSGRVDVAKDIHNAILMCLPSHVETIISLANLCRRHGGLE
FT                   AAIEIYKTQLDSPECEMATKAALVAEWARLLWKIKGSPDEARTVFHENQRYYLDSRPFW
FT                   CSYLVFEIDQPTSEATESVQYERIKQVITDIRSKSVLQVDAVKELVQIYMTYLLERGKD
FT                   TAKEYMTLDREIYGPSSVASARTGGNVAVQPTTAGGQFASIPHMQPTPDEAAAYAYYQQ
FT                   TAANGTAA"
FT   CDS_pept        join(807930..808211,808291..810224,810286..810442)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268796" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943420"
FT                   /orf_name="Pc18g03460"
FT                   /product="Pc18g03460 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP94570.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001831E25"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBB2"
FT                   /transl_table=1
FT                   /translation="MTNGPEGLPPLPPPDPVERPPSPPPPPPEDLAAPPPPPDSIAPPP
FT                   PPDDVPPPPPVESQKKQKLGWGAKKPSVTPLSVEELIRKKKEADAATSKPKFLSKAQRE
FT                   KLALEKRAQEVEAERQAKARTNGNGLASAPSSVRPNIREEPVVRHVPTGPRAMRDDPAT
FT                   GPGGMRKGGRQSNQRYRDQDMPPPQSKTKGEKRLTEEDEAAALAALTKHRYMGADQTSN
FT                   FSAKKKRKRTADRKFNFEWNVEEDTSGDYNPLYQRRQEANFFGRGRLAGFGDEVADDVA
FT                   RKYAEALATRDHEAGSARAQQMLEMERRRREESKRTQIDKHWSEKRLDLMRERDWRIFK
FT                   EDFNIATKGGSVPNPMRSWEESSLPKRLLELVERVGYKDPTAIQRAAIPIAMQSRDLIG
FT                   VAVTGSGKTAAFLLPLLVYISALPRLDENEWRKNEGPYAIVLAPTRELAQQIEIEAKKF
FT                   TQPLGFNVVSIVGGHSLEEQAFSLRNGAEIIIATPGRLVDCIERRMLVLSQCCYVIMDE
FT                   ADRMIDLGFEEPVNKILDALPVTNEKPDTEEAENSMAMSQHQYRQTMMYTATMPAAVER
FT                   IARKYLRRPAIITIGGVGEAVDTVEQRVEMISGEDKRKKRLAEILSSGDFRPPIIVFVN
FT                   IKRNCDAIAREIKQMGFSSVTLHGSKTQDQREAALASVRNGSTDVLVATDLAGRGIDVP
FT                   DVSLVINFNMATSIESYTHRIGRTGRAGKSGVAITFLGSEDSDVMYDLKQMLIKSPISR
FT                   VPEELRKHEAAQSKPSRGPGGKKIEDSSGFGGKGGWA"
FT   CDS_pept        join(complement(813714..813859),complement(811286..813656),
FT                   complement(811079..811204))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000106482" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943421"
FT                   /orf_name="Pc18g03470"
FT                   /product="Pc18g03470 protein"
FT                   /function="metallopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP94571.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniParc:UPI0001831E26"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBB3"
FT                   /transl_table=1
FT                   /translation="MCSSRRDTSGSTNVQGREVLPTNVKPQHYDLTLEPNFEKFTYEGT
FT                   VTIDLDVTEDTDFITLNSNEIEIHSAIVSAKGSVVDSKPEISLKKDDQTATIKFGQAIA
FT                   AGSDAQLKLTFTGILNDNMAGFYRSSYKENGETKYIASSQMEPTDARRAFPCFDEPALK
FT                   AKFTVTLVADKSMTCLSNMDVDTETEIQGGAKKAVKFTTSPLMSTYLVAFIVGNLNYIE
FT                   TKNFRVPIRVYATPDQDIEHGRFSLELAAKTLAFYEKAFDSDFPLPKMDMVAVPDFSAG
FT                   AMENWGLITYRIVDVLLDEKNSGASRKERIAETVQHELAHQWFGNLVTMDFWDGLWLNE
FT                   GFATWMSWYSCNVFYPEWKVWQTYVIDNLQSALSLDSLRSSHPIEVPVKRADEINQIFD
FT                   AISYSKGSSVLRMISKYLGEDVFLQGVRNYIKKHAYGNTETGDLWAALADASGKPVQSV
FT                   MDIWTKNVGFPVISVTENKESSSIHVKQNRFLRTGDVRPEEDQTLFPVMLGLRTEKGID
FT                   EDTMLTERERDFPIPDLDFFKLNADHSAIFRTSYSPERLKKLGQAARDGRLSVEDRAGM
FT                   IADSGALAASGYQRTSGMLSLLQGLDTESEFVVWNEILTRIGTLRAAWLFEDDKTKDAL
FT                   KAFQRALVAPKAHEIGWEFPENDDHILQQFKALMFGSAGMAEDPVVVKAALDMFARFSA
FT                   GDLSAIHPNIRGSVFTIALKHGGLKEYEVVLDRSRHAPTSDEKTTALRCLGASEDPELI
FT                   KRTLGLAMSEEVKSQDIYMPLGGLRSHPAGIEGRWNWLKSNWDELYKRLPPGLGMLGTV
FT                   VQLTTASFCTEAQLKDVEDFFASKDTKGFDRAVEQSLDAIRAKINWLKRDRDDVEQWLS
FT                   SNSYLQSKL"
FT   CDS_pept        join(complement(816462..816573),complement(816173..816404),
FT                   complement(815662..816112),complement(815342..815606),
FT                   complement(815125..815287),complement(814673..815072))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187297" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670543"
FT                   /orf_name="Pc18g03480"
FT                   /product="Pc18g03480 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP94572.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001831E27"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBB4"
FT                   /transl_table=1
FT                   /translation="MAERVDPVVEASNKSPVFDTKPAGDDGLRRADGISGLYEGNVFEA
FT                   TPDDRRQIGIFSAALLIFNRVIGTGIFATPSTILALSGSVGLSLFMWVIGTVIALAGTA
FT                   VYLEWGTAIPRNGGEKNYLEYVYTKPKFLATAMFAAYAVLLGWAASNSVVFGQYILNAA
FT                   DIEVGRWNQRGIGMACLTAAFLIHSVALKWGIRLQNVLGIIKLVIVLFIIVAGWVALGG
FT                   HTKAETPDNFTNAFEGTKGSGYGIVMALYNVIWSFVGYSNANYALSETKNPARTLKIAA
FT                   PVAIIAVGVMYMLVNIAYFAAVSKEEMLESGSIVAAVFFRNMFGGQAEKVMSVFVALSA
FT                   FGNVLSVIFSQGRIVQELGREGVLPFSKVWASNWPFHSPAAGLLEHYLVSVVILLAPPP
FT                   GDAYNFLVNLISYPLAIVNFFVAAGLVHIYLTKEKNYPNWKPGVRATLPVTIFFMLSNL
FT                   YLAVAPYVPPSDGQNVYEELPYYLHCVVALALFAAGGIYYVVWAILMPRIGGYVLVKES
FT                   VVDADGWSRSAFTKLPQAQAVHS"
FT   CDS_pept        join(complement(820790..820915),complement(818134..820726),
FT                   complement(817913..818076))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246715" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943422"
FT                   /gene_name="atg1"
FT                   /orf_name="Pc18g03490"
FT                   /product="Serine/threonine-protein kinase ATG1 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP94573.1"
FT                   /db_xref="EMBL:ABO31072.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020656"
FT                   /db_xref="InterPro:IPR022708"
FT                   /db_xref="UniParc:UPI0001593026"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7KAL2"
FT                   /transl_table=1
FT                   /translation="MASQHSRRSREAPRPEMSIGRYTRLDEIGRGSFATVYQGVHTKSK
FT                   TYVAIKSVNLSKLNKKLKENLSSEIDILKGLHHPHIVALIDCHESTSHIHLVMEYCALG
FT                   DLSLFIKRRDTLGSHKYTRDMIAKYPNPPGGSLNEVVTRHFLKQLSSALKFLRDRNLIH
FT                   RDIKPQNLLLCPSPSSYRSGHAQVMPYKGSDDSYEPTTGLESLPMLKIADFGFARSLPA
FT                   TSLAETLCGSPLYMAPEILRYEKYDAKADLWSVGTVLYEMVVGRPPFRATNHVELLRKI
FT                   EKGEDRIRFPEDNPASDDIKKLIRGLLKRNPVERLNFPEFFSNNVINDPIPGLLADDAP
FT                   GPPQSPRPRQLVGKAEESPYDTGPEDKLAYPPGQRPVTTHPKSGTPPTATDMRRMGSAD
FT                   RPAPAISKEQQPGGTPPQRPGPVSLATAPGRQELIDRNATTAAMDRQRHRNTYAGAPKA
FT                   SDSTIRAQEARDRAAQEVAFERDYVVVEKRAVEVNAFADELAHSPRLQGGLSRPGQTGA
FT                   GSRRTTTQGLPTVSPSSPHANAAKAMQVVSGRARADSTHQRQHSYERRYGQSPTSATSA
FT                   ISKALNMASGRLFGMGFSPPLAITKGGRSPPLAYNPFPAYPPVHASLLITGDGSKPNAT
FT                   GDEDCKAVQEIEECATRSDVVFGFAEVKYKQLIPLAPSASTDPSARPMDTNVEPDSADS
FT                   DDGLTVDAIVTLSEEALVLYVKALSLLAKSMDIAGAWWSRKNREEVYGESPTKDSMSAV
FT                   AGTRINYVVQWVRSRFNEVIEKAEFVRLKLIEGQRRLPPDHPSHPDNHSISSTAGSSST
FT                   ADVVVSPGVTAERLMYDRALEMSRAAAINELTGEDLANCEITYVTAIRMLEAVLEDDGM
FT                   RSMPGSNIERQSSSQGGEKVVLDELQVEDRQVVVKLVSSMRGRLASVRKKVAVLAKRSS
FT                   APTPTAGSAGKTPTSNISPVTYATGVTPPR"
FT   CDS_pept        join(complement(824471..825035),complement(822269..824415))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189759" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823317"
FT                   /orf_name="Pc18g03500"
FT                   /product="Pc18g03500 protein"
FT                   /protein_id="CAP94574.1"
FT                   /db_xref="UniParc:UPI0001831E28"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBB6"
FT                   /transl_table=1
FT                   /translation="MSSPWKEEQEATPRISTPLSPEAFAEDLRLFNRSPHPYHRSRRLG
FT                   SCTPSEQGDRLHPLSSYSRSSRTTSDSGTEADDESTGILRGLPAPPLRPRKGLRSGGVG
FT                   PTDLNDWLPSLQPWPSFVRPMLRTSRRSSEEELEEEAFEERLRFRRQRRVEVLRRLLEV
FT                   ALLLSVGGVVLYQDGARSLAREWRKEIAAHGLVVLGLYAAYPLVVRASQGRSWRIWRVW
FT                   STKRTYFSIPSSFDPAPLLYPILIPIFVSLSLSNHLPPLIMPNIVLSLSSLPSPVIPFQ
FT                   HRTNDLNGLHWMISMIPILVAEHFSLDHTVPKPLTLRGLDAESLILLFPLHQALIPTLD
FT                   FLLTTSILPAELQLLTTALINLYLFAASPQMEILKALLWLGGMCLFASCRHILRWEVSL
FT                   ARIPSWKFRRAPHGSKSLRKFLNMVDHRVCEKLSRTGHVPSDGASSDSDGPNGFPFSRP
FT                   RKTKTMQENGSSHPAAEPVSAVDKITTEEIFEEHARVVHRRRHTISTFDEVVREERVRT
FT                   TPGGRRKKMMGPGLAVFLSLTSAQAQVRKWLYAFYVYVLCLVIVLGPIRKYVAEHALQG
FT                   QDPFGWAIGYLFGNFSRVRFWVLMLNLEYWIELPPRPDADILSASCFLGSVEHIRQTTF
FT                   GAAITRLLLSGYCVLVLLTGLAIVIKLSSVAEVDTRRKIFHGMMVVMFLPAIFVDPAFC
FT                   AMALALVLSIFLILDLFRASQLPPISRPLTSFLTPYVDGRDHRGPVIVSHIFLLIGCSI
FT                   PLWLSLSDLPRTGLGPWAGWEIPSRDVSMASGVICVGMGDAAASLVGRRYGRLKWFWGG
FT                   GKSLEGSAAFVAAVTCGLIAVRAWLVLGGWPVSGVESAEGTAFSAHFWAWTLLKAVLAA
FT                   AGTSATEAILTGCNDNVVVPVVLWLLVRGLGV"
FT   CDS_pept        complement(825386..827674)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189770" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943423"
FT                   /orf_name="Pc18g03510"
FT                   /product="Pc18g03510 protein"
FT                   /protein_id="CAP94575.1"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0001831E29"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBB7"
FT                   /transl_table=1
FT                   /translation="MSAAQPSAPGLNVIALISGGKDSLYSILHCIRNGHKVVALANLYP
FT                   EPQNKSSTNPKQPKRDEEDDIDSFMYQTIGHNIIPLYETALQTPLYRQPITGGAVDTSR
FT                   IYGTKPSEKDETESLVPLLQRIKKAHPEANAVSAGAILSTYQRTRIESVANRLGLVPLA
FT                   WLWMYPSLPAPPARSADTLAIRQAGLLEDMAAARCDARIIKVASGGLDEGFLWENVSGA
FT                   GSGGRMMRRCLVKAMSRFAAAEDIRGAVLGEGGEYETLALDGPGFLWKQRIEVGSREEK
FT                   VGEGGVAFVRLRGARCTAKSAREIGDGIAPSDIRRPGLLDAVFEGVLDSALDFSGSRDD
FT                   SKSRAMTSTARSPDWPVCEPVHRLSGSTWTISNIVAPEAGPGAGEQMKAIAHKVQKLFK
FT                   SFSHPKSGSRSTDDIVFATVLLNSMADFGSMNDIYVSLFKKPNPPARVTVACGDRLPSN
FT                   VKVMVTFVVDLGARDRRQGLHVQSRSYWAPANIGPYSQALSVPLQNASRLVYIAGQIPL
FT                   DPGSMDLAQVEGPGSWVENYRLRAVLALQHLWRIGEAMQVNWWLGAVAFLARGEHANTQ
FT                   AQVAWRLWERMHALPDNEDEDDDDGPQLDAWDIKYGRRTEELTDAPVPSLPQFTALVVS
FT                   HTSIPPFLAVQVDELPRGSDIEWQGLGGRCEQVKLDIQGGTSSTTMDNQYKYTSIEIDA
FT                   GSSDETLKQILRSVNEAYRRDSSLSQAVLYTTYPVPEPLWPVQVVPCRSVWGREGRRLS
FT                   AGVVLQQLS"
FT   CDS_pept        join(complement(830075..830580),complement(830009..830025),
FT                   complement(828821..829965))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189781" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943424"
FT                   /orf_name="Pc18g03520"
FT                   /product="Pc18g03520 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP94576.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831E2A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBB8"
FT                   /transl_table=1
FT                   /translation="MDSTYTMAPTSVQGQPFTYYPDSTQRQGHYQSDVPFYGQMQYGQE
FT                   QPLYSPQPMMNMHQMATTNAFRGATMSLTPIASPQPSQMKPTIMVQQGSPGLMPLDTRF
FT                   IGHDMYSFPSTPPLSASGSTISSPPSAHGALPTPVHDTFFTFDKVEGVKEGCETDVHQE
FT                   ILATPESHFDKFFIHPPSVTHIHGSDLLSATSCPSLSPSPSPVPTDILASQSLGSSQSF
FT                   CDPRQLTVEPSVNVHAQDLPPLPNLSCEEEEPRAVVGSASVTLPVNENPSPSFSSSTQD
FT                   PLSSLPTFDSFSDLDSDDELNRLVEFHPAANAVYMGGKRQRVHAYPVEDDGFLSEHSLE
FT                   DSDDSETFMPNGLPSFEWTQTAQPQAEAEEEPVEEPKTKKRSNRKSRKIAADEAAEAKA
FT                   LAACESSGDCCSDDGSVDDSESAPISVNRRGRKQSLTEDPSKTFVCTLCSRRFRRQEHL
FT                   KRHYRSLHTQDKPFECNECGKKFSRSDNLAQHARTHGGGSIVMGVLDASDAGSVSFDDQ
FT                   HDAGALGQVMYEAARSTEVTGTTSVDRRATKKRKRDLS"
FT   CDS_pept        join(complement(838789..838842),complement(837627..837770),
FT                   complement(837314..837460))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943425"
FT                   /orf_name="Pc18g03530"
FT                   /product="Putative uncharacterized protein Pc18g03530 "
FT                   /protein_id="CAP94577.1"
FT                   /db_xref="UniParc:UPI0001831E2B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBB9"
FT                   /transl_table=1
FT                   /translation="MYWNCTYTGRKSQLVRRTDRTESKKSFDRTSLDLICPICLICGLQ
FT                   ADLYPQVESGGGSRTIPHSVELEMGKKPSKFKLIAPHEPPTRCTADPQQILPETNPASH
FT                   VLPATFALAL"
FT   CDS_pept        join(complement(842153..842228),complement(841907..842054),
FT                   complement(841038..841809))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189802" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670544"
FT                   /orf_name="Pc18g03540"
FT                   /product="Pc18g03540 protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="glycerol ether metabolic process "
FT                   /protein_id="CAP94578.1"
FT                   /db_xref="GO:0006662"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI0001831E2C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBC0"
FT                   /transl_table=1
FT                   /translation="MSVIEISSKEQFTSLLSSSRLVVADFHADWCGPCKAIAPAYNSLA
FT                   TQLSRPNLITFTKINVDHQQELAQAYGVTAMPTFIVFKNGRVNQTVKGANPAQLNQIVQ
FT                   KLASEASQSDEAATGEGSSSGEPWIGGAVPKGYSDITDQVDVKGLELLNRDTDTAEPRA
FT                   LFNISKPSGLAAKGKAKAAGQPDWTESDTDEQLMLYVPFNAMLKVHSIQITSFPPAEAD
FT                   GDDDETPMRPRNLHIYKNTSHVLGFDEADGIPPVQKVEIKPGDWDVKTGTATVPLRFVN
FT                   FQNVTSLVMFFVDGDGDSEKLRVDRIRVIGEAGANRSMGKLEKIGDEPGE"
FT   CDS_pept        complement(843109..843714)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670545"
FT                   /orf_name="Pc18g03550"
FT                   /product="Pc18g03550 protein"
FT                   /function="heat shock protein binding"
FT                   /protein_id="CAP94579.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007872"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI0001831E2D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBC1"
FT                   /transl_table=1
FT                   /translation="MTRTAHAVDLYEILSLPFTGSSSTVLSKQQIKIAYHKALLKHHPD
FT                   KAGAVARETGLGGPTNSTSTSTPNPLFPRSDGNSSRQLYTIDQITTAYKTLSDPALRAE
FT                   YDRSLRLDRLKVAEREKTGNVFHTGLEIVDLEDLACEEAEGGDGDCWYRGCRCGDERGF
FT                   LVNEEDLEREAEHGEIIIGCRGCSLWLKILFAVEADEG"
FT   CDS_pept        join(complement(845200..845559),complement(844386..845123))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189824" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976523"
FT                   /orf_name="Pc18g03560"
FT                   /product="Pc18g03560 protein"
FT                   /function="heme binding"
FT                   /function="peroxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="CAP94580.1"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR002207"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniParc:UPI0001831E2E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBC2"
FT                   /transl_table=1
FT                   /translation="MASAARTASRAFLRSTPATSSFRPAARSTRFAIPANGLRASPRRG
FT                   YASEAGPEKSGSSFGIWALGLGALGGGAYFYLNGDSASSPKKPFVPTQADYQKVYDAVA
FT                   ARLADDTDYDDGSYGPVLVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKT
FT                   ARDFLEPIKAQFPWITYSDLWTLAGACAIQELGGPTIPWRPGREDRDVAACTPDGRLPD
FT                   AAKDQRHIRDIFSRMGFDDREMVALIGAHALGRCHTDRSGFDGPWNFSPTVFTNEFFRL
FT                   LAEENWIQKKWNGPKQFTDKSTGTLMMLPTDMALMKDKGFKKHVERYAKDSDVFFKEFS
FT                   DVFVKLLELGVPFKTEDRFVFKTSE"
FT   CDS_pept        join(complement(847263..847410),complement(847030..847191),
FT                   complement(846550..846656),complement(845775..846119))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943426"
FT                   /orf_name="Pc18g03570"
FT                   /product="Putative uncharacterized protein Pc18g03570 "
FT                   /protein_id="CAP94581.1"
FT                   /db_xref="UniParc:UPI0001831E2F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBC3"
FT                   /transl_table=1
FT                   /translation="MACPDTNDSHLPMRLKAEALSEPSRSRNDSQEYLLVRQYDQPSYD
FT                   RGIGGQGHVTALVQSRAIKLKIKTFPPHTFPPSAIIRVLETRESNPLMSGIVEDLDPTC
FT                   RQLNARGNGVFCIDGSVGLNMCYCPRGMGSEGSSRTWIITEQAAKRWARGQTGRSGKQV
FT                   ESGGVGLRWPNSALLLITPMDVSEISVFFLTHASSVRCTSLYCQFNKYNLLGLQRNIEI
FT                   VKNIMTEVKEVKVWGCTMMYRNAEMDETPRQ"
FT   CDS_pept        join(847833..847947,848007..848023,848086..848196,
FT                   848268..850415)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189825" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943427"
FT                   /orf_name="Pc18g03580"
FT                   /product="Pc18g03580 protein"
FT                   /function="ARF GTPase activator activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of ARF GTPase activity "
FT                   /protein_id="CAP94582.1"
FT                   /db_xref="GO:0008060"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0032312"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniParc:UPI00018310F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBC4"
FT                   /transl_table=1
FT                   /translation="MAPGISKREQARNEKTLAELIRTVPGNDRCADCDALTPGWASWNM
FT                   GIFLCMRCAALHRKLGTHISKIKSLTMDTWTSEQVDNMKSHGNILMNKMNNPRGIKPPI
FT                   PTDIDEADACMERFIRQKYQHRSLENGKPKPPSREDSSYSNHRAPSPVESRKNDYNISP
FT                   EGSPPPLPPKSGRFFKFGLRSSSSTSNLRRFGGKPKVTSPTSDDGAWSPPPLQSRKTTG
FT                   LGAPVADVTTASFESKMAALQQMGFTNDRRNEMVLKGLHEDLDRAVETLVRLGEGGNPA
FT                   SRSRTPAGTSSGASARVVIPKPETSKNPFPVTTDNTFPEVSNNPFDRAVSNPVAPSQTQ
FT                   QPQTTAYNPFDQMNGKPASTQPLESYFQGLQVSQPLFPHSTGGYPNQTSSMQHSLHQQS
FT                   YTPPVTATFAQSPYVTSPQPMDKSYNPFDQAPPQPQGGLASQTYPNPNVPQTNPFFNTA
FT                   PQNQPMQPQQQRMNPLMTKPGGFEPPRHANTMPVMSSSSPFGLTAPSQVQQQQPQMQMQ
FT                   MQPQMQPQQQQQQPSNGLGAYNPFQQGPAPNTAQSAGGYPNQFQSHLQPQLQQAQQLMP
FT                   QRTGMDKNSILSLYNMGPAQSNMTTIAEQPQQPQQPQPSQAPPPSMNPYAQPSNQYTSM
FT                   SHTQQATNFQNQHQPQPQQNSQSQQPTANTQPTTSNNPFFGTAPTGSGSGLAAQAGINT
FT                   YQQQSTGLGIGGMNDQPGAGTTTGTTPSTGTNNSPFSGMSSPPFAGANSSPFAGGKSPF
FT                   SGPPPTNSAFPRTHMSQPSVDVSGLQNGRHSPDAFASLSARYG"
FT   CDS_pept        join(complement(853166..853363),complement(852885..853115),
FT                   complement(852701..852813),complement(852414..852560),
FT                   complement(850912..852361))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000189846" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823318"
FT                   /orf_name="Pc18g03590"
FT                   /product="Pc18g03590 protein"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="CAP94583.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniParc:UPI00018310F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBC5"
FT                   /transl_table=1
FT                   /translation="MSKPISPRTPQIPRAPTQNILLFLIAFRLVNAFAVRTFFQPDEYF
FT                   QSLEPAWQIAFGQGQGAWVTWEWRHQLRSSLHPLFFAALYKTANFLASALSVSPATRAE
FT                   LLIAAPKTAQAVVAAIGDFYTWKLAVRVYGDDSRGSWTTLVATVLNPWQWFCSTRTLSN
FT                   CLETTLTIVALELWPWQCLHQCLPLAALACILRPTNILVWATLAGLAWLRTSWPQRKIL
FT                   IFEVIVCGSAILAVSSVADRLFYGIWTFPPLRFLYFNIAQSLAVFYGSNDWHYYISQGY
FT                   PLLLTTLLPFALIGLYRTLTTRKSTVGDSLQAAIRVQLATVCLLMPFVLSLISHKEVRF
FT                   IYPLLPCLHILAAPPLVQFFYPAIYSRAYPRHTPRRLILIFLVLVNVVIALYTTLHHAS
FT                   GTLRVLSYLRQQHEAHSVPTKRQTNSVSETGISAGFLMPCHSTPWRSHLVYPTINAWAL
FT                   SCEPPIDLNATQKAVYRDEADQFYDDPFQFLRQNMAGGLRHVPRRPSYASSAHDFVPGK
FT                   STNKAPQHEWPDYLIFFAQLEPTLYAILRGSYYGECWRTFNTAWHDDWRRRGDIVVWCL
FT                   DTAEQDAWRSNTERQLRQSRDKQFDRIVEAFKNEGRKQRKQGWMGLHVSSMPWSSSPPS
FT                   LFASWRRSVKALFSSPSKSSIPWPWRPASRWEKFVTRLSFSKQKTSWLPSWMSDWLPVL
FT                   PSWLGGAERRPTEAELWS"
FT   mat_peptide     join(complement(853166..853267),complement(852885..853115),
FT                   complement(852701..852813),complement(852414..852560),
FT                   complement(850915..852361))
FT                   /db_xref="UniProtKB/TrEMBL:B6HBC5 "
FT   sig_peptide     complement(853268..853363)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBC5 "
FT   CDS_pept        join(854113..854580,854653..855354,855413..855598)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020206" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943428"
FT                   /orf_name="Pc18g03600"
FT                   /product="Pc18g03600 protein"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="CAP94584.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00018310F6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBC6"
FT                   /transl_table=1
FT                   /translation="MATNGSFSHYHAASSAEAIEAEHEYAAHNYHPLPIVFARAQGTSV
FT                   WDPEGRHYLDFLSAYSAVNQGHCHPKLIAALVDQASRVTLSSRAFYNDVFPRFAKFVTG
FT                   YFGFDMVMPMNTGAEAVETGIKIARKWGYKVKGIPENKAVILSAENNFHGRTFAAISLS
FT                   SDPESRENYGPYLPGIGCTIPGTEKPIAYNDKVALREAFEAAGPNLAGFLVEPIQGEAG
FT                   IVVPDEDYLQEARALCDKHNVLLICDEIQTGIARTGKLLCHEWSGIKPDLVLLGKAISG
FT                   GMYPVSCVLGRKDVMLTIEPGTHGSTYGGNPLGCAVAIRALEVVQEENMVERSEKLGHL
FT                   FRDGLLAIQSPIIQTVRGKGLLNAIVIDESKTNGHTAWDLCMLMKEKGLLAKPTHQNII
FT                   RLAPPLVITEEEIQKALDIIKEAVTDLPNLKGASEDKVIPPPEKKVKIALEN"
FT   CDS_pept        join(856481..859381,859445..860806)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19823319"
FT                   /orf_name="Pc18g03610"
FT                   /product="Pc18g03610 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94585.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI00018310F7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBC7"
FT                   /transl_table=1
FT                   /translation="MSAPQPLHKVVVADDKLQGNTSRSASGEADVQPMQKKKWYRRLNP
FT                   LRLQKIPPVPTERSVSHEHGASIFSIISFQWMSPLMKVGYLRPLDLQDIWTVNPDRAVD
FT                   VLSGRLDAALEKRTESGINRPLLWALYDTFRFEFLLGGICQLFSSLLLVFAPYLTRYLI
FT                   AFATEAYVAQKAGHPVPHIGKGMGFVVGITCMQALQSLCTNQFLYRGQVVGGQIRAVLI
FT                   SHIFNKAMKLSGRAKAGGQATPEEAKALEATKDALLKPEEKAKKQKPDNALPAPGGVAG
FT                   DGRGWNNGRITALMSIDVDRINLACGMFHMIWTAPISIIVTLVLLLVNIGYSCLSGYAL
FT                   LVIGMPFLTFAVRSLITRRRNINKITDQRVSLTQEILQAVRFVKFFGWESSFLGRLKEI
FT                   RGREIRSIQTLLAIRNGILCVAMSIPVFASMLAFVTYALSNHDLDPAPIFSSLALFNSL
FT                   RMPLNMLPLVIGQVTDASTAFNRIQEFLLAEEQKEDIERDENMENAIEMDHASFTWERL
FT                   PTDEKDAQKAEKKAAARPEPTEKSTPEDETDETPTEPFKLKDMTFEVGRHELLAVIGTV
FT                   GCGKSSLLSALAGDMRVTDGTVRLGTTRAFCPQYAWIQNTTVRNNILFGKEYDETWYEQ
FT                   VIDACALTPDLEILPNGDQTEIGERGITVSGGQKQRLNIARAIYFNAELVLMDDPLSAV
FT                   DAHVGRHIMDKAICGLLKDRCRILATHQLHVLSRCDRIIVMDEGRISAVDTFDNLMRDN
FT                   EVFKRLMSSSRQEDMQEEEEEAVDEAVDETDEKEPSSKKAAPAKPTAALMQQEEKATES
FT                   VGWSVWNAYIKASGSYFNAIIVFILLGLTNVANIWTSLWLSYWTSDKYPALSTGQYIGI
FT                   YAGLGGSVVLLMFAFSTYMTTCGTNASKTMLQRAMSRVLRAPMAFFDTTPLGRITNRFS
FT                   KDIQVMDNELSDAMRIYALTMTMIISVMVLVIVFFYYFVIALVPLFILFLLASNYYRAS
FT                   AREMKRHESVLRSMVYARFGEAITGVACIRAYGVENQFRRTIRDSIDVMNGAYFLTFSN
FT                   QRWLSVRLDAVATLLVFVVGVLVVTSRFNVSPSISGLVLSYILAIAQMLQFTVRQLAEV
FT                   ENNMNATERVHYYGTQLEEEAPLHQAEVSPSWPEKGHIEFNSVEMRYRAELPLVLQGLT
FT                   MDVRGGERIGIVGRTGAGKSSIMSALFRLTELSGGNIKIDDIDISTVGLHDLRSRLAII
FT                   PQDPALFKGTIRSNLDPFNEHNDLELWSALRKAYLIDQEQELEGEELPNGSGSGTATPV
FT                   TGSDVKARPLNRLTLESPVDDEGLNFSLGQRQLMALARALVRDARIIVCDEATSSVDFE
FT                   TDQKIQHTMAQGFDGKTLLCIAHRLRTIIHYDRICVMDQGRIAEMDAPVALWDKADGIF
FT                   RAMCERSGITREDILSTN"
FT   CDS_pept        complement(860952..861611)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000263121" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127608"
FT                   /orf_name="Pc18g03620"
FT                   /product="Pc18g03620 protein"
FT                   /protein_id="CAP94586.1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="UniParc:UPI00018310F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBC8"
FT                   /transl_table=1
FT                   /translation="MPPKRVAIVTSSTRSPRLNPTITQYVYDVLTSDPMIPTNHNETTD
FT                   TDPRHITLEILDLANQSLPLYDESVIPASLPAADPTPHYSKAHTRAWSAVVRQYDAFIF
FT                   VTPQYNWSIPASLKNALDYLFFEWKGKPAGIVSYGGRGGGKAADHLRGVLTGLRMRVVG
FT                   TAPGLSVKFTGLPVGVLSEEEMVRLDERDLVGWREAGVEGMMRNLGMELVCELDKV"
FT   CDS_pept        complement(861972..862715)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976524"
FT                   /orf_name="Pc18g03630"
FT                   /product="Pc18g03630 protein"
FT                   /protein_id="CAP94587.1"
FT                   /db_xref="UniParc:UPI00018310F9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBC9"
FT                   /transl_table=1
FT                   /translation="MDRVFSRDYDPVAKSDADGDSDATITSRPSRRGFQQFLKRNLAAI
FT                   TITGLLMILLLLAIAVITAIAVEPFHKVLVVNGPSSDSLAYPETLEGKRQCLPPAPRVR
FT                   YSCGNSTKEAEALGCSYDPLAGCWLHKECPHDFTDEFAHFNNGKPFVYFYDEAATQQMK
FT                   DYTELGNNPDFYWTAVREHLVHCLYLLRRGHDVHMRGARLDNMLADLEHVDHCTNMLAN
FT                   WLRRPDPALEEIGTQGQTHCFMSCA"
FT   CDS_pept        join(complement(863729..863857),complement(863421..863654),
FT                   complement(863311..863364))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000193252" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943429"
FT                   /orf_name="Pc18g03640"
FT                   /product="Pc18g03640 protein"
FT                   /protein_id="CAP94588.1"
FT                   /db_xref="UniParc:UPI00018310FA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBD0"
FT                   /transl_table=1
FT                   /translation="MKSFFFMVFFVAAAIAQRATIGLPAENQKINSGEEVVIQVQRPNS
FT                   LSSSKEMGVAIGLSSCESAPCRDADEVLGTILYNGPFKPEYHESSLPPYENFTVTVPAS
FT                   ATLGKSQINIAHAALIGAGPSAFLESLNQTVYVV"
FT   mat_peptide     join(complement(863729..863809),complement(863421..863654),
FT                   complement(863314..863364))
FT                   /db_xref="UniProtKB/TrEMBL:B6HBD0 "
FT   sig_peptide     complement(863810..863857)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBD0 "
FT   CDS_pept        complement(866092..866970)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943430"
FT                   /orf_name="Pc18g03650"
FT                   /product="Putative uncharacterized protein Pc18g03650 "
FT                   /protein_id="CAP94589.1"
FT                   /db_xref="UniParc:UPI00018310FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBD1"
FT                   /transl_table=1
FT                   /translation="MFVDAEYVKPAFAGVPVYFRMNPVAPAPAQFGPEYFGPPAVGPSP
FT                   VPYGPYRPPPVYPALLNPAPPGPPPYAQPMMGTSFPHSQFIAPPPVNPAFNRPNFRMAA
FT                   SYPGEPVQIPENKPHECLVAHRKFMNWIHTVYYSSKSPEAFVQAWKRALKEMKQAFGPP
FT                   HLPTVFVLNQFLAAVSANPDTIPWVESLHFERGSLPASILDEAYADFLEFEACRLGKQQ
FT                   PVPANPHTAAPDANQTESLSKQYCPYHQRYTKHPVEECFRNPQNTKHKRKSRRKQAKRA
FT                   AALEAKKETQL"
FT   CDS_pept        join(869406..869605,869656..869789,869855..870007,
FT                   870064..870264,870317..870480)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189858" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943431"
FT                   /orf_name="Pc18g03660"
FT                   /product="Pc18g03660 protein"
FT                   /protein_id="CAP94590.1"
FT                   /db_xref="UniParc:UPI00018310FC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBD2"
FT                   /transl_table=1
FT                   /translation="MSSFSPRDFQEWVDRRQSTTSSSTVSSASTGILFPSPTTSPGSSS
FT                   RKQSWQFYDDVVRLELTPAVQISFVKSGQLFKLKYTFIDICKDSTGALRCLELGGGLGQ
FT                   QTPFIHGFSNTKLPVPHLEHPKTGDDYPLRVSFMDQQTVQTGSTVFMTQLSYKFDHWDD
FT                   CVRFQELLLGSKLIFIGGMAEAKSKGRGEECISQNLRILRGHNGKRVMLFFANSQRREL
FT                   KRYVSIPLNCIASIKPPKKAGRPALLELNPNFEILSQMRNLTVQFLDDDGQCAFKFLWM
FT                   IG"
FT   CDS_pept        join(871167..871229,871294..871401,871484..871815,
FT                   871874..872802,872857..873254)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171119" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943432"
FT                   /orf_name="Pc18g03670"
FT                   /product="Pc18g03670 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP94591.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018310FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBD3"
FT                   /transl_table=1
FT                   /translation="MGKFHHRLYKTDRARDFDHEQDRFVRMRQIYETIDRQKFQWIVVL
FT                   VAGLGFFLDGYTLFAGNVAIPMISYVYWRDDTSSLRLTGINIATLGGTLIGQVAFGFLA
FT                   DKNGRKKMYGVELVLLITATLGVVMSSTGVDGSMNVFAWLVWWRICVGIGVGADYPLSA
FT                   VITSEFAPTKHRARMLATVFFMQPLGQIAGNIVSLIVIAVARSNSSPGEDLTRTVDIMW
FT                   RWVIAIGVVPGVVATLFRFAIPESPRYLVDIVDDPITAEFDATTLFSDTPGIIDSGGWG
FT                   TTATCSAGSAIQLPPISSIASSSTFDIDDDDEFTRLPPATLNSHWRLARTDIIRYFWTE
FT                   GNWRHLAGCSLAWLLLDFGFYGIGLSSPQFLAKTWGELNITRPAPNWKTDETPNANLYD
FT                   MFMHTSVRGLIVLNIGSFVGGILLIAFAQKLDRVALQKYMFLGLAALFIALGTMFVCLY
FT                   SYPPVVVALYIVGQILFNFGPNGTTYMIPAEIFPTRYRASCHGISAGAGKLGSILVQIF
FT                   STFYHFGSGPGPESTRKHGIVLLVFSACMILGAIVTQYWIPPIQQKRNGRTKLWGGTPE
FT                   TLESLSLGRMGRRSRDADCRKRTSRHRALSMSA"
FT   CDS_pept        complement(873406..874965)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217765" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943433"
FT                   /orf_name="Pc18g03680"
FT                   /product="Pc18g03680 protein"
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /protein_id="CAP94592.1"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="InterPro:IPR003480"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI00018310FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBD4"
FT                   /transl_table=1
FT                   /translation="MTTIESTRLRPANQLPPTSTPLSILDATVARFSPTGAIWIFDQHQ
FT                   DLDQKTLIEHLRTSFIETLSKFPQWAGQLQWAPVKPKGNHSERFNRPLIVYGTDTDPGV
FT                   EWTVIEHAFRADEIAPTAEERASSTTRSQPSAWAGDAFNERLFISSSPLALANLRDYAG
FT                   LPGMQVQISLLQEGGYVIGVKMAHCLADAQTLMVFMHQWAHSSKKQFGNQPETPLIGEP
FT                   VFDPALLDSCAAGDTDSPEPDQGLVRIARKLPLHRYSWWDTAAEGYPPFLIPTTENSKP
FT                   PPGELEHRRVSPSEPAPWVSWDFSKKVRYTQLHFTAAGLSKLQAAALDTGGRRDISRLD
FT                   ALLAHLWIAIMRARGQADSSRCVYMDLSLGARARVSPALPDTFVGSPLFLTHVSGTASS
FT                   VCREITGETASRIRETMKGFTADAVGAMLHDAAHEVSPQRLWQAFLGSEHTLVTSWLRL
FT                   RLYDVDFVGGNKPRYVHAVMPKMDGCLQVMDSGVPDGGMDVALYLDEVAMGRLLDGGCS
FT                   WA"
FT   CDS_pept        complement(875523..876676)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(876709..877305)
FT                   /pseudo
FT                   /gene_family="HOG000076608" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(878544..879177,879234..880468)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000240003" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670546"
FT                   /orf_name="Pc18g03710"
FT                   /product="Pc18g03710 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94595.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI00018310FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBD5"
FT                   /transl_table=1
FT                   /translation="MAISNNIPPSHERVVPGSCNIELGQFPKTMSSESDVALDPNAIAD
FT                   KIINQLNTGLASRDKAAVASLFLENCYWRDHLCYSWDFRTLEGSQAISAFVTEIAPSKI
FT                   EIDRSVDFKSPHKAPIDAFGEVFGIEFYIKVTTENGQGNGIMRLAEDDGQWYIFTVFTS
FT                   MVEIKGHEENKERPFGVRHGEQQGRKNWKDRRIDEINFEDKDPAVLIVGAGQGGLTAAA
FT                   RLKMLEVDTLVIDREEKIGDNWRQRYHQLVLHDPVWYDHMPYLPFPPDWPIYTPKDKLA
FT                   DFFETYVKFRELNVWMQTEMKSSSWDDDKKQWTVVLERKTENGTETRTLHPRHVIQATG
FT                   HSGKKNMPSFEGMEDFKGDRLCHSSEHPGANPESKGKKAIVVGSCNSANDIAQDFVEKG
FT                   YDVTMVQRSSTCVVSSDSTLSIAFKGLYDGTGPPTEDADLYLTSVPLRLLKAQQVRVTK
FT                   LTNQNDAKTIEGLEKAGFKVDNGPMGSGLLMKYYHRGGGYYIDVGGSQLIIDGKVKVKH
FT                   GQEISQVLPHGLRFADGSELEADEIVFATGYQNMRTETRVIFGDKVADRVGDIWGLDKE
FT                   GEMRTIWRRSGHPGFWFMGGNLALSRYYSRMLALQIKALEEGLTTW"
FT   CDS_pept        join(complement(881531..881598),complement(880638..881451))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943434"
FT                   /orf_name="Pc18g03720"
FT                   /product="Pc18g03720 protein"
FT                   /protein_id="CAP94596.1"
FT                   /db_xref="UniParc:UPI0001831100"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBD6"
FT                   /transl_table=1
FT                   /translation="MDFAVDSPDTIRTYDSDTSSEERPSSQPIKTRIQASFQIARPPPK
FT                   SSQLLRLSPKLLLQIQQLQPNHRPVPVLEIWQPPLRKSKLTRSFPQRPKLGTRDIYATL
FT                   NEPYITNKQPDEQDHPEEQDPHSNDTQEKDTVAAMCQPSSDIPSSIHFRDTKCIWQASA
FT                   SSAGPEKGTCYRFVIKKEDNTTGTEQCRMIMQWEKRTLAANGNAASGSPDNEQFVLMAI
FT                   DRKIRRKSRIATMTRGGIEILVRKSSILDHLRTCLVLTEPVSGGSADFETWLYTLVLTL
FT                   GVSVASQEGWLG"
FT   CDS_pept        join(complement(882667..883644),complement(882384..882602))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189938" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670547"
FT                   /orf_name="Pc18g03730"
FT                   /product="Pc18g03730 protein"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94597.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniParc:UPI00018311CD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBD7"
FT                   /transl_table=1
FT                   /translation="MTDQGDLPPPAGPLSRALWNFASVWFIVPQGTGIIAVILYRLKYQ
FT                   FNGLTTLATIVWIYTIVQLGLFLILYLIRTFLHPRHVLHQLRNNSAETSCLCCISIAST
FT                   SILEMAVLQYGDTAGLAIYIMWWVNTGMAIVACMVIPFIHLKMQQSGTRHMQADMLMPF
FT                   LAALTSAAGGGVICRLARISPRLQVPGIIISYLEVGAGLALVAAFETIILYQYFGRPSQ
FT                   SPDTVYQDMIMCGPCGQASVALQALGEAVQAGSFAAYDRGQLLTAEAAGPFAFISHFTG
FT                   LLVWGHGVFWWFFAILTICYTLHTQPGGWKQSRFTMAVWSVVFPWGTFTNAAVEFGRIM
FT                   DSPAFDVFSTALLLLLVLMWVVIQIFTLKGIVTGRVFGLDHGWRKRYDDRRPAVNKEA"
FT   CDS_pept        join(complement(884330..884549),complement(884197..884281),
FT                   complement(883870..884101))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943435"
FT                   /orf_name="Pc18g03740"
FT                   /product="Pc18g03740 protein"
FT                   /protein_id="CAP94598.1"
FT                   /db_xref="UniParc:UPI00018311CE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBD8"
FT                   /transl_table=1
FT                   /translation="MGLSNAAIIVIVLVACLAATALGASLFKHYKPADGETPFSPGYDQ
FT                   KVYMAEVRARGFNNLRQISWSGRDLESRYPAGPAYPGYYRPPTYTEDTNYTKDTGSSEL
FT                   YGLKVLREKALRREWVRLVSGDYAHASGYSDSVGHGGLDNFSFEIMILWYGVALDLRAT
FT                   HLEIIALQSICFICI"
FT   mat_peptide     join(complement(884330..884480),complement(884197..884281),
FT                   complement(883873..884101))
FT                   /db_xref="UniProtKB/TrEMBL:B6HBD8 "
FT   sig_peptide     complement(884481..884549)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBD8 "
FT   CDS_pept        complement(885799..886485)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127609"
FT                   /orf_name="Pc18g03750"
FT                   /product="Putative uncharacterized protein Pc18g03750 "
FT                   /protein_id="CAP94599.1"
FT                   /db_xref="UniParc:UPI00018311CF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBD9"
FT                   /transl_table=1
FT                   /translation="MPAKYPEFEPLGETFRRWMESADEPGCYIPRTTLTVAGLDPTLWH
FT                   VVSSPKPLTLEWEAWADTFGLTLGDPASGQTMYLDQSVLKIKGEYTYWMGRIGPGVIFI
FT                   DNMKRAQDPTNFHMSEFTKALYESHYPLESLKCVIVTMIIQAETRPFIREDIYGSRGLG
FT                   FPPKEPQTWQSPSPEFCGILGTPIGKVVAAFVLCAYGQGVKRIPRIVTFHTSLAGLNIR
FT                   FDIEDV"
FT   CDS_pept        join(887322..887397,887453..887858,887954..888005,
FT                   888195..888281)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943436"
FT                   /orf_name="Pc18g03760"
FT                   /product="Putative uncharacterized protein Pc18g03760 "
FT                   /protein_id="CAP94600.1"
FT                   /db_xref="UniParc:UPI00018311D0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBE0"
FT                   /transl_table=1
FT                   /translation="MASCTLYSISASLAIRLVGRLSLRARPRTQGALPGPNRILEGYCD
FT                   PLAEGVTGLFQAGKRLWARQKQTTEAVIVTGNRVVKASGTSVDLEMGIDKLDSRRVAVL
FT                   MVDKNCLVDLGELCISPKSLVFTSGVTSSPVRRHQCDGHIDNGIATISVYHPHNVVSVG
FT                   SEDISHAWQYIDCKAVDIESAANGLLVWESSLRLNSPLVPFRR"
FT   sig_peptide     887322..887381
FT                   /db_xref="UniProtKB/TrEMBL:B6HBE0 "
FT   mat_peptide     join(887382..887397,887453..887858,887954..888005,
FT                   888195..888278)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBE0 "
FT   CDS_pept        888825..890153
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823320"
FT                   /orf_name="Pc18g03770"
FT                   /product="Pc18g03770 protein"
FT                   /protein_id="CAP94601.1"
FT                   /db_xref="UniParc:UPI00018311D1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBE1"
FT                   /transl_table=1
FT                   /translation="MLIPFLGIFLGMTLWSQWFPIPGFTAPEQSFMRRLSGTFQLTMES
FT                   WAFCDLVNAAASKRGHASQGEHPVWESPHVGHGYANSTDTVFSLGTDVIVRHSLADEMP
FT                   PWFLTPFLVPISVSSWSSDGVTSSDPEEFVDIHQLRPKPEQDYFATLLLFLGVWCFLQV
FT                   LWDLIAYQRQLCSGLGTLIEWILKVLEGQAQIARVQFVAEEDSSSFDEEMDRLIAGPTE
FT                   TDEEILSWVIAADNCPESVSHVSVLSQFRGIWVHRITENLGDEQSLDPVSACNTTNPVD
FT                   TTDDARANLVSRHPWNSTDLYASDPDDSPAPAESPIGNGAEDERPDSTPAYFSRRNRPS
FT                   QAKRRRDAKKARQERKELQHSNVLASYASRASLAMSSSSTPLSALAPVFVPGRLAEQGD
FT                   SQSGPPSPTPLFANVNIDPPTDCGTTSPDDSAPHPAHRRRRRR"
FT   sig_peptide     888825..888899
FT                   /db_xref="UniProtKB/TrEMBL:B6HBE1 "
FT   mat_peptide     888900..890150
FT                   /db_xref="UniProtKB/TrEMBL:B6HBE1 "
FT   CDS_pept        join(complement(891249..891316),complement(891137..891184),
FT                   complement(890910..891012),complement(890700..890831))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943437"
FT                   /orf_name="Pc18g03780"
FT                   /product="Putative uncharacterized protein Pc18g03780 "
FT                   /protein_id="CAP94602.1"
FT                   /db_xref="UniParc:UPI00018311D2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBE2"
FT                   /transl_table=1
FT                   /translation="MANGVHAQAGLINVPQATVKMTIRLLPPEAVWKTDTVPMTSSPRC
FT                   CVAAHGIAFTENREPSRIELKNEKDNQDTRAEDPLREDDRTEIVVTVVESRRTEIRWQI
FT                   SSPDSKSKNKAT"
FT   CDS_pept        join(complement(891858..892022),complement(891710..891797),
FT                   complement(891582..891652))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943438"
FT                   /orf_name="Pc18g03790"
FT                   /product="Putative uncharacterized protein Pc18g03790 "
FT                   /protein_id="CAP94603.1"
FT                   /db_xref="UniParc:UPI00018311D3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBE3"
FT                   /transl_table=1
FT                   /translation="MERLIQRPWTNVLIDTDEHMRLSEDAKTPIVFRGLIQHKVLVKVL
FT                   WREEKGAARQSTKALIMVHPPVCNVQQPLGGKSDDKIGIGPIDGHGALDPAKAGLTAQR
FT                   RAT"
FT   CDS_pept        join(complement(895758..895864),complement(893147..895661))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183635" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670548"
FT                   /orf_name="Pc18g03800"
FT                   /product="Pc18g03800 protein"
FT                   /protein_id="CAP94604.1"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00018311D4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBE4"
FT                   /transl_table=1
FT                   /translation="MEDTSPTEDTFVHQGSSASLSLKTCFDRLPLNVIEHILYASDANT
FT                   FASLSLLNRRWKHASDSEALYAYQLSRCSSFSWARGLISETESLTKLKRQFVKEVRQNA
FT                   FDAFLRPRQTLVRLISSSMSSSTAFPQGEVFRFSFSGNGQMVLCITSSRIVVLDVATDP
FT                   VAVKHELMTRRRPLGATLRDDGSLIAVLSSTHRVHIYQLSDDEAKHIQVITLNDAPRDI
FT                   KFSPAGSVLALAFEDSIEVYAVGGEALPTDRRAVRCPRVDALSFSPDGAMLLGFADEGI
FT                   VTITPPFYTETGTDASPEELEMRMWTTQILFPETIDCHITHGSLIAGHEDADDLWVMGY
FT                   DQQLGAFRALQLNKNAGIVYFASPFLTDESREMRPSMRPATDYAAELSALGFQDSELWI
FT                   YGMPGLGASEITGTEIGGGHHYGGCAPRDNLAQLQKIVQQPKILIRGRRVSDMHGITSA
FT                   HWVHSDSKRRRLVAVAPGGVRSQNFGGEDIPVDGGRILLLDFERSTMNGESIVLDIEVG
FT                   ETAPKILMEPDSSLATEVELERRRTRLHRGDTATNFAGLSHSATTREARALPLHLRRNS
FT                   LAIPTSPSETARGEIVDLPYDNTQPRSSEVLHRAATAAASTRGRYDPRYRSSHNPRHIP
FT                   HESDADAWVPPPPPYKRETVDPLPEHLQRLLLPPANAANSSLPLGREETVPAAQEAARP
FT                   RPQSVNLQRVGNISSARRRGSSIGRDFNPDQLVPQDSFTNGLSPEQPRSASRPPTATQP
FT                   TTPTFAVYPAQLQPHENTMPLPYLGASALGDALGDAYFPYSVSSPNLLHIPQPYQEGQG
FT                   TAADDEHEIPQRQRSFQRRVSTEPSSLPPPTNEEWRRRIQDWNDNTIKERGRKRRGKCQ
FT                   VM"
FT   CDS_pept        join(896423..897126,897190..897627,897680..898061,
FT                   898114..898249,898302..898720)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943439"
FT                   /orf_name="Pc18g03810"
FT                   /product="Pc18g03810 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94605.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018311D5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBE5"
FT                   /transl_table=1
FT                   /translation="MSPAPVQVNSSSKLPSPGFNAGARPYRSHKVRACDLCRKRKSRCT
FT                   VDIPGQSCLLCRVQGADCHYQEEANADTSVLSAPDSKSWAGPPVMEPVPGQKRKRSDDG
FT                   LAHMSQNMPPRQPANGPSPHGTTSSGGRRGSDSRRKDMDDPQNESVLIVGPMVAEDAQV
FT                   IEKHMPPERMSQSEEPKSHPYNIYSSDPRKPVLYTTISRRRKGMRRGTPPGENQKEILE
FT                   QILGPFKHDLVRLFIDRFNVSFPIFDGESFWESYMADDLHDPPAALVCQVYSMSLVYWK
FT                   HTQNLACHPKPDVRYAINMTVAALHEEFSAPGLDTISAALIDLTGRPIFSMTGNAVSCG
FT                   RMLSLANCLGLNRDPSNWKLSQAEKNQRIRLWWGVVIHDRWGSFGHGVPPQISKNQYDV
FT                   PLPTVDVLVPSNLRTTERVRAAHCHIYLCRLTETLGELLPLVYGLQHKPARETSKKLRQ
FT                   IRTDLDIWEDSLPDWLRGPTVHPGERIYGASSLQLAFLAVKMLVSRVELNEVNNSETEN
FT                   TEARRYFQTECRRSAEEIVGFITSLRKNNFTEFWLPYSAFHLTSTATLLVRCAFETTDS
FT                   DVARSCLSNVETLRSVLRRVREEEDWDVADMCLDHCERIMHRLPGTGATMDQAFTTTMA
FT                   DSGLVNPAAISLPETQTNNDIVDDMMSISNTFGTMDGFPFDMTGIWDVSVFQDVNLT"
FT   CDS_pept        join(complement(900370..900609),complement(899611..900312),
FT                   complement(898968..899558))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183658" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127610"
FT                   /orf_name="Pc18g03820"
FT                   /product="Pc18g03820 protein"
FT                   /protein_id="CAP94606.1"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00018311D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBE6"
FT                   /transl_table=1
FT                   /translation="MLSRAVLPLTRPNVFASAVRASTLSARPSPYAAYKLSPGIQLRAK
FT                   SNKSKSNTPKAAPKDFAAEQPEFDTKAESTQPSESAEQPPQKPLPDLTQGIPSTLAAEL
FT                   EGRMKKGPLNLTEDPTQSEEYETEGRGGGDIPKGGYETSIDRRKARMANIVYAGMLFAG
FT                   IAGMVYLGRNWETEEEAQQHPETPSGWSPGLWYNRIKARTSDLTSYYKDPAFPKLLPDE
FT                   DAEMRQPYTLVLSLEDLLVHSEWTREHGWRVAKRPGVDYFLRYLNQYYELVLFTSVPSM
FT                   MADQVLRKLDPYRIIRWPLFREATRYKDGEYIKDLQYLNRDLSKVILIDTKEEHARHQP
FT                   ENAIILDKWTGDPKDKTLVALIPFLEYLAGMGVEDVRTVLKSFEGTPIPIEFAKREKAM
FT                   RERFEKDLAEEQKKRPSRGLGNFAAALGLKSSVTLNGEQTPSEGLAQGKMLWDQIRERG
FT                   QKNYEMIESEIRLNGEKWLAEMAAEEEKARQEQMQSMKGSFTGMFGGGSKEQ"
FT   mat_peptide     join(complement(900370..900531),complement(899611..900312),
FT                   complement(898971..899558))
FT                   /db_xref="UniProtKB/TrEMBL:B6HBE6 "
FT   sig_peptide     complement(900532..900609)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBE6 "
FT   CDS_pept        901054..901926
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183669" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943440"
FT                   /orf_name="Pc18g03830"
FT                   /product="Pc18g03830 protein"
FT                   /protein_id="CAP94607.1"
FT                   /db_xref="UniParc:UPI00018311D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBE7"
FT                   /transl_table=1
FT                   /translation="MGFKKKMIHFEEQLSDVDSEPEGPEILQQFPFLRLPSEIRLLIYH
FT                   YVLFTPTRKSTLKRTGGNVGSSAKKSKPLAPSSHRVALFLVSRQIHDEATHYFYSTQTF
FT                   RVFPVQDFLRMPTIRALPRRHRSSITTIELIVGSSWTAPPKSWVVNQGLGLHDMELVRT
FT                   LKVFVQCDPSHPVFEGFRISKDYYTNFCGKLLSQILERLPGLVQVEFDAWPSVEKNGPL
FT                   MTRLLEETRNAQKNVLWGPDRGWSDTQDDTHEKHELIDVDAAFDGLRAYSPDVVEALSN
FT                   SLQTVKLES"
FT   CDS_pept        join(complement(903336..903404),complement(902978..903231),
FT                   complement(902384..902919),complement(902184..902329))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943441"
FT                   /orf_name="Pc18g03840"
FT                   /product="Pc18g03840 protein"
FT                   /protein_id="CAP94608.1"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI00018311D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBE8"
FT                   /transl_table=1
FT                   /translation="MDRLNRMLQAAQGMGMGGAAPGGDTPNLIDNSETVHISSLALLKM
FT                   LRHGRAGVPMEVMGLMLGEFLDEYTVRVVDVFAMPQSGTGVSVEAVDPVFQTRMMEMLR
FT                   QTGRPETVVGWYHSHPGFGCWLSSVDINTQQSFEQLTPRAVAVVVDPIQSVKGKVVIDA
FT                   FRLIQPQTVVMGQEPRQTTSNLGHLNKPSIQALIHGLNRHYYSIAIDYRKTGLEENMLM
FT                   NLHKHVWTEALEMSDFHEEGQHNVERMKQLVLLAEGYEKRIKEETELNKDQLKTRYVGK
FT                   LDPKKHIEDVSQQLIEDNIVAVSRQMIDKEASVARQSSKEDTNGAAMEVDEDL"
FT   CDS_pept        join(903946..904128,904184..904484,904538..905079,
FT                   905126..906025)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943442"
FT                   /orf_name="Pc18g03850"
FT                   /product="Pc18g03850 protein"
FT                   /function="histone deacetylase activity"
FT                   /biological_process="histone deacetylation"
FT                   /protein_id="CAP94609.1"
FT                   /db_xref="GO:0004407"
FT                   /db_xref="GO:0016575"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="UniParc:UPI00018311D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBE9"
FT                   /transl_table=1
FT                   /translation="MALEPISDRLLGSKNKKVAYFYDSDVGNYAYVSGHPMKPHRIRMT
FT                   HSLVMNYGLYKKMEIYRAKPASKYEMTQFHTDEYIDFLSKVTPDNMDHFSKEQSRYNVG
FT                   DDCPVFDGLFEFCGISAGGSMEGAARLNRNKCDVAVNWAGGLHHAKKSEASGFCYVNDI
FT                   VLGILELLRFKQRVLYVDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEYFPGTGELRDIG
FT                   VGQGKNYAVNFPLRDGITDETYKSIFEPVIKSVMEWYRPEAVVLQCGGDSLSGDRLGCF
FT                   NLSMRGHANCVNFVKSFDLPTLVLGGGGYTMRNVARTWAYETGILVGEPLGSELPYNDY
FT                   YEYFAPDYQLDVRPSNMDNANTKEYLDKIRNQVVENLKRTAFAPSVQMTDVPRNPILDG
FT                   MDDEADDVMDDLDEDENKDKRFTQRRFDQRTEKAGELSDSEDEDENAANGVRRQPGGMR
FT                   RRNQVNYRNLEPDSGLDSGMATPQDGSSAADGEMDFALDAKMTDAPRTEPEAPFAGPQA
FT                   SHADQTPITDADNMAMESEEQEAPTASQHQSPHPHEEDTTMEDAAAVAEPTTSEQAPAK
FT                   APSTEEKSLVEGSAASPVRAQSPPKEAADSTLEKSAEASAPTVDTEATATKEENLEPMA
FT                   EPKKEE"
FT   CDS_pept        join(906572..906585,906757..906807,907049..907373,
FT                   907455..907487)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943443"
FT                   /orf_name="Pc18g03860"
FT                   /product="Pc18g03860 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP94610.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="UniParc:UPI00018311DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBF0"
FT                   /transl_table=1
FT                   /translation="MSKRGRGGAAGNKLKMTLGLPTGAVMNCCDNSGARNLYIISVKGI
FT                   GARLNRLPAAGVGDMVMATVKKGKPELRKKVMPAVVVRQSKPWRRPDGIFLYFEDNAGV
FT                   IVNAKGEMKGSAITGPVGKEAAELWPRIASNSGVVM"
FT   CDS_pept        complement(908085..909809)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943444"
FT                   /orf_name="Pc18g03870"
FT                   /product="Pc18g03870 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP94611.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI00018311DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBF1"
FT                   /transl_table=1
FT                   /translation="MSLRWLLSRTFAHLLPITVIATVYLYLYPVLNGCAFPLPQSVSHS
FT                   SEKQLYRNSVINTLFQHLGVSTSDTNGQPAIFRLLVLADPQLEGDSSLPFPEYELYPRM
FT                   QTHWRAIQEAIGNSSTSPLLNEDVLSNITTGLQTLATEDIPRAFKAGVKRLDLFGNDYY
FT                   LAHIYRTLFWWTRPTHTTVLGDLVGSQWISDDEFAWRGHRYWNRVFRGGERVDDNITRT
FT                   GAAGWSEGEGNNAPLLEPLGADRAWSRRVINVAGNHDIGYAGDISEARMERFERVFGRA
FT                   NWDVRFEHPPIVSSSASESTGDQLVTPTLHLINLNSLMFDTPALSAEIQSHTYSYLNEL
FT                   IARRLSPVEDRSAFTLLLTHLPLHKEDGVCTDGPYFSFRDSDDKDGPDGVPRWLDGGLK
FT                   EQNHLSDTLSASGVLQGIFGLSGDENALAGGQGRNGLILTGHDHTGCDVVHFVNRTETA
FT                   DDNGSSQAWKWAAERFNKSRHIDDPSIREVTLRSMMGEFGGNAGLLSAWFDEVAGEWSY
FT                   EITMCPAGVQHVWWAVHVLMLVTLGVALLWSLSSSAQVKTAPQRVDSVQKTQNGQKK"
FT   CDS_pept        join(complement(913559..913607),complement(913335..913478),
FT                   complement(911042..913260),complement(910481..910978))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183715" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943445"
FT                   /orf_name="Pc18g03880"
FT                   /product="Pc18g03880 protein"
FT                   /protein_id="CAP94612.1"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="UniParc:UPI00018312B3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBF2"
FT                   /transl_table=1
FT                   /translation="MGPPQGVRPGDILEVLHEFGGRGEDELIMLPRDKIELIELDEGFG
FT                   DAWYYGKNLRTGQTGLFPANFTTKPGAPRKTLAESPVLVESPTQLESSAPADSSFASVG
FT                   SGQSTPQASRHASSDDMQSPQIGSPTQHRSASSPLPRPSLAADIQQAFRGSMDNHVNGE
FT                   ESPVMNETLSVIDEHITDMNTPRHSVSTREPRTINDSGSEYSSHIGHRASYINGHETDD
FT                   EEQSHPTEQEVRKWSQSQTARCLRGLGIDPKHCDIFEEQEITGDVLLDMDQDFLFMKEF
FT                   DFGVMGKRLKTWHKIKAFQEETKGFSQQQARKDSISSFSGPSDERALSRAGHTGPLLPR
FT                   IPTLSEKNGAGYPRASAPVQHPRLASNNSSPMTPHTPPYSHDSPRRISAASLRDLNQAR
FT                   RHSSIDATQRGMSDSVVVGHQKKPSFDRSWTLNSGPQSMPVRPGTSAGTSSGGLQSGPL
FT                   TAESGSHTNSYISTPDQIEDLDRGYFSGTELDSRRTRRVLQKRGSTGVGVNNHSRKSSY
FT                   AEDQYRVMSPAKRHSRIGSVDSIRDAAKHVSTAAHAYHGTPPKSRMRSLSTRVSTDRSG
FT                   NNSHSSTTESRTSNSGFFANFSRVNKGDSESSSSRASPMQFQPLKNAGPKFRRAMGLRA
FT                   ISDVVGKKIDTSASPDSPQESEPISARTGSTTPSATSKSSERHSTDGSGKAATDGHGFV
FT                   VRPRTVKSKKETSAYTRGLEKKTPHEQMDGCDYSGWMKKRSSNLMTTWKPRLFVLRGRR
FT                   LSYYYSEDDTEERGLIDITAHRVLRADQDPIIALHATITGSTALPANANNTDGNGPFFF
FT                   KLVPPKSGNSRTVQFTKPATHYFQVDNVQQGRLWMAALMKATIERDLGQAVESTNKQKT
FT                   ISLKQARLMNQRPPELMPASGSTKTSQTINEEEEEAGLQLEGLNLSQSDANSFEDTNGS
FT                   LDINNTDGGLERPLSNPLGDLDSGHSSLLPDPLAKTESK"
FT   CDS_pept        join(914023..914102,914267..914291,914337..914396,
FT                   914487..914581,914615..917885)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823321"
FT                   /orf_name="Pc18g03890"
FT                   /product="Pc18g03890 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP94613.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="UniParc:UPI00018312B4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBF3"
FT                   /transl_table=1
FT                   /translation="MYNTQIIPKIAKKKRRKAKGESDVCKFFSIPFSYIMNPVIHGFLP
FT                   KSQDGSYYVYRVPYLYCSLCTDPFLFWYLSAKLLGFFVPTWLLDQNHPDAFYTYSIVMV
FT                   SPKSRSHASADHIEESNTTANLFLGGVRRNWMGPQTNAPENSATGNPRVEVDLTVTPES
FT                   LPQAVLMSPVTPGETLNQPRSRGSIHTKTPDTPATALPSPVLSTNSHPSPVNADAIVSS
FT                   RPPTLPPISTQLTAQRGDDERMAVQPPSGLATSRSATQSPLMGPNRSTNSPSNTGTRTA
FT                   HTTQGSIVSGSRPSPLQIGGTGAAAIPNEVWEQWSGQLDALVNELSAIGAIPARRDTTI
FT                   TRPRIQLLCNAISRKDAFYLVTHQLYCQYSIDPSILGQIRAPESGMRSLIPLLEDNGKM
FT                   HDAAVIVFAHFPASPQQLMQSRWYLQMLSGVSEFLARLATEWQGILNHSLQAQHPPLVS
FT                   RLWQALACPSPMLMSVMFTCAARRLHHDKDIEALLKLFWTDFKAFQRCKESEAPETTHQ
FT                   ALNRQITQEYLNFPRSSESQTPSSSHPVRPPRAQNQTMSQVPLPPSHPRSSLAGVSQPA
FT                   ANSPALTPPGASLQPLPSNLPQGQVVGPPGHQFNVNSPMQNTPQSPYYNPMSQGQGQWQ
FT                   GTGLWYLVNSQMNPQMSPQTQMHMQAAGHVPPSRRHQAPPGPHGQQMQRRTMPTTSVAP
FT                   ANSSIASLQPSALTSAHPSQSLYAPSPITTTPTTTNHMAQHPLPPQMPNNHYNRQHSMN
FT                   LQSASPSTRVPPQGQPPTGQHFQPLPNSAFLPVPGHRAPMMVNPNPTRFGLHMVDLRDP
FT                   MKKLVKRSSDGNEVETDLFTYLDTFVVYPTFVNVDQSIYTWNFSFTHDERQKFPHVAHG
FT                   KEGQHSVWTFRPGCRTIRLRCIRLPGDSNTVAEQTWSTASTFWPSVFYISVNDKELFVR
FT                   RKVHNGKDLPLDITESLKAGENSVRLDMILGQDECKTSKYAFGVEVMEVAEFDQILSLV
FT                   QSISAADSRAAIKKRLSPTTDDDDLAVVTDNLTIDLVDPFMARIFDVPVRSRHCNHHEC
FT                   FDRDTFIRTRKSVSGPTPMVDNWRCPICKGDARPQFLVVDQFLVEVHAQLARTHRLNGI
FT                   RAIQIKVDGTWTPKYDTDETSPAADRPFSPKRKAESPFGPVAVRTKKDVSSGSHSPAVR
FT                   AQEPTVIELD"
FT   CDS_pept        join(complement(919917..920007),complement(918318..919858))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183748" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976525"
FT                   /orf_name="Pc18g03900"
FT                   /product="Pc18g03900 protein"
FT                   /protein_id="CAP94614.1"
FT                   /db_xref="UniParc:UPI00018312B5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBF4"
FT                   /transl_table=1
FT                   /translation="MSEGPSDLSSSHLEPTSRTTEMQDPGAGDHTSESDEEYFSDASEG
FT                   NPQPQSLPQSGRTSPVPRTRVERVDNSTQHGETPGTAAFGKRQQDAVPDEIEVIPEGSQ
FT                   SQTRSPVGSENQGLCTEGLPVPRTVVEKVDPDEPSHGEVPGTLAHEQRLADAVPDVVTK
FT                   ASDSDSSPTPPTINSTPPEVDGPTADIPETRLERVDTIATEEDLSSHPHAHTSSTSDAL
FT                   PDAVETVPDVSIDDTDLKPKDLSLEDDMNDDHGYEKQEAGDDFDEFVEEQEDMGDDDFG
FT                   DFDDGFQEPNAEEAPTVETTAPQQFHAPPPLTDFDTFKSTSELLDSLQDTLDILFPESQ
FT                   DISSLTPVEPIPDSAAIFSTERSLSLWSQLVAPPPLQPQNWVKSRIRRLFLVSLGVPVD
FT                   LDEILPASKQKKLVLPSIDIEGTGAKSPGARSRSRVRKEEGNDNITEKGRAPSRQKATP
FT                   RRGVPPAPEIDLSAVRRLCATTDAALNGLTDAELKLHVQELNQFAQRASSVLEYWLKRR
FT                   DGLVGEKEAFEGVIENLVSHVRRVRK"
FT   CDS_pept        join(920467..922100,922160..922283,922348..922557)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183759" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976526"
FT                   /orf_name="Pc18g03910"
FT                   /product="Pc18g03910 protein"
FT                   /function="structural constituent of nuclear pore "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="CAP94615.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0017056"
FT                   /db_xref="InterPro:IPR007758"
FT                   /db_xref="UniParc:UPI00018312B6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBF5"
FT                   /transl_table=1
FT                   /translation="MAFSFGAPASTGASSGNLFSTAGNAFGANKDSNASSGGLFGNVTA
FT                   SSTGNSAPSLFGANSASGQSTPTFGNAGASSATNGGASAFSFGGKAPSGTGTQPNSLFG
FT                   AAAGSQTPNKSTESTTPASNSVFGGGGAKSLFGNAAPTATPAPAGGNLFGNNSTTPAGP
FT                   PPASNPPSSLFGAAKPADSTTPTAAPSSTTPATSQAQPSSNMFGGGPSKSLFGGGATPA
FT                   APSGGLFGASKPAESPAPTTTAETTPKSLFSAAAPAGGAQSSQTPSLFKNTAAPSGDSA
FT                   SKPAFPALGAPASAATTTPSLGAPATSSATPQKSLFPSTGSATSTAAPSTTPATAPLGG
FT                   GLFGASAPSTAPGTAATAAPATTTAAAPTGGLFGQATTTTPSTQPATSASSAPLSGLGS
FT                   KTTTAPTTTAAGAAPAAPSALGQSTTGPAPPAQSRLKNKTMDEIITRWATDLGKYQKDF
FT                   REQAEKVSEWDRLLVDNGTKVQKLYGSTVDADRATQEVERQLSAVEGQQDELSSWLDRY
FT                   EREVDEMVTKQVGPGESLQGPDQERETTYKLAEKLSERLDEMGKDLTSMIEEVNGASST
FT                   LTKTNKADEPISQIVRILNAHLSQLQVIDQGTSELQSKVTAAQKAGQSISARLGYGYPN
FT                   NGMGNNNTADDFYRSFMQGR"
FT   CDS_pept        join(complement(924342..924347),complement(922768..924231))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943446"
FT                   /orf_name="Pc18g03920"
FT                   /product="Pc18g03920 protein"
FT                   /protein_id="CAP94616.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00018312B7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBF6"
FT                   /transl_table=1
FT                   /translation="MYAPSRTTLPSSYTEAPSILPGLSPRHPSKYPSMTLLSLPNELLL
FT                   AISGSQDCQRDINAFARTSRRCYVLLNPLLYAYNVRQHQGSALHWAASQGQLRTAQESL
FT                   RQGAQINSRNRKTGKTPIIQSVHSDHADIVALLLAHGADLNAKGGGGPDEAIISAVTRN
FT                   KAAVARVLLDHGVDVNLTDYRGSLLHIAARRADKNREEVVRVLIEKGANIESTHVGETP
FT                   LHVACESGSVEVARCLIESGARLDTWGRRGSSLLHAATNEVKGVKLLVEKGVDIEVKDD
FT                   QGETPLHRACWNGRAETAAFLLDQGADIEARSLSGKTPLLLAVLWESSVCKQLGPASVT
FT                   TLLLERGANPSRGNDSNITPLQCVTTKGTTSLFKLLLQYGADVEPKTRLGATPLHSLAD
FT                   SGALESARHLLQKGADAQPRNGEGNTPLHLAAQRSDVEFVRLLLEAGADRLVKNHKGQL
FT                   PVHLASEGARESEERQRKVVDLLEPQFGHQR"
FT   CDS_pept        join(complement(925373..925506),complement(925169..925234),
FT                   complement(925044..925109),complement(924939..924957))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183772" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823322"
FT                   /orf_name="Pc18g03930"
FT                   /product="Pc18g03930 protein"
FT                   /function="enzyme inhibitor activity"
FT                   /biological_process="negative regulation of nucleotide
FT                   metabolic process"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAP94617.1"
FT                   /db_xref="GO:0004857"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0045980"
FT                   /db_xref="InterPro:IPR007648"
FT                   /db_xref="UniParc:UPI00018312B8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBF7"
FT                   /transl_table=1
FT                   /translation="MLRQFARPAATANRAVFTRSFSVAVPRMGEGDTGAPRPSGGASSG
FT                   DAFTKREAAQESLYIREKELEKLAQLKKKINEQRKHLDELETHIDGLRR"
FT   CDS_pept        join(926971..927031,927088..927636,927696..927766,
FT                   927829..927936)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000240379" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943447"
FT                   /orf_name="Pc18g03940"
FT                   /product="Pc18g03940 protein"
FT                   /function="protein domain specific binding"
FT                   /protein_id="CAP94618.1"
FT                   /db_xref="GO:0019904"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="UniParc:UPI00018312B9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBF8"
FT                   /transl_table=1
FT                   /translation="MGHEDAVYLAKLAEQAERYEEMVENMKVVASADVELTVEERNLLS
FT                   VAYKNVIGARRASWRIVTSIEQKEESKGNESQVTLIKEYRQKIEAELAKICDDILEVLD
FT                   EHLIKSAQSGESKVFYHKMKGDYHRYLAEFAIGDRRKGAADYSLEAYKAATEIASTDLA
FT                   PTHPIRLGLALNFSVFYYEILNSPDQACHLAKLAFDDAIAELDTLSEESYKDSTLIMQL
FT                   LRDNLTLWTSSEAEPASESAAPAEKKEEAPAAEAEKPAAE"
FT   CDS_pept        join(928556..928564,928628..928721,928820..929136,
FT                   929349..929423,929580..929771)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823323"
FT                   /orf_name="Pc18g03950"
FT                   /product="Putative uncharacterized protein Pc18g03950 "
FT                   /protein_id="CAP94619.1"
FT                   /db_xref="UniParc:UPI00018312BA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBF9"
FT                   /transl_table=1
FT                   /translation="MALTVPESTFAYSQYLHSLPVGSTATDSASRTSIDPNPISIQANY
FT                   ILDTFQSSMKYIESHTTDRIGNAKGILRRRSQCNVPDNESALCYKYLTRMCGHVHMPAY
FT                   CRRTAMISVAVLAGLLSLGAPVGVTSRLIVFFTRYTPRGLDKKGYADNKGEMEDLRRAR
FT                   SWRAPPNIEKACEEREEDTWTAPKDPLRCFPLPTPFCCGDNRHHAMPMTKKHFNALARA
FT                   IQSNRV"
FT   CDS_pept        join(complement(930884..931203),complement(930605..930788))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183794" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943448"
FT                   /orf_name="Pc18g03960"
FT                   /product="Pc18g03960 protein"
FT                   /protein_id="CAP94620.1"
FT                   /db_xref="InterPro:IPR019357"
FT                   /db_xref="UniParc:UPI00018312BB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBG0"
FT                   /transl_table=1
FT                   /translation="MASDTEMTEASPVDTLPQPNDGGRMHMSSLSSSSSISDAETERRG
FT                   RSERPRMASRKPSASILVPRDHPEIEIEEEEFPPDDARAMSPRRNSADLERLGKEARQT
FT                   LQEQAKALQSSLQALAERIDAVKSDHDKLENENKILQDYIGGLTRNMTKSEMTRGTKAR
FT                   KAQK"
FT   CDS_pept        complement(935380..937101)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183805" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943449"
FT                   /orf_name="Pc18g03970"
FT                   /product="Pc18g03970 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP94621.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI00018312BC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBG1"
FT                   /transl_table=1
FT                   /translation="MAPQHTSFAPLGLSRSLYHILILCFLSFSAVTNALAYPSQETLGV
FT                   PSSSSSIDDPSKETVFGGTESAPEGSIHDPILNTLQDLIAALQVMQDRYFVLWQGTWPT
FT                   SIDWTAAVLGTHVSAALSSLTSGPLDIPDTDELQGLSFFRLENTVNQFFSHTSAFYFGE
FT                   NSFSLRNQAYDDMLWVVLGWLENIKFQNLHSDLHYVSSSNSSGELWYGTQFQNSAAHRA
FT                   RIFYELASAGWDETLCKGGMIWSPYLLPYKNAITNELYISASIEMYLYFPGDPIEAPFL
FT                   VDSQGTQPARKNPHDPVHLQAAIDGYEWLKNSNMTGIGGLYADGFHISGWQSTSNPGSG
FT                   QCDELNSMVYTYNQGVILSGLRGLWLATNSLDYLRDGHELVREVLQATGWPHTSNQQWK
FT                   KLGRGGVLEDACDSRGACSQDGQTFKGIFFHHLSAFCRPLQPQEKQFLADAVRKHTAHD
FT                   DWAEVYEQHMKQCRTYGPWIKHNAQAALMTRDNDGKFGTWWGRSYLQLDANEVVDSSTI
FT                   PEGAVDYRNADYEIQPSTTGSTSKDYNDRGRGRTVETQSGGVAVLRALYQWQSYDE"
FT   mat_peptide     complement(935383..936993)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBG1 "
FT   sig_peptide     complement(936994..937101)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBG1 "
FT   CDS_pept        join(complement(938430..938675),complement(938080..938307))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183826" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943450"
FT                   /orf_name="Pc18g03980"
FT                   /product="Pc18g03980 protein"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94622.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR008111"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00018312BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBG2"
FT                   /transl_table=1
FT                   /translation="MSNEMEIDPPVAHDDVPEQSDRSFEPRTQGNAVAVRSIEGWIIIA
FT                   SNIHEEASEEDVTELFAEYGEIKNFSLNLDRRTGYVKGYALIEYSTLPEASEAIQNLNG
FT                   SKLLEQTLHVDYAFVRPPPSGKHKNGGPKGRATRNRSRSPNRSRSPEAGGDRD"
FT   CDS_pept        join(complement(940033..940562),complement(939489..939969))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183838" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823324"
FT                   /orf_name="Pc18g03990"
FT                   /product="Pc18g03990 protein"
FT                   /protein_id="CAP94623.1"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniParc:UPI00018312BE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBG3"
FT                   /transl_table=1
FT                   /translation="MAFFLRRPFAVSSALRHVPKVTNTARFIHNSPIKPTQATKPQGIS
FT                   SSIFAKSRQNFQNAFRRTYMQQSFNPAQGGNMTQKLVYGAAIIGGTVMATNFIFNRETR
FT                   EDGGMPAYERSFLNDTFMHTGLGLGIIGVAARALHMNGWSYRLMAMNPWLVMGVGLVGS
FT                   IGSMYGTFYTSPDNYVMKYGCWTAFNLTQAALLSPLMFMNPAILARAGLYTVGMMGSIA
FT                   FVGATAKQEKYLYLGGPLLAGVTIVALSGLAPMVLPATAVRTLMWSERLWLYGGLAVFG
FT                   GFTLYDVQKILHHARLAERGLIKRDVVNECVSLELDFINIFIRMVQILGMGNNRR"
FT   CDS_pept        join(940818..940973,941033..941155,941222..941521)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000272647" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943451"
FT                   /orf_name="Pc18g04000"
FT                   /product="Pc18g04000 protein"
FT                   /protein_id="CAP94624.1"
FT                   /db_xref="InterPro:IPR013926"
FT                   /db_xref="UniParc:UPI00018312BF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBG4"
FT                   /transl_table=1
FT                   /translation="MASSLETISLSHLPLMPVHVALYRNIQNAAFLKGQLLAGDTEFEY
FT                   AFIDASMVLSRAHATAAVFRAVNDYMHNRLKSRNVHSEIVFSLNPTNNIAESFRRFGIT
FT                   DSTKDLLVVKVSVSPEITHESVAAHLESSVQGTPVLFDDQTLSEISDINKIKKAYKLGA
FT                   LPSPTAKENDEAKQRLENSLLSAIALRGS"
FT   CDS_pept        942256..944910
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183849" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943452"
FT                   /gene_name="slx4"
FT                   /orf_name="Pc18g04010"
FT                   /product="Structure-specific endonuclease subunit slx4 "
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94625.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="UniParc:UPI0001831385"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HBG5"
FT                   /transl_table=1
FT                   /translation="MTSMADVIILSSSPHPPRSPGPGRHDTKPVSHALPRSATPPPIRS
FT                   TSDLSQPHTRSRFFPTPVASNKCPDGASKPKKRLTKDPASETSKQTAPSKPRREAKKVA
FT                   GAPGTTALGEPQPEAVGKKNDAVKPTKSRSRRNAKSKDSGNMTLAGKVTKTSGDLPSKK
FT                   SSKGGKKTVATKLSPSEDTSEKSTPKESNALGKDEVLRLDEAMRRRMDWTPPRETAYEE
FT                   IATVTDRGSQDQDRDSSSSGGFGKLVSDYNYSGSALHPRDFVQNANGEGPTKRRRIELV
FT                   NPEIQALLNGRYSDSSDQSSGQGENTGKPKKTTKGKPKKFTTLTARMTAQYSKNDAEED
FT                   EPVIDCLAGIRTTKGRQKKAKEIEKQSSSTVLSPEAAVEFLNDQDLIFGSCSQLEKDDS
FT                   PETLRETQQAIRVPEGPSYSKGTHNKDPSAIQESSTRFVSKLAGTRNLWCVGARDTEGS
FT                   LIQPETLNVVDLTNGEESPGKKSQDDAENPSHNTLQSDWYELEFADIDSPSEKRPSPLP
FT                   TESVLDSDTQVQAPAPIPADTATATATATAVVKAAKPAKGANDTPTEAVDSQPASSQAP
FT                   PMPQYTGFTDAELSKQVSSYGFKAVRGRKKMIDLLRQCWESKHGSGSNAASDSQLICQL
FT                   EQQEEPASKMDNVPKSTSAAKTKATVKPKAGTSIRNRKSLDATKSTSASRTNLQTSPKK
FT                   NSREKPITGTSTSFIDVEEIQDSEEEIIPSPSQVQKHYTDIYSKSKTGSWVQDHSLDIL
FT                   TKTPSPSPTKRKVVSSDIPAKRPPSSASIATTRMTESSKEISLAEISAQITQAVRLQPQ
FT                   LSPLSSSRGSRSRPTWHEKILMYDPIVLEDFTAWLNIEGLGLVGEDREVGTASVREWCE
FT                   SKGICCCWKKNAS"
FT   CDS_pept        join(complement(945722..945907),complement(945385..945645),
FT                   complement(945310..945336))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976527"
FT                   /orf_name="Pc18g04020"
FT                   /product="Pc18g04020 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94626.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831386"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBG6"
FT                   /transl_table=1
FT                   /translation="MDTPDFTIPDDDHVNDAPSENPPKSKKTRRSRYDPEPDWSAMVRA
FT                   KVTKTQHRVGQACDRCKLKKMKCTPDPGGCACCLILNIPCKVTDRVTGETWVRGEAGRM
FT                   RAIIESLKKQTEDLKEQVTQLQQKNAQLQDCLDGSYRANLMDHYEIWFFKFED"
FT   CDS_pept        join(complement(948477..948563),complement(947665..948402),
FT                   complement(947545..947610),complement(947266..947478))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184141" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670549"
FT                   /orf_name="Pc18g04030"
FT                   /product="Pc18g04030 protein"
FT                   /protein_id="CAP94627.1"
FT                   /db_xref="UniParc:UPI0001831387"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBG7"
FT                   /transl_table=1
FT                   /translation="MSNRSDIPCSEEMREYYEGIPAHWPEMPATPSVGSHSPYCTEPLA
FT                   PNGMLTPISLPDSSFRASPAVSYHAQGYHHVHEYQYSINDPLSAPLGLGISAPFPSDYP
FT                   RSSAPDPTYLYAPDPSGIQHGLAQTPSQSPQGPPPAKRARHVSAEASSREYPSNTPINI
FT                   APNPEGVLRMEQSRQYVQPTSHILPKVRAPGRGRRDPQAEDEDAFVEELRDKQTAWKVV
FT                   REEFRERFNKDASEARLQMRLHRRLRERMVRWEESDVSMLPPCNAWCKQSVCCIKLLIH
FT                   AHGIWAKDKFQYLSDKMKELGGTRWYSPDQCRTQLQLLDTKEQHRDRTSASPSAMSDPA
FT                   PMTPTVSRKRRRAQSLDLDSDYDEATI"
FT   CDS_pept        join(948676..948718,948827..948941,949280..949374,
FT                   949590..949807)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670550"
FT                   /orf_name="Pc18g04040"
FT                   /product="Putative uncharacterized protein Pc18g04040 "
FT                   /protein_id="CAP94628.1"
FT                   /db_xref="UniParc:UPI0001831388"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBG8"
FT                   /transl_table=1
FT                   /translation="MKLEAKEDVGLQAADSCEQEKRGIFKSKRHAQVRLSSTLRDITAS
FT                   AGMPREARVVDDPPQSQSVALRALERSSGLWRAPLKPYLEEKEKKPLNSRLLNSNTPVW
FT                   GWERWRDYDPSSPMQRHCSRRAALDWPKMNQNPIEAEKTPRAAWWLLSTENS"
FT   CDS_pept        join(complement(951867..951966),complement(951492..951793),
FT                   complement(950854..951423))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231400" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943453"
FT                   /orf_name="Pc18g04050"
FT                   /product="Pc18g04050 protein"
FT                   /function="ER retention sequence binding"
FT                   /biological_process="protein retention in ER lumen "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94629.1"
FT                   /db_xref="GO:0006621"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046923"
FT                   /db_xref="InterPro:IPR000133"
FT                   /db_xref="UniParc:UPI0001831389"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBG9"
FT                   /transl_table=1
FT                   /translation="MVTWNVFRIIGDLSHAGSICVLLWAIHKNKSAEGVSLLTQILYGV
FT                   VFVFRYLDLFDPRTYTSGTWHSIWNVSFKLFYLISSSYLVFLMMKVFPRTRERERAWKL
FT                   GLWSVAGSLILAPISIWLLDTDDYNAWFIEFCWAFSIILESVCVLPQLLLLRQTTVPTV
FT                   IDSYYLLALGSYRAFYILNWIVRLFNKEPFHDWIAVVFGIVQTAFYVDFAWVYYSRQRV
FT                   KLRNGGVVDSEDYGNSWLVNRVVNFRASRNSVDEEQRLQDEEEGVDSQPNHNRWGARGI
FT                   SIAADDTLESNGHNKGHHHDDSLDGFSGDEDETNDHRVNNSR"
FT   CDS_pept        join(954859..954863,955011..955383,955454..955501,
FT                   955562..955594,955653..955736,955807..955848)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184130" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823325"
FT                   /orf_name="Pc18g04060"
FT                   /product="Pc18g04060 protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94630.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000183138A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBH0"
FT                   /transl_table=1
FT                   /translation="MSSPPTSKRLKTSATTSAPPHMLAQQQIHPFHRVPTFEGIPIPTA
FT                   PLPQQNPGASRKRPPSPTGSSAMMQAPGNPAGGTIDDPGAIPTVESTPKKKGRTNTPWT
FT                   AEEEQRLKTMRDAGRSWSEIAKTFPTRTEGSVKKHWYKDMHYAEFAEDESVKLREAIKE
FT                   YEANKWKVIGQKVGKPAKACEQYAKEHFKNV"
FT   misc_structure  956626..956722
FT                   /gene_name="TPP"
FT                   /db_xref="Rfam:RF00059"
FT   CDS_pept        join(956761..957222,957292..957442,957497..957569,
FT                   957621..957734,957792..958497,958558..958629,9
FT                   58664..958783)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670551"
FT                   /orf_name="Pc18g04070"
FT                   /product="Pc18g04070 protein"
FT                   /function="nucleobase transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP94631.1"
FT                   /db_xref="GO:0015205"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="UniParc:UPI000183138B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBH1"
FT                   /transl_table=1
FT                   /translation="MASENEITALAVHSSKEDPATFAPESPGVANKDEGLYAETTTNRR
FT                   NPVGSRLGSVIRAFENQLIEYNLEARGIERVAADERMKRNTWMSYLQVSLLWISINLAP
FT                   NNITLGMLGPAVYGLSFRDSALCAVFGAFVGSFVASWMATWGPVSGIRTLAFGRYSMGW
FT                   WPSKIIVVLNLIQMIGYGLIDCVVGGQILSAVSPGGMSVAVGIVIVAVISWAVATFGIQ
FT                   VFHYYERFAFLPQVIVVCILFGVSSVKFDLSTTSTGDPRTVAGNRLSFFSICLSAAVTY
FT                   TPLAADFFVYYPENTSRAKLFGLSLGGLLVSFTMALVSGVGLASGVSKHPEYSAAYEQG
FT                   QGALIVEGFSPLHGFGKFCSVICALGLIANTVAPTYSAGIDFQILGRYAEAVPRVIWNT
FT                   IAVIIYTVCALVGRSNLSEIFTNFLALMGYWVVIWIAIVLEERFIFRLRTGYNWHIWRD
FT                   PSKLPIGIAAFTAFVVGWVGAVLCMAQVWYIGPIAKLVGEYGADMGIYVGFCWTALVYP
FT                   PLRFIELRFMPCPSIRVSHIAAFGQGSARRLIRGFAYTTAFPRCIRLH"
FT   CDS_pept        join(complement(960249..960345),complement(960049..960102),
FT                   complement(959649..959807),complement(959410..959510),
FT                   complement(959250..959340),complement(959088..959176))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184129" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943454"
FT                   /orf_name="Pc18g04080"
FT                   /product="Pc18g04080 protein"
FT                   /function="cytochrome-c oxidase activity"
FT                   /cellular_component="mitochondrial envelope"
FT                   /protein_id="CAP94632.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005740"
FT                   /db_xref="InterPro:IPR002124"
FT                   /db_xref="UniParc:UPI000183138C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBH2"
FT                   /transl_table=1
FT                   /translation="MFLQRTASALARRSPARAFTLAQRPFSSSVIRSNEKKWAPKQEGK
FT                   ILTFDEIKGEDDLFAPGAKPGTIPTDLDQATGLERLELIGKMQGIDIFDMRPLDASRKG
FT                   TLQDPIIVNGAGDEQYAGCTGFPADSHQVTWLTVSRERPIERCLECGNVVKLNYIGPEE
FT                   DPHAHDHDHGHHHPPHVEPKTFADYVKPDYWYR"
FT   CDS_pept        join(complement(960889..961833),complement(960712..960837))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943455"
FT                   /orf_name="Pc18g04090"
FT                   /product="Pc18g04090 protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="CAP94633.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI000183138D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBH3"
FT                   /transl_table=1
FT                   /translation="MVNYAPHDSGKDANREDSIPYGATQLLQERPTEIRYHSNTTQPPF
FT                   GSPSTFITSHSPQRQPGSHYNTHGYRLSPIQGSRKRQRTDNGPEASEDTEHNYGYRPIL
FT                   QTLPMGDPSAPGGEPAGLTYADVGPSSSHQTSNQDYLQGSRKRRRTDNGPEASEDTEHN
FT                   YGYRPILQNLPMGDPSAPGGEPAGLPYADVGPSSSHQTSNQDYLQPALPQQHHHHRLPP
FT                   QAFGASSAGDQYQPQIDRSFMNLPGVPAPYPQPRAPKTRFGHKEDEMLIALKEHWKFSW
FT                   RQIECFFPGRKQQTLQVRYCTKLKERDVVWDIVLDQKLKKALEDYEDNKWAHISRKLGP
FT                   GIPPAACKLRAEELEC"
FT   CDS_pept        join(complement(966616..971192),complement(963654..966141))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184103" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127611"
FT                   /orf_name="Pc18g04100"
FT                   /product="Pc18g04100 protein"
FT                   /biological_process="nuclear mRNA splicing, via spliceosome"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAP94634.1"
FT                   /db_xref="GO:0000398"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR012591"
FT                   /db_xref="InterPro:IPR012592"
FT                   /db_xref="InterPro:IPR012984"
FT                   /db_xref="InterPro:IPR019580"
FT                   /db_xref="InterPro:IPR019581"
FT                   /db_xref="InterPro:IPR019582"
FT                   /db_xref="InterPro:IPR021983"
FT                   /db_xref="UniParc:UPI000183138E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBH4"
FT                   /transl_table=1
FT                   /translation="MASLPPPPPPPPGWGAAPPSVPLAPPPPGYQPPADPNVAKFAQKK
FT                   NEWLRTQRNRFGEKRKAGFVETQKADMPPEHLRKIVRDIGDVSQKKFTNEKRSYLGALK
FT                   FMPHAVLKLLENMPMPWESAREVKVLYHVNGCLTLVNETPRVIEPVFHAQWATMWMCMR
FT                   REKSDRRHFKRMRFPPFDDEEPPLSWSENIEDVEPLEPIQMELDDVEDAAVYDWFYDHR
FT                   PLLDTPHVNGPSYKKWNLSLPQMATLHRLSHQILSDVVDQNYYHMFDLNSFFTAKALNV
FT                   AIPGGPRFEPLYKDIDPNDEDFSEFNAIDRIIFRAPIRTEYRVTFPFLYNTLPRSVKVA
FT                   WYSHPQVVYVRTEDPNLPAFYFDPVINPISSRSVAPKNITVSHEDKIFGPGNNEDDEFE
FT                   LPGDVEPFFDDEELYTPDTASAIALWWAPHPFDKRSGKMVRAQDVPLVKQWYLEHCPQG
FT                   QPVKVRVSYQKMLKTYVLNELHKGTPKAHSKQNLLKTLKTTKFFQQTTIDWVEAGLQVC
FT                   RQGFNMLNLLIHRKNLTYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRLTKL
FT                   IVDAQVQYRLGNIDAFQLADGILYAFNHVGQLTGMYRYKYKLMHQIRSCKDLKHLIYYR
FT                   FNSGPVGKGPGCGFWAPAWRVWLFFMRGIIPLLERWLGNLLSRQFEGRHSKGVAKTVTK
FT                   QRVESHFDLELRASVMADLMDMMPEGIKQNKVNVVLQHLSEAWRCWKSNIPWKVPGLPA
FT                   PIENIILRYVKSKADWWISVAHYNRERIRRGATVDKTVAKKNLGRLTRLWLKSEQERQH
FT                   NYLKDGPYVSSEEAVAIYTTMVHWLESRKFSPIPFPSVSYKHDTKILILALERLRESYS
FT                   VKGRLNQTQREELALIEQAYDSPGTTLARIKRFLLTQRAFKEVKIDMNDNYNNINPVYD
FT                   IEPIEKITDAYLDQYLWYQAEQRHLFPAWIKPSDSEVPPLLTYKWTQGINNLSNVWETA
FT                   EGETNVMIETELSKVYEKIDITLLNRLLRLIMDHNLADYITSKNNVQLSYKDMNHTNSY
FT                   GLIRGLQFSGFVFQYYGLMIDLLLLGLQRASEMAGPPGSPNDFLQFRDRATETRHPIRL
FT                   YTRYVDKIWVFFRFQADDSRDLIQRFLTENPDPNFENVIGYKNKKCWPRDCRMRLMRHD
FT                   VNLGRAVFWDMKNRLPRSITTIEWDDTFASVYSKDNPNLLFSMNGFEVRILPKMRNLNE
FT                   EFSVKDSVWSLVDNSTKERTAHAFLQVTEEDVQKFNNRIRQILMSSGSTTFTKIANKWN
FT                   TALIALFTYYREAAVSTVNLLDTIVKCETKIQTRVKIGLNSKMPSRFPPAVFYTPKELG
FT                   GLGMISGSHILIPTSDKRWSKQTDTGITHFRAGMSHDEETLIPNIFRYIIPWEAEFIDS
FT                   QRVWMEYSQKRMEAQQQNRRLTLEDLEDSWDRGLPRINTLFQKDRSTLSFDKGFRLRAE
FT                   FKQYQLMKSNPFWWTSQRHDGKLWNLNAYRTDVIQALGGVETILEHTLFKATAFPSWEG
FT                   LFWEKAGFEESMKFKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGI
FT                   FLHGKIPTLKISLIQIFRAHLWQKIHESVVMDLCQVLDQELEQLGIEAVQKETIHPRKS
FT                   YKMNSSCADILLFATNKWNVTRPSLVFDTKDVYEPTTTNKFWIDVQLRYGDYDSHDIER
FT                   YVRAKYLDYTTDSMSIYPSATGLMIGVDLAYNLFSAYGQYFPGLKTLVQQAMAKIMKAN
FT                   PALYVLRERIRKGLQLYASESSQEFLNSQNYSELFSPQIQLFIDDTNVYRVTIHKTFEG
FT                   NLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVE
FT                   EQPKQLIVTRKGLLDPLEVHLLDFPNISIRASELQLPFQAAMKVEKLADMILRATEPQM
FT                   VLFNLYDEWLKSISPYTAFSRLILILRALHVNIDKAKIILRPDKTVITQEHHIWPSLSD
FT                   EDWIKVEVQLRDLILNDYGKKNNVNVQSLTSSEVRDIILGMEISAPSLQRQQAAEIEKQ
FT                   QEEQKQLTAVTTKTQNARGEDIVVTTTSQYEQQSFASKTEWRTRAIATSNLRTRANNIY
FT                   VSSDDIRDEGYTYIMPKNVLKRFITIADLRVQVTGYLYGSSPPDNDQVKEVRTIVMIPQ
FT                   VGNTRDVQLPHQLPQHDYLQNLEPLGIIHTVSGNEPPYMPAADVTHHARLMNAHPSWDK
FT                   RTVTMTVSFTPGSVSLAAWGLTPAGYKWGAENKDTTSDQPQGFSTNMGEKCQLLLSDKI
FT                   RGYFLVPEDNVWNYSFMGSSFGSVEKRPIYVKIDTPLKFYDDQHRPLHFQNFAELEDIW
FT                   VDRPDNFA"
FT   CDS_pept        join(971614..971637,971699..971712,971840..971963,
FT                   972175..972363)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216922" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127612"
FT                   /orf_name="Pc18g04110"
FT                   /product="Pc18g04110 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP94635.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR008195"
FT                   /db_xref="InterPro:IPR018065"
FT                   /db_xref="UniParc:UPI000183138F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBH5"
FT                   /transl_table=1
FT                   /translation="MTNNRLQYRRRNPYNTRSNKVRIVKTPGGELRYLHLKKKGTAPKC
FT                   GDCGIKLPGIPALRPREYSQISRPKKNVSRAYGGSRCAGCVKDRIVRAFLIEEQKIVKK
FT                   VLKESQQKAAKR"
FT   gap             973695..973794
FT                   /estimated_length="unknown"
FT   CDS_pept        join(976617..976709,976757..976849,976959..977012,
FT                   977181..977255)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823587"
FT                   /orf_name="Pc18g04120"
FT                   /product="Putative uncharacterized protein Pc18g04120 "
FT                   /protein_id="CAP94636.1"
FT                   /db_xref="UniParc:UPI0001831390"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBH6"
FT                   /transl_table=1
FT                   /translation="MGRQHAAADTADAAKDVRVTPAPWPTASVMRDRTRVSRERLRKTN
FT                   KEKEKSSRRSTSFPFTMESLFIRYMSPGAQYGVAEKTMVDTISGFVIDLDRCRGKAHTN
FT                   "
FT   CDS_pept        join(complement(978336..979067),complement(977683..978234))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944469"
FT                   /orf_name="Pc18g04130"
FT                   /product="Pc18g04130 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94637.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniParc:UPI0001831391"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBH7"
FT                   /transl_table=1
FT                   /translation="MDFSFHSQHFDRVQISDQDSNAGPLSQPEAPPQFSVPDWARWRSQ
FT                   LALPPKHYQGMSIPRLADSEYSLGPLSQDLIGDPSGHLDPYRSPVTPTLAGAPLEILAP
FT                   QAGESLPDWSLFQPSHVFKDQSYNYPQLDHLQPPPDSPPSPLSEVSSYHSPQSLAASSP
FT                   AMTVQTADRLSPRSGTGDNKEERPGHPPYSVLIYQALKEAPGNKLQLQSIYSWFEANTD
FT                   KARDPNAKGWQNSIRHNLSMNAGFEAVKEEVGPGKKAVNFWRLTPEAIHSGGIQSTTRY
FT                   RKLQHQKKAMNFGHRGPTRQPSESKGVHATKVVKSRSTNSPHSERAEAYHHHHQHMIST
FT                   NPSLGHEYGPTSVPAMQSYMQHPTGPVVGCTPMVPGNTLFVDSVESGPAFDVGHNHDWY
FT                   VPESVSNMVQDPLVGPGRSSPWDMKNEI"
FT   CDS_pept        join(complement(981637..982155),complement(981111..981575),
FT                   complement(980424..981053),complement(980326..980358),
FT                   complement(980255..980272))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184070" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944470"
FT                   /orf_name="Pc18g04140"
FT                   /product="Pc18g04140 protein"
FT                   /protein_id="CAP94638.1"
FT                   /db_xref="InterPro:IPR018816"
FT                   /db_xref="InterPro:IPR019134"
FT                   /db_xref="UniParc:UPI0001831465"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBH8"
FT                   /transl_table=1
FT                   /translation="MSARYPDRPDAKRSRSRSPSSWRQPQKHPRRDDRDWRDRQDSDRR
FT                   WNNERSGPSQQPRNMRDQVRLNLIQEDQQEREWVAQEDLFVLKQAKKKAEIRVKEGRAK
FT                   PIDWLTVTLRIIDPTRDPLDDEIADSDLDVVDPDGVFEGLSQTQLRDLEKDIDTFVNLE
FT                   TNAKNREFWQTMKVICRDRQKTVTPEGRALNSVAADINKLLSPKSYEQLQNLEVQVKRK
FT                   LNSNEPIDTDYWEELLRSLTVWKARASLKNVYQAIIDERVRDLRRQQRQEAESIREKLA
FT                   PLASVVIAGETTSHAEFGGLDPDPLLQVRPEDKNLEIMDESAFLNQVARERQKILRMGF
FT                   VPLRHRTAEKSSAAVSKPTSTNAPPASVSTRFSSIPNEDFSQATKALYERELAKGVSEN
FT                   EEIFTGEEAVSTSSQPQWAGKHRPRKPRYFNRVQMGYEWNKYNQTHYDHDNPPPKVVQG
FT                   YKFNIFYPDLIDKTKAPTYRIERENGRKRGESSAEAGEEDTCLIRFMAGPPYEDLAFRI
FT                   VDKEWDYSAKRERGFKSTFDKGILQLHFQFKRIYYRK"
FT   CDS_pept        join(982368..983276,983337..984197)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184049" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944471"
FT                   /orf_name="Pc18g04150"
FT                   /product="Pc18g04150 protein"
FT                   /function="DNA binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="double-strand break repair "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94639.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006302"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="InterPro:IPR009089"
FT                   /db_xref="InterPro:IPR015381"
FT                   /db_xref="UniParc:UPI0001831466"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBH9"
FT                   /transl_table=1
FT                   /translation="MPSRWQRLHSSQEGLPSLLFQYTWSRQGYEIHITDLTYIWSERLP
FT                   HKAITKRAEEDATTIDPGEDPEQLDVLLEKIGEALQKGNESAILSSGTQTDSLEITITA
FT                   KLPSPLKPLKWSLKLSKEPLSSLTINLVIPLLKEEAEWESRQRSLLNQIKQKDYVLGKL
FT                   FDKMETIGVDLGSVFPSAAGSRTSRKAITRTEAAKFVKGIAPFEEQTWLAETGVSEGAG
FT                   LATNLLQEISESGDPHDLDTFTRSQGDWWYQLPRRSEVRAREASPIEEEISRDEDRKEP
FT                   IETKDIDEGGDPTTSSEADEFQRQETPPRLKPQHGKGKISPPKQIPRKKSPVPPVLPSE
FT                   EDEATASDSDSDLEPPPRQRRRIPSVSRSPEPAAPQTKAREAPKVPKGGLGKIGGKSKK
FT                   ETERRPSPSPSPAPSPPAQVREAPKRPKGGLGIIGGKKKQAKEPSPSPAPSPPAQATES
FT                   PEEERISEDHAPISSTPAPAAAKAKRPGKLGMIGGKAKAKASEAGRDKSPLPTSDAVAV
FT                   SPEKAAPAKLKADRQAIKREESPLPTPAAEKVTPAPPAEPETEDQRADRKREELKRSIE
FT                   AKSKAPAKKKRRF"
FT   CDS_pept        join(complement(988341..988525),complement(984473..988175))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184038" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127872"
FT                   /orf_name="Pc18g04160"
FT                   /product="Pc18g04160 protein"
FT                   /protein_id="CAP94640.1"
FT                   /db_xref="UniParc:UPI0001831467"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBI0"
FT                   /transl_table=1
FT                   /translation="EGSFNRVFIFTIDGSSRVVARLPFTSGARKIATASKVATIXYCVX
FT                   NNHLQGSSSYANYLCHGVXRNTSIPIPKILTXSDNAVNIVGSEYIIIEYTTSIPLQQK"
FT   CDS_pept        join(990144..990488,990545..991704,991774..993043)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15944472"
FT                   /orf_name="Pc18g04170"
FT                   /product="Pc18g04170 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94641.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0001831468"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBI1"
FT                   /transl_table=1
FT                   /translation="MDPHAALELLQYLRTSYPIFLLILFVVAFVANTTIAAKKAGKHEA
FT                   QYFGPGGRPLPQRTRSTPAYRSQEFSRNVKRVFNLLSAAVILTFLADATIYITHVMVAR
FT                   SENWWRGQSFVVYVVGSFFVYSVLLMAMLDTSPSPTLAQFVCWSVAIPIELVIVSTSLS
FT                   IYTSVHHEPIVGDPEGGRVRRRITLWESLEVGSNSIRILILFALVLLYACQSFSMKSHA
FT                   KASQRANGATEATGLLDSGGAENGNGNGNGHGKANGHSYGSTNGAPHPETSKPTDPWVR
FT                   PTTLPSTSWWEYLSGYSLFFPYLWPSKSRRLQLIVTFCFGLLICQRIVNVLVPYQIELI
FT                   TGSLAESSESDDFKVPWIQICLYVVYRWLQGSQGLLSSLRSSLWIPVSQYSYMELSTAA
FT                   FEHVHSLSLDFHLGKKTGEVLSALSKGSSINTFLEQVTFQVVPMLVDLVIAIVFFLVSF
FT                   DVYYALAVGISTFGYLYVTIRMAQWRAEIRRQMVNASRQEDAVKNDSMVSYETVKYFNA
FT                   EQYEFNRYRGAVRDFQKAEYHVLFSLTLLNTCQNTVFMMGLLVMCFICAYQVATGQRPV
FT                   GKFVSLLAYMVQLQGPLNFFGTFYRSIQSALINAERLLELFREQPTVVDSPRATPLAMC
FT                   NGDIKFKDVEFAYDSRKPALNGLTFHCKPGTTTALVGESGGGKSTVFRLLFRFYNSGNG
FT                   RICIDGHDVQDVTIDSLRQHIGVVPQDTVLFNETLMYNLKYANQDASDEDVYEACRAAS
FT                   IHDKILAFPDGYNTKVGERGLRLSGGEKQRVAIARTIIKNPRIILLDEATAALDTDTEE
FT                   HIQRALSTLSQGRTMLVIAHRLSTITTADRILVLSEGQVAESGTHEELLAMKGRYYSMW
FT                   RKQIRAQKAMAEAQVLAERIRTATTSDDSSSQSDEDRNLVRSPKQLNQQGLNR"
FT   CDS_pept        join(993762..994305,994420..994634)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976767"
FT                   /orf_name="Pc18g04180"
FT                   /product="Pc18g04180 protein"
FT                   /protein_id="CAP94642.1"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="UniParc:UPI0001831469"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBI2"
FT                   /transl_table=1
FT                   /translation="MHSPSPQLLRVLRTSLVNTRRTSNLTRFCQIPSATAAPCLVSNPS
FT                   SGISSTRRNYSSPVRPTRMIPRSHAHKPVSRDRGPESKEDTQTNFDSLNVLGNIPAPTT
FT                   AIDACLDSGFHLNNGVKLTDGNGLLLVGGEAFAWRPWKAVEGAENDSVAKDAMLNSKGQ
FT                   FELDESVWGLLNLVWPKPVQRTDMLILGVGGTMFPLSPETKRNINSLGIRVDILDTRNA
FT                   AAQFNLLATERGVNEIAAAMIPIGWKARPL"
FT   CDS_pept        join(994988..996509,996561..996841)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000099116" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976768"
FT                   /orf_name="Pc18g04190"
FT                   /product="Pc18g04190 protein"
FT                   /function="phosphatase activity"
FT                   /protein_id="CAP94643.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniParc:UPI000183146A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBI3"
FT                   /transl_table=1
FT                   /translation="MAREESLVPPRLSSDDGSSVRNEEEDYALLTGERTDHEDKRRAWP
FT                   SWREIGAFSWAVIATILVIVLAVMYPHNSAEPHNHHSSNTTWGPGGKPTGKRNMIFMVS
FT                   DGMGPTSLSLTRSFRQYTDDLPFDDILVLDKHYIGTSRTRSSSSLVTDSAAGATAFSCG
FT                   RKSYNSAISVLPDHSPCGTVLEAASLAGYKTGLVVTTRLTDATPACFAAHANLRNYEDL
FT                   IAAQEVGEHPLGRVVDLLLGGGRCHFLPNSQDGSCRGDDHDLLKVASQNGFGYIDDRAG
FT                   FDSLKGGDNATLPLLGLFASGDIPYEIDRRSQNDTYPSLEEMTRTALKAMSKATEDSEQ
FT                   GFFIMIEGSRIDHAGHGNDPAAQVHEVLAYDKAFAAALEFLENDSTPGVLVSTSDHETG
FT                   GLAAARQLHKSYPEYLWLPGVLDKANHSGEYLAARLKEYLSGPGKDAKDSAKQSWVRKT
FT                   LKDGLGIDDATDDEVDALLHPDPQIATEHVFTDMISRRAQVGWTTHGHSAVDVNIYASS
FT                   TKGAWPLVGNNENTDVGDFLADYLDLDVDNVTKLLQDTKSGILQSYDWMGDRLGLNFHT
FT                   EGLDTYHGDFRKRSPDDCGCGAAH"
FT   CDS_pept        join(complement(997223..997667),complement(997162..997190))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944473"
FT                   /orf_name="Pc18g04200"
FT                   /product="Putative uncharacterized protein Pc18g04200 "
FT                   /protein_id="CAP94644.1"
FT                   /db_xref="UniParc:UPI000183146B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBI4"
FT                   /transl_table=1
FT                   /translation="MCLFVETHYSNCKHTCFELYLFCREILRQLNRINDPDQRRDYALP
FT                   FDPDCPTCQPYTIISASIAESNYPQQHFHTYNLGHHGPQMVMPGPQDQFSNGLPMQYPH
FT                   SQGQPPLSQQPAARPSIPGFTYIQGPVLASTMRQTTLRPDVNDLNDGFGGELS"
FT   CDS_pept        join(998898..999574,999627..1000328,1000396..1001257)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206405" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823588"
FT                   /orf_name="Pc18g04210"
FT                   /product="Pc18g04210 protein"
FT                   /function="binding"
FT                   /protein_id="CAP94645.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000183146C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBI5"
FT                   /transl_table=1
FT                   /translation="MDRFLQDPEGEKLLTEHNRALEAAEALRGTPFKPKMTRDELSKQF
FT                   KYWQRTNKEHSRRQSSGGAVDVSFAIPIYPPCLAPLEGLKKAMLKDLLLETHHRGSYIL
FT                   VRSITQAESMGAVMAIVEDEEKDAISLQMLNEKLRCQDGCADKGQILLVKEPYLTSMSD
FT                   TEYVVRVDHVSDIMFIPFFDEMVPSAWRERIPEHETSQWMARDWLSMGNEYLNRGKFYS
FT                   ATECYSKGLECSPTEEEKHYLLYYRGLAFFQVDEWDASLRDLDAVPPGPKSDKALRGKA
FT                   QTLYRLRRFRESCDQFTKLCKKNPEDVSARNDFREAIARLVEQKKGIYNFSKMQEKASK
FT                   THPPLLDHATWIGPVTVRQTESQGRGLFTTEAVKVGDLLLCEKAFAYATEHHSRPRWSS
FT                   TLHVNTETRTTARGGQLALASLIIEKLCKTPSLAAAITDLHSNGFRQVSTGLIDGKPVV
FT                   DTFQVARIISLNSFGSPTSSRGDHIRDARDASGSPGRLHNCGTWPYASMINHSCMSNAH
FT                   YAFIGDMMIIRAATDIPANTELTIWYLLPAPENRPMDFRHWGFECSCTICVDIKATEPH
FT                   VLEMRVRQHAQIAMALKKSSEYSRSRAEVLIDRLTETYRRPLEQVLRLGLWEPLIMIAG
FT                   VYDSLMQQDEAREAVVQALAAVGFVIEGGMEGPLVVKKWGQAMDSLVIAWIILWRTLLG
FT                   VAPESAKQAARYARMAYLICVGEEESFDATYGMNFKVAHEPVEEGEVEGWVV"
FT   CDS_pept        join(complement(1003090..1003112),
FT                   complement(1002726..1003011),complement(1002555..1002638),
FT                   complement(1001615..1002451))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670811"
FT                   /orf_name="Pc18g04220"
FT                   /product="Pc18g04220 protein"
FT                   /protein_id="CAP94646.1"
FT                   /db_xref="UniParc:UPI000183146D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBI6"
FT                   /transl_table=1
FT                   /translation="MAESWDDGSFNPRSYSPTTAALEQSHRRTRPPSRPLRLDSLRRYA
FT                   AGYKAWIGAEGMWIRTNYDAENEEAHQILWNDYMDISQVIGPDSLVLVPLFRPFLNTEG
FT                   HNNKLLPPKVPCRSHGAHATRTPIPSYQIHQAERQDTTCKRRCATVSRAPRRPMPSVDS
FT                   ALGAPASQQKVLDCPKILERYINVNSTGGRWEVSSTFMASLQHSDWLAQITTVRIFLKG
FT                   GRLQDGFRLLGGCFEACKANLKTESPLLTSEIFMGAFQLSTISPSLGWSFLKYIRDLSG
FT                   IVLNMAHPLLLLLSKYLTLDKEAFANCSNLFLGFFLDLMARCVPGWDQSHRGALLLTTG
FT                   RIFLLSLIEFSQYEELTRKSKSHETMPLLLGQQVLQYQGQLPPAAMRSDTVAVFPFPST
FT                   NQGGREMWRC"
FT   CDS_pept        join(1005135..1005637,1005697..1005868,1006006..1006242)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944474"
FT                   /orf_name="Pc18g04230"
FT                   /product="Pc18g04230 protein"
FT                   /protein_id="CAP94647.1"
FT                   /db_xref="UniParc:UPI000183146E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBI7"
FT                   /transl_table=1
FT                   /translation="MDKQTQTRRCDEVKRLYKLLKSCESWFLSPGDLQGLGIYSQQVGM
FT                   TGDGSVQFDPCFFRPYPEKVLQKYPLDTVSMAADHPPQTLQRLNNPRDFQTLLREVQND
FT                   PKVEHPLEFAKSRWDTLTLLYGPDAWEDHARQTRWHIQSQQMLPRRGLSRGSTLSDLRS
FT                   IYERRTKWKHSAPELCGLNRRNYWRILSLREVFQPSFNPHAIMELLSDVPANHAENCLT
FT                   LQELLVLSYTGQKHGRIIQASLHGESLLLQYSQLWSFADDETAPVELFVRYDMSQPVPI
FT                   ALEEPNPIIGSLVGPVTSISLN"
FT   CDS_pept        join(1008606..1009486,1009534..1009807)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944475"
FT                   /orf_name="Pc18g04240"
FT                   /product="Pc18g04240 protein"
FT                   /protein_id="CAP94648.1"
FT                   /db_xref="UniParc:UPI000183146F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBI8"
FT                   /transl_table=1
FT                   /translation="MEPPPTPRPPAPKVPSTVSQWRASARGCHVLTKNPSKLECLHPGS
FT                   KVTFKEYLSMRIIRRVSNITEFPDRETEGRAKEMVKGDEAIQTWLSYIETDQYPTDRKL
FT                   GMFALVRQGQLAIVASDSQEPSQTVELRRRDRPQAPELSADTAGRSPSAAASTAPTEPS
FT                   TAASSVPTELSTAASRKWVKYARADGEPQVNQFVINLLNALTLSVGQGVNCQWSPNGNL
FT                   FGSVSFGEVQLTAYVDGYLVGVKKSDIFAIVEVKAGIRDPEQYPLVEWQEGAEMVSWIM
FT                   NDEENLRRHPFETRLLISLNRHEMHLTLARYHEDYVKFLKGEFQGLKSYPENRFLHLHE
FT                   YGPWDIGKKSHMRDLAEIIVGFSLRVKDEQARSAVPSGSGPDGA"
FT   CDS_pept        join(1011368..1011397,1011447..1011505,1011560..1011616,
FT                   1011670..1011699,1011840..1011936,1011989..1012029,
FT                   1012077..1012102,1012184..1012370,1012442..1012870,
FT                   1012924..1013005)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161754" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976769"
FT                   /orf_name="Pc18g04250"
FT                   /product="Pc18g04250 protein"
FT                   /protein_id="CAP94649.1"
FT                   /db_xref="UniParc:UPI0001831470"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBI9"
FT                   /transl_table=1
FT                   /translation="MAEKMDQIAVDPDFYAMSTGYGMDPHDLQSDTTSLASAIARGRVE
FT                   NGRRYQATKEDDYCYGINELRHMMFLVLDHDQLNPLFRAPIGDSPKNILDIGTGQGSWA
FT                   IDVADRYPSATVRGVDIFPPPVSWMPPNCLFEVDDVLREWTWREPFDFIHMRLMYGAFP
FT                   PDGWHELYKQAYDALEPGGWIEQMELDVRVYSDDGTLKKEHQLYGWGDMFIRCSERAGR
FT                   SLRTHETMRSAIEEAGFVDVHEEKYKIPIGPWARDNALKEAGHLQYGHWNAALEGWAMW
FT                   LLTHFGEPVPWSKEEVHVFLAKVRTELSSPHIHAYEPANRVWARKPTKEELEEKEPNIK
FT                   AETSP"
FT   CDS_pept        join(complement(1014979..1015093),
FT                   complement(1014484..1014924),complement(1013676..1014421))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000184016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976770"
FT                   /orf_name="Pc18g04260"
FT                   /product="Pc18g04260 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="cellular cell wall organization "
FT                   /cellular_component="cell wall"
FT                   /protein_id="CAP94650.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005618"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017168"
FT                   /db_xref="UniParc:UPI0001831471"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBJ5"
FT                   /transl_table=1
FT                   /translation="MVRFVTPLLLASLSVSAFAAQKCNSSSQCKEEKYPCCSQYGECGT
FT                   GAYCLGGCDPLASFSLDSCAPMPVCESKTYTWENLDNAVTQDKYLGNASAADWTYSGKE
FT                   VKTEDGNLIMTMPANSVGTLFANNHYVWYGKVSGKFKSSRGKGVVTAFILLSDVKDEID
FT                   YEWVGADLTTVQTNYYWQGVLDWHNSGNITVDGEDTFNDWHTYEIDWTPEKVDWIVDGS
FT                   VHRTLKKADTYNETSKQYEFPQTPARLQMSLWPAGQASNAQGTIDWAGGEIDWKSEDIE
FT                   ESGYYYATVGEVSVKCYDAPSDAKKTGDKAYIYANSAAMESDISITDNSTILASLGATG
FT                   LDMDLGADKSSSSSSSASNSIPTGSGGSGGMSGDNTSSDSGSGTSTADGSETSTSGFTQ
FT                   GSSTQDSGAAGQNERVLRGSLFGVLVALVVLVTL"
FT   mat_peptide     join(complement(1014979..1015036),
FT                   complement(1014484..1014924),complement(1013679..1014421))
FT                   /db_xref="UniProtKB/TrEMBL:B6HBJ5 "
FT   sig_peptide     complement(1015037..1015093)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBJ5 "
FT   CDS_pept        join(complement(1018444..1018738),
FT                   complement(1017430..1018387))
FT                   /pseudo
FT                   /gene_family="HOG000048667" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(1019948..1020013,1020077..1020211,1020276..1021190)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944476"
FT                   /orf_name="Pc18g04280"
FT                   /product="Putative uncharacterized protein Pc18g04280 "
FT                   /protein_id="CAP94652.1"
FT                   /db_xref="UniParc:UPI0001831472"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBJ6"
FT                   /transl_table=1
FT                   /translation="MATQTLEKMRRAQSLLRECHGWLVQNDELLLAVELCAIEGSLALL
FT                   FEDRGLPNSPYPGVQETELPPLRLSNSQKRRNRRRAFNYYHRPHHINRGGTEAPASRAG
FT                   DAQKSQAQATTSTARDTARDSISPDAVTATSPPEGVLLDFNHDMEFVRFPPNMAADMEA
FT                   AQTSNLDSKGKQSPSERPAAISSDGPAPGVLVPVDGDDGSFHQTIAAAVHAASVGLDTP
FT                   VSSHYSPAVVKEGVVPVTSQPPLPGSPVSNSLEGGSPHASQTNQRMQETTRGTLIDLDD
FT                   DLTVILPGEIDADTHPEEKDVLAASLDSGVAHNPAPEEEDDEIVFHGTAKGIRSDSKAL
FT                   FVSSDDESQTSRRAIDLTAVLKKYSEVIICN"
FT   CDS_pept        join(complement(1023425..1025854),
FT                   complement(1023011..1023355))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183871" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944477"
FT                   /orf_name="Pc18g04290"
FT                   /product="Pc18g04290 protein"
FT                   /protein_id="CAP94653.1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0001831555"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBJ7"
FT                   /transl_table=1
FT                   /translation="MRRHGRSSGGPTKAVSPLSDTVSLIRSFDSVMNPNRPARPSPLAS
FT                   SHIKALPLELVDRLRSFPLFQATPESFLIEVGQHLRPQLHAPNDYILTEGDEAKAIYWL
FT                   VRGAVSVTSRDGESIYAELKPGAFFGEIGLLMDRPRTATIIARTRCMLVVLTKDDFRNI
FT                   LPRFPEVEQAIREEAEERLMILEKKKKETSAPALDLPSPARRGSKRLRESFSKDLTVVE
FT                   DDGDLNAKSVYKKRKSPSPGRRDGSSALANGLVNVRLLLKELPLFSGLPADILHYLGLN
FT                   AQPRSFPPFTDIIQQNSQGRELYFIVRGEVEVLTEKAEMNHSSPNKNSPNGFIERPGIE
FT                   VKARLKQGQYFGEVVSLDLAPRRTATVRSVTSVECLMLDGDVLGEFWEKCPSDVREQVQ
FT                   RTAQARLQAAADGDVVMSDDADPQPSIGDLALDDRVKITSSRRRSMPLLTLTETELDGP
FT                   HQSSHVEDQDQDVLRPSDPDPYFSIGLDKVRMRSRRGSLAPLAPEEVSGEQQRSSPTEP
FT                   RSASSSTIALPETASLSTSSRTERPRIDGSNGLLPDSVLLSIFQFLEFHHLLRIRAVSS
FT                   HWSELLTRSADVVQDLDLSVYNRKITDDVITKIICPFVGARARSVNINNCFHITDEGFT
FT                   ALAATCAPNTTVWKMKSVWDVTASAILDMSSKATNIQEVDLSNCRKVGDTLLARIIGWV
FT                   VPADQKMGEKQSSIKPTIQTAQCTVYGCPQLKKLTLSYCKHVTDRSMHHIASHAAGRIE
FT                   EMDLTRCTTITDQGFKYWGNAQFTNLRKLCLADCTYLTDNAIVHLTNAAKNLEELDLTF
FT                   CCALSDTATEVLALQCSRLKYLNMAFCGSAISDPSLRSIGLHLLSLQHLSVRGCVRVTG
FT                   VGVEAVAEGCHQLQVFDVSQCKNLGPWLEDGGAVHYQPRVQFKTVAPNKKLPR"
FT   CDS_pept        join(complement(1027385..1027841),
FT                   complement(1027144..1027316))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944478"
FT                   /orf_name="Pc18g04300"
FT                   /product="Pc18g04300 protein"
FT                   /protein_id="CAP94654.1"
FT                   /db_xref="UniParc:UPI0001831556"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBJ8"
FT                   /transl_table=1
FT                   /translation="MGANHPLSTDSPHNSIVLKIVHWDKLFESDSPPRLGIEFGKRLPY
FT                   ATMSAFSTGMALGYYHGSKRAGLVFRAENAHRFPTTSTGWFQYHKTKNYIGVVGGVKDG
FT                   MRMGLKLGAGALAFCLFEETVDYARHDERDFLSTVTAGLSFSGIYSLLARHDVYTAART
FT                   AKLGLKLSLTYGLLQDALGTLKGNSPAYVDFFLGNRRSKVEKEGSI"
FT   CDS_pept        join(1028057..1028059,1028107..1028607)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944479"
FT                   /orf_name="Pc18g04310"
FT                   /product="Pc18g04310 protein"
FT                   /protein_id="CAP94655.1"
FT                   /db_xref="UniParc:UPI0001831557"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBJ9"
FT                   /transl_table=1
FT                   /translation="MLIIEKPPRQSNTDSRSLTILFKKHKTTVLLMLQPHESLDFAKER
FT                   LLDALQSREITNINGDVLPDDSCDIEFGEPVDRADPQKGWKRIQADAPEIDTEDVPKRN
FT                   KGKSPKNSATIMEAGLQNGHSIAFRFHKSSEGQNGGLDMDLDGEDPGWDVVMPVYEDEP
FT                   EERG"
FT   CDS_pept        join(1029397..1029596,1029649..1032472)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183905" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127873"
FT                   /orf_name="Pc18g04320"
FT                   /product="Pc18g04320 protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="CAP94656.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI0001831558"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBK0"
FT                   /transl_table=1
FT                   /translation="MAASDGASSINVAVRVRPFTIREAAQITRCDEGPLFLGDGSLAGA
FT                   PTPKLNQKGIRSIVKVIDDRCLVFDPPEDNPVQKFSRSVVPNGKRVKDQTFAFDRVFDQ
FT                   NASQGEVYESTTRSLLDNVLDGYNATVFAYGATGCGKTHTITGTAQQPGIIFLTMQELF
FT                   ERIDERAGEKSTEISLSYLEIYNETIRDLLVPSGSSGKGGLMLREDSNQSVSVAGLSSY
FT                   HPQNVGEVMDMIMRGNERRTMSPTAANATSSRSHAVLQINVAQKDRNADVNEPHTMATF
FT                   SIIDLAGSERASATQNRGERLFEGANINKSLLSLGSCINALCDPRKRNHIPYRNSKLTR
FT                   LLKFALGGNCKTVMIVCVSPSSQHFDETQNTLRYANRAKNIQTKVTRNVFNVNRHVKDF
FT                   LVKIDEQMNLINELKAQAKDYEKVAFAKFRKQGEKKDAVLREGVARIRNAYEHTLPERQ
FT                   EKTNNMLKLRQIGRRIGILSSWIAAFDNVCAARADEEGLSNLYAVRKSAQGILLELEGS
FT                   RHHYNQKLSKSTWDRAVTSAVENSAKQLREFDITDNSDYANLNREAELLRSNAEREALT
FT                   AVIEQDKAGEAAAVQLLLQAQFEMMSSIEDIMQLNASEAIKKGRAILAKMLEDCSDVAT
FT                   NLVKPDGTMPSVPNVSSVRPPSPTKTKKRFSLVSLPPVSSANPPVTLAPAAPASPTKGS
FT                   PRRRKGTAGRKSVSFTPKKVQVKVPKRSVRWKDDEEDGTLTEFQKTPKKVESADESSFE
FT                   DSLLPPRSGSPIPRNIPRVVSPSGSISPTPDEPAESAGPTLNVQKNNSRFKAGFLTKRT
FT                   GSSPLAPPPSSSLPLSRRESSPLRDIEGSSFMNRTSTERPSRIAVRSPSGNFSSSPVSE
FT                   NRDNWKSDKEEAIKINSAMRRMSSGRITSGQFGTQSSNALRVHRRRSPTSSTYGTPPAD
FT                   NHMFTASQARRMVKSEREHDTKPRVLSPHTLPVMKHTGRRTTLGGDGRPRNISLSSRDA
FT                   IRLSVMAAPPTDHNSQAW"
FT   CDS_pept        join(1033078..1033249,1033340..1033755)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000263863" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670812"
FT                   /orf_name="Pc18g04330"
FT                   /product="Pc18g04330 protein"
FT                   /EC_number="1.8.4.11"
FT                   /function="peptide-methionine-(S)-S-oxide reductase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAP94657.1"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008113"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="UniParc:UPI0001831559"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBK1"
FT                   /transl_table=1
FT                   /translation="MSGTETATVAAGCFWGVEHLYRKNFGNGKGLLDAKVGYCGGAVSS
FT                   PSYQAVCSGTTGHAEALRIVFDPSIVTYRQLLEFFYRMHDPTTENRQGPDVGTQYRSAV
FT                   FTHGDEQQKIAEEITDKVSKQWYKTPLSTKVLPAGQWWDAEEYHQLYLQNNPAGYECPA
FT                   QYVSLSSEFYLIRLLTSCLLASSDLSLLWRID"
FT   CDS_pept        join(1034877..1035295,1035354..1036167)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162222" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823589"
FT                   /orf_name="Pc18g04340"
FT                   /product="Pc18g04340 protein"
FT                   /protein_id="CAP94658.1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000183155A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBK2"
FT                   /transl_table=1
FT                   /translation="MAPMALYNQTVDFLSGAFSNNQTHLRLLAVTGASFTLGLLARSVF
FT                   PRNGPSQTVLVSPRSTTVLPDISESERRKHPLPPDVFPGARDVASPYGSMRVYEWGPED
FT                   GPKVLFVHGITTPCISLGGLAHALVDRGCRVMLFDLFGRGYSDCPADLPQDDRLFSTQI
FT                   LLALTSSPISWTGAESGKFCLTGYSLGGGIAAAFASYFPQLLSSLVLLAPSGLLRDSQI
FT                   SFQSRLLYSKGLMPENILAYLVTRRLKAGPLTTPKPKNKKLNAADVLTEELPSQKAAAT
FT                   QVLSRAYPHINIPSTVEWQVNNHTGFVHAFMSSMRFGPILRERQWNTWTRLGEYLTAQN
FT                   GVPSTENEKLADNKVHILCGNDDSIIVRSELVPDATAALGGNVVFKFYEAGHEFPSTKY
FT                   EEVACYIFDLL"
FT   CDS_pept        join(1038942..1038952,1039049..1039288,1039353..1039404,
FT                   1039459..1039461)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944480"
FT                   /orf_name="Pc18g04350"
FT                   /product="Putative uncharacterized protein Pc18g04350 "
FT                   /protein_id="CAP94659.1"
FT                   /db_xref="UniParc:UPI000183155B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBK3"
FT                   /transl_table=1
FT                   /translation="MPKAYWECTPYLHGFFFRAHERGPCSLLNPAAQPLPVSCFIKLPA
FT                   PATSLVFQTRDLSESEGIHKVRLGPADESILGLGMAQSRLANWLHESRDDSTAASL"
FT   CDS_pept        join(1039834..1040003,1040095..1040177,1040281..1040459,
FT                   1040556..1040624)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823590"
FT                   /orf_name="Pc18g04360"
FT                   /product="Putative uncharacterized protein Pc18g04360 "
FT                   /protein_id="CAP94660.1"
FT                   /db_xref="UniParc:UPI000183155C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBK4"
FT                   /transl_table=1
FT                   /translation="MGFHISVLIFAGSSGPHQWFFSLGSFCYGQTSVYFWLISGRRDPD
FT                   AVTTPWGIPSSRFGAVFDISSPLMRLLDKASFEQGNHFALFGFFGTRRSAESLRSLFAM
FT                   RKAALQRATADPAYHGLRSKYRVYSHRYLPLRYTACVSTRLPCDAVELDLASDSVTKPS
FT                   NSR"
FT   sig_peptide     1039834..1039920
FT                   /db_xref="UniProtKB/TrEMBL:B6HBK4 "
FT   mat_peptide     join(1039921..1040003,1040095..1040177,1040281..1040459,
FT                   1040556..1040621)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBK4 "
FT   CDS_pept        join(complement(1042889..1043264),
FT                   complement(1041163..1042781))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168830" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976771"
FT                   /orf_name="Pc18g04370"
FT                   /product="Pc18g04370 protein"
FT                   /protein_id="CAP94661.1"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="UniParc:UPI000183155D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBK5"
FT                   /transl_table=1
FT                   /translation="MQLYGSLFGAFILILQSLQLVQAENLIQATGLTQCSDSAEVTVNN
FT                   FNAVFTPSNKSISIAFDGYSEVAGDVYIDVDLLVYGYKALTKTFDPCSLDLAVFCPMKA
FT                   IELQIPTITQTLGDSVLSQIPSIAYSVPDIDAVIRLQLKYKNGGKQIVCLETRVRNGKS
FT                   VYQAGVSWTLAIITGLGLVTSTVISLLGHSNTATHLAFRSLAFLGFIQTQAMAGMCSMK
FT                   LPPFVQSWTQNMQWSLGIVRSDALQTIATWFQRATGGIPSAVMTSAGSISVVLQKRSSI
FT                   HRRDAQPGSQILLRGIERVGIRDSIELTNIFMTGYLFYYFITAVVVACVGLVLVVRAVL
FT                   AKKQTLLPKLDRAVTVTADWKTVLRSTFFRLACIGYPQMCILCLWELTRRDSAAEVVLA
FT                   ITMWLVTTAVLAFAAFKVFQRAIRSKQQHNTPAYTLYSDPATLNQWGFLYIYYRAPVYY
FT                   FLVPTLVYTIVKGMVIAFAQPSPVAQSIVLLVLELAMMLATAIIKPFMSKGANVVAITM
FT                   TVLNSLNTIFLLVFSDVFDQPELMTGVLGVIFFILNALFTLVLLIYLLVGMVYAIFLKK
FT                   PDTKYKPLGDDRDSFRWSRTGTTTELSSLEKIARGEEDAEGHPHPARAVTAPPSDEDVS
FT                   MAARRPFNDVVDPSLPLFPTSYDHTRQQS"
FT   mat_peptide     join(complement(1042889..1043195),
FT                   complement(1041166..1042781))
FT                   /db_xref="UniProtKB/TrEMBL:B6HBK5 "
FT   sig_peptide     complement(1043196..1043264)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBK5 "
FT   CDS_pept        join(<1043477..1043571,1043657..1043764,1043851..1043883,
FT                   1043981..1044065,1044304..>1044384)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976772"
FT                   /orf_name="Pc18g04380"
FT                   /product="Putative uncharacterized protein Pc18g04380 "
FT                   /protein_id="CAP94662.1"
FT                   /db_xref="UniParc:UPI000183155E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBK6"
FT                   /transl_table=1
FT                   /translation="MRSIGVVINGVPLILCYLGYTSLLPLCPSPQGHKAQESANATMKK
FT                   LSPATGQQAQIISANSHLYQLPSIVSSRGGLVFPPFVSLIGQHETGLNVQPIEMLSHLE
FT                   LHQTYQPTITAIPSIYLDMQNVTVQLGEAR"
FT   gap             1045233..1045332
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(1046880..1047416),
FT                   complement(1046400..1046804),complement(1046025..1046330),
FT                   complement(1045614..1045970))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944481"
FT                   /orf_name="Pc18g04390"
FT                   /product="Pc18g04390 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94663.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183155F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBK7"
FT                   /transl_table=1
FT                   /translation="MGILTLAEDRPTPKSVYNWRVYALAGIASCGSNMIGYTSAFIGTT
FT                   ITLASFMKEFGLDEMSTPQRNLISENIVSLFIAGAFFGALGTYALGHFIGRKWSLAVAA
FT                   TVFFLGSGLQLGANSARGLGILYAGRVLSGLGTGIASNIIPIYLSELAPPAIRGRLVGL
FT                   YELGWQIGGMLGFWINYGVEQHMPQTHEQWIIPFAIQLVPSGLLFLGALWIKESPRWLF
FT                   LKDRRSQAMENLCWIRQLAADDMYITEEVAAIDQALEHQKSSIGIGFWKPFQALATNKS
FT                   VMYRLMLGCMLFFWQNGSGINAINYYSPTIFKSIGVDSNTVNLMTGIFGVIKAVMTFVW
FT                   LLFLVDQFGRRNLLLVGAVTGSLCMWVIGAYICVVKPEDNPSTSLNGGGIAAIFFFYLW
FT                   TAVYTPTWNGTPWVINSEFFDPNFRSLAQAATTASNWLFNFLVSRFTEQMFATMHYGVY
FT                   FFFAALSFLAFFFAFFLIPETSGIPLEKVDRLFDCKPVWRANGILKAALAEEEEQFRYE
FT                   VKESSYHEENTGSIAAS"
FT   CDS_pept        1048627..1049058
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670813"
FT                   /orf_name="Pc18g04400"
FT                   /product="Putative uncharacterized protein Pc18g04400 "
FT                   /protein_id="CAP94664.1"
FT                   /db_xref="UniParc:UPI0001831560"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBK8"
FT                   /transl_table=1
FT                   /translation="MPWRYRPALVLKNALLKSTLNGEQLLPEELYKLTFRVVKGLLGTN
FT                   LSRPISDIPGVLKNSLIRKTHKSVFAVKPTGDYAARRMRTYPVSQIAGAMLSLTDLSGT
FT                   GPLRYIPEAPWKSANVPTVKFNEFPNNPCPNLRYCPRVL"
FT   CDS_pept        join(1049291..1049981,1050161..1050569,1050631..1052224)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076711" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823591"
FT                   /orf_name="Pc18g04410"
FT                   /product="Pc18g04410 protein"
FT                   /protein_id="CAP94665.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001831561"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBK9"
FT                   /transl_table=1
FT                   /translation="MADPLSIAAGIAGFLSLGIQVTQTLIEFYSAYKNQDTDVAKITRM
FT                   IENLQSTFRFLQIAVQQRQAQANAEELLQKVDNTIQACHEIIQELQTECQKLHTDSITG
FT                   LKGRFQVAGRRAAYPFRKSTIHKIEEDVGEIRGNLSFALNVLQYKSHNRIEDEISEVKY
FT                   LLERTNTSQISLAIRAWLMAPDAYMNHHAIYAKHHPSTGLWFINGHHFANWLVERNSFL
FT                   WLNGFAGCELQQLHAFYKSSTPSVEILLQTLRGFLDRSQDSYILLDALDECPRDCGRED
FT                   VLGVIQAIRGWRLPSVHLLVTSRDQLDIRESLNPSNCHDLSMKNAANDKDIADFVFDQL
FT                   NHDTKLQRWKARHGEIQSKLIHGAQGVYVECQLNALRRARNRNQLDECLRSLPRDLDGT
FT                   YERMLCSIDEIYVQDVQRIFTVLCLSVRPINVNELIDAHAVELGESPYLDREGRSYEQD
FT                   DLVDICLGLIEIAVIEDDNGKPVSTARIAHFSVQEYLQSDRIQQQKAERFAIQSEPANT
FT                   EMARICLAYLLDPALSCEILDEAKLQNFPFAHFAAMNWYHYYERCHGSKSKTETLVTRI
FT                   FQDETNCFLTWVKLHDVDRPWNTKGTLERRADDIASPVYYAALLGLASVLKSILAVDSR
FT                   TQRLSDTVNAQGGEFGNALQAASIGGHKNAVQILLDKGADVSAQGGWYSNALQAASFNG
FT                   NKEVVQILLDRGADVNAQGGRYGNALQAASWRGHKEVVRILLDRGSDVKVQGGDYGNAL
FT                   HAASVGGHKEVVQILLDRGAKVNAQHGRYGNALQAASVGGYAEVVQVLLDRGADVNAQG
FT                   GRYGNALQAASRRGHKEVVRMLLDRGSDVNVQGGDYGNALHAASFNGNLEVVRMLVDRG
FT                   AYATTRSGGHKKVDMLLGREANLDAE"
FT   sig_peptide     1049291..1049362
FT                   /db_xref="UniProtKB/TrEMBL:B6HBK9 "
FT   mat_peptide     join(1049363..1049981,1050161..1050569,1050631..1052221)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBK9 "
FT   CDS_pept        complement(1052243..1052835)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(1052979..1053285,1053590..1053750)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944482"
FT                   /orf_name="Pc18g04430"
FT                   /product="Putative uncharacterized protein Pc18g04430 "
FT                   /protein_id="CAP94667.1"
FT                   /db_xref="UniParc:UPI0001831562"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBL0"
FT                   /transl_table=1
FT                   /translation="MARTRYTIDAVAVSQEHCASRLLNLVDTKNKSSRRARQLQSIAGG
FT                   NPPGEAARLICSVPIPLLSSLWIMNGQVSTCGIECDFLDRNQFGQSWARNANNAPRSRS
FT                   NTCQQPLVLLQGFESRYVNTNRQYLLGPQTLDFPRVADCLGNLVDTPFPGS"
FT   CDS_pept        join(1053963..1054082,1054137..1054566,1054643..1055046)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034157" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823592"
FT                   /gene_name="atg5"
FT                   /orf_name="Pc18g04440"
FT                   /product="Autophagy protein 5 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP94668.1"
FT                   /db_xref="EMBL:ABO31076.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR007239"
FT                   /db_xref="UniParc:UPI000159302A"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7KAL6"
FT                   /transl_table=1
FT                   /translation="MENRVSLGSIQKAVWDGRLPLEIVLASSESRTFDKTDPYLISYPR
FT                   ISYLPSLLPKLRAFFSNFLIDPNSQSHDGWFEFEGVPLKWHYPVGLLFDLYAGVDPASK
FT                   TAARDNESPGDGSSLPWRLIVHFSDWPPDLVRLDAYGMVMNDAFINSVKEADFLRNGTA
FT                   KGIMSLSKEDSSGLWNAVQEVDLLSFQRISNILLPQPSQPFRNVPIRVFLPLLPDAESS
FT                   SLKVVQTPLPPSIPASSMQSSQILTSRSGSTLQPQTVGTVLHTLLPNLFPSRRTPVLAK
FT                   PVLHGAVIPMSAPIEEVVRSSAYGDGWAYIVVRMMG"
FT   CDS_pept        join(complement(1058263..1058265),
FT                   complement(1058029..1058211),complement(1057215..1057973),
FT                   complement(1055550..1057088))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182156" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944483"
FT                   /orf_name="Pc18g04450"
FT                   /product="Pc18g04450 protein"
FT                   /protein_id="CAP94669.1"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="UniParc:UPI0001831648"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBL2"
FT                   /transl_table=1
FT                   /translation="MNSSLAARRRVVPAGVDTTNHEWFYPNKTIEKKRPNSGATIFDDT
FT                   ESEGGDWDESHRQSMQSLSYGSNTTLSSPELPTPDLVPRNLPTFRSSKELVVGPSGPDL
FT                   FRQSRGSRGSTVDVEFYLAPSPTIDYKPSLTQPEFVNTYQAGFVNQYQPEFSNPYLLSP
FT                   KTPKAFPPNPDVSHLSEEEIRNWDPSQVAHWLCIGGYADDVRDTFIKNDISGDILMSLT
FT                   EDELKDQLLIQSMGKRRKIFNSITYLKEHMQTRPIPETPSQFPSETASSNGRRSPQSFA
FT                   HQEFAPQDYVPQELVPQEIVSQEYGSQEYAPQESSVSIVGIEEFHPKPHKCSKGENCSK
FT                   FKKLKRLRQLATEHHDTDFQGGATFVGSPGNPETARNLLRPTSEAELSVAASSDIFGPR
FT                   SGPRLSEAALSEVERLDPQETIRNFLRHQHVDDFPKPGPLGLDTYNLPPADGFEGISPP
FT                   NSQENNMAAHLRSLPKLTIPTSPLTEDMTTAVTTNRYFTPTHQNGSPTAVQQFGPFSHA
FT                   HQAQATETYRQGTPFSEVDVPITAIPSDPIPRDVSQSVPPSMQYGSLFPPYGGGNSLAQ
FT                   NTSTRASDDLPLRDNNYPTRSTSTGPSDDLPLRNNNYLTRNTSARHDVLPLRQVNENKA
FT                   LTPIEHPEDLVRSPRVKQHGHSGSMSSSLASDPDVTHAGYMKKRKTTRLLRHEWSDAHF
FT                   TLRGTNLAMHKDERDAHRISRALDNIEVDEYAVACSSLATSSKLTAAFKRSILRNGNNT
FT                   IDSRDGTAFAFSLIPATKESEKKALFGNNAIKSHHFAVKSREERIDWMRELMLAKALKK
FT                   GRDGGDDMLVNGNVI"
FT   CDS_pept        join(1059620..1059862,1059909..1060030,1060149..1060286,
FT                   1060436..1060499)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944484"
FT                   /orf_name="Pc18g04460"
FT                   /product="Putative uncharacterized protein Pc18g04460 "
FT                   /protein_id="CAP94670.1"
FT                   /db_xref="UniParc:UPI0001831649"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBL3"
FT                   /transl_table=1
FT                   /translation="MGLRTPAEDIIEQARCLDLARIEYKIMTARPIYFIQCEESRSSSM
FT                   AACDFGSKYARAAEMITGQPQMYSILRTCIICNLSAKSNGLGASSRDNIGRLNLKQIFI
FT                   IVSTEMARTFDGQPAVCTRTEPDIKMRGLMSFDMDAFVPNRDYELLRCLNNVRYVALNI
FT                   RSGYWSYVKGTRSSLIVRSYFGSMD"
FT   CDS_pept        join(complement(1061824..1061844),
FT                   complement(1061597..1061736),complement(1061407..1061481),
FT                   complement(1060626..1060728))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976773"
FT                   /orf_name="Pc18g04470"
FT                   /product="Putative uncharacterized protein Pc18g04470 "
FT                   /protein_id="CAP94671.1"
FT                   /db_xref="UniParc:UPI000183164A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBL4"
FT                   /transl_table=1
FT                   /translation="MRVAETVRMHLDVQVPRGTGWRSFGRTGIPCSQLRSMGGCRYLIG
FT                   PGLISVFGGLLLVKATVTKSLDPQGTKAAGGVEILPSNCENAKSLFFPFPPATADCSLA
FT                   RVTYGERE"
FT   CDS_pept        join(1062238..1062364,1062436..1064416)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        1066911..1067591
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182134" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127874"
FT                   /orf_name="Pc18g04490"
FT                   /product="Pc18g04490 protein"
FT                   /protein_id="CAP94673.1"
FT                   /db_xref="UniParc:UPI000183164B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBL5"
FT                   /transl_table=1
FT                   /translation="MPSVKPILPPLKTPKTEVFPSQLHNGSTSSVSDYIKQEDQSTPIT
FT                   PPTAYTEFLKALTPVFTGPMSAGMSFPKYISDKASKPSTATSPTSQPASAFSGSTFSDS
FT                   VRSPTVSLPPPTPNSAAPSRKSFQGRRLRIQSSLKFTPSADSPRSATPRSATPWSATPR
FT                   SATTLRSPFSPSDWTLRYYDSPRSAKPVSVKQVVTRTVTYKRTQLEAPPKGKRRKCREA
FT                   KEVD"
FT   CDS_pept        join(1072203..1073295,1073350..1073714)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190115" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944485"
FT                   /orf_name="Pc18g04500"
FT                   /product="Pc18g04500 protein"
FT                   /protein_id="CAP94674.1"
FT                   /db_xref="UniParc:UPI000183164C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBL6"
FT                   /transl_table=1
FT                   /translation="MPRSGGSKIREEPIEPLLQLRIPVYYETPETPADGKRPLTSSPTF
FT                   AFFLQSRDRRVICDPAQFVSLHCVLSSSFSPISAPRDLARARPFLVRISSLASTRPTAS
FT                   IAMAQAPPTFTPDSEFAELETPRGPKNGSLSITAMARFEFEPGRGNDGTKILMIEWEDD
FT                   DLTRSATEGSWHVSWAGKTATMPTDERPSDSLRRCYFLLPPHTTIPPVVTLSYEAKSSA
FT                   SGSADDTVPTPARPQDTFQLNPLPAIFPPELGATGRTAGKKGVLHTIWAKKRLQVLESE
FT                   IEHESRNNVEGIALLMAIQEKEWIELNFGVGSRAVDSVASSHDSANSSSVYPATPVSPV
FT                   SGRKLSDKLKGLKLQTSERDLSGSGSHGASLLSPQSPDVAVSSFSSFRNVANRHIHSMP
FT                   TPNTNPTPTPSSQNPSGSEALKPVALFPPDFLQESQRTSEPTGFAAMGAAMGPISRTPS
FT                   NDSGEELFAKALSPRSPDLPRSPFSFR"
FT   CDS_pept        join(complement(1074873..1074918),
FT                   complement(1074173..1074789))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190104" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670814"
FT                   /orf_name="Pc18g04510"
FT                   /product="Pc18g04510 protein"
FT                   /protein_id="CAP94675.1"
FT                   /db_xref="InterPro:IPR013248"
FT                   /db_xref="UniParc:UPI000183164D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBL7"
FT                   /transl_table=1
FT                   /translation="MAFKSGSFATFLIVCPTCFFLGIIFSLFPYDYPILWSTVLTPPAH
FT                   YDYLEAHLRFLHASPPLIPRILHIVIFLGLAGLLTKLYKPSESNMLFDGASLVLYMCGV
FT                   TVYIANIVKGLRLASAGQYGAELASSADEKEQILGREDSLKVLSASNTILALVLVGILV
FT                   LQAGQWYAERKDAQEDESFATKKTEKEAGDATATASGASTATAAKSGRQGSQRKKSN"
FT   CDS_pept        join(complement(1077085..1077546),
FT                   complement(1075225..1077024))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944486"
FT                   /orf_name="Pc18g04520"
FT                   /product="Pc18g04520 protein"
FT                   /protein_id="CAP94676.1"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI000183164E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBL8"
FT                   /transl_table=1
FT                   /translation="MSANPPTQPTLPASRNRNSFLSKFRSPLGQRNRGITDFYIDPDDP
FT                   WRSYFPGDVVKGTVVVTVVRPVRITHIVVCLHGYVKVFKNAVPAGEATPDLGFLGPGRG
FT                   RRGAEYLGNGLATLFEDEVVLCGDGRLKEGIYKFRFEMGLPPYALPSSINFERGTIGYS
FT                   LTSTLTRPTTMNPTLTCRRRVNLLENIDIAPFPAPRPRIVTLEPIAKRSKPKGKAQSTN
FT                   SDATAGPDTTSVDTPISGASPSLDMRPPLSPSPSNVSSSSRPSESSQSFRIASDPSSSA
FT                   STSGQNSEGRSVTPSISDKTITAKAELLRAGVLPGDTLPITVTINHCKQVRSAHGIMVT
FT                   FYRQGRIDLHPAIPMGTTAAGKKPVYEDCYPRSRTGLGGLTLGTSRTSSTFRKDLSQTF
FT                   APLIVDPSTMTAIIKTSIRIPEDAFPTITRVPGAMINFRYYVEVVTDLRGKITSPDRFL
FT                   PRFNMVSGGTTFSPSGQALNPADSSGVTANWAGNILDTDSIRREKGVISVAFEVVVGTR
FT                   DSQRQKAKRTLSTAGESTKSQTAPPASAIILNPVDGEEWPEASSVPNSHGDYGTQEGYF
FT                   PEETDWAEYPAEYPENFQPMDPRVAPPEVEEPVDEKTRVRRHEEALLPSQPPEEDEAGP
FT                   STAPMEVPTAPVLPDDHHLQDYQHVPSPDTSGEPHSVRSAESLQTVVVNGAGPSEPHVS
FT                   GDDKQELERHRLQAQASAPQDEPSGQEPSDGPSAPVFDEDDQLVGGTAHADESLPRYQR
FT                   "
FT   CDS_pept        join(complement(1079260..1079262),
FT                   complement(1078533..1079183))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190082" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670815"
FT                   /orf_name="Pc18g04530"
FT                   /product="Pc18g04530 protein"
FT                   /protein_id="CAP94677.1"
FT                   /db_xref="InterPro:IPR005647"
FT                   /db_xref="UniParc:UPI000183164F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBL9"
FT                   /transl_table=1
FT                   /translation="MPKLTKSAKQDLILTHLRATGTCHTLKDLEKALPSVASINGIQVK
FT                   EYIQALTDEGQLRVEKIGSGNWYWSFSSDEKHALEHQLARVTTEVEKVRKSCADAEAAL
FT                   AGETMRRGEETDDEHERESLMAKKTELHVAIDRVRTTEAQLSGPLNSLSSKGVKQIEEE
FT                   LAGFRQQALQWTDNIYMLEEYLRKLAGGDRQIIEGILRECYGDEYVDGEGLCEL"
FT   CDS_pept        join(complement(1080839..1080971),
FT                   complement(1080211..1080776))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190071" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670816"
FT                   /orf_name="Pc18g04540"
FT                   /product="Pc18g04540 protein"
FT                   /protein_id="CAP94678.1"
FT                   /db_xref="UniParc:UPI0001831650"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBM0"
FT                   /transl_table=1
FT                   /translation="MSVARLPGLDEESFVESVEDKQEPTDDKPSRHIKRRANVYDAVAG
FT                   RVNLRGVNAFRHVAAQYRDTTSSAARSLRPEELLYRKQNIPAESIEEITYFAHENLPSD
FT                   QALPNSELLETIHAYAADYYEYATADNGKDDHQTMDETALLAMGILIEEMAKEELGETG
FT                   DLALVEGEELTEEEDDKTGRESDTTTKSAARAARRKRASSIVRQRSKRRKVSRSVSVTT
FT                   DLDTEIDERP"
FT   CDS_pept        join(1081186..1081427,1081496..1082714)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190060" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944487"
FT                   /orf_name="Pc18g04550"
FT                   /product="Pc18g04550 protein"
FT                   /protein_id="CAP94679.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001831651"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBP9"
FT                   /transl_table=1
FT                   /translation="MNSYLLNRALGSVTPNEFHVAQTTRLVHNLEPAPGIRFSSRRAAA
FT                   PTNRSEDDVAPLDQELGATAEVFAHKSGVNCLAVDHMISGGADPSIHLWDLESRGSELE
FT                   HVHQSCASVSKSSHADAHTHAITSLSIYPFDPVPSTIFSTAHDGTLKLSALQSPSITPV
FT                   HTFSLDCTPYSHSFSSQPGSTLLVAVGTSDRSVRLVDLRSGLSTQGLPGHNGAVLSVAW
FT                   APHRPHLLASASVDNRVIIFDVRRGGHNSAIATLDMDDPVGLVAPGTGSVPDSYQCRPA
FT                   FSRHARAHNGPVTGVRWTSNGSHIVTTGQDSRIRVWDSATGANTLVHFGPRVRNSSSSH
FT                   LAERAPLIVPKGSMNPGHETLLWPNFNEQDDRGEVSMFELREGTFVKRLRVPGLVAGSQ
FT                   NVRGRSSALSAGRINDLVWRGSGASGEGIELFSAHGDGTIRAWVSREPDGEPTETEQAA
FT                   QADRKRKRDVLDEIYQGFLGPGQPGLRI"
FT   CDS_pept        complement(1082906..1083292)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190049" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944488"
FT                   /orf_name="Pc18g04560"
FT                   /product="Pc18g04560 protein"
FT                   /protein_id="CAP94680.1"
FT                   /db_xref="UniParc:UPI0001831652"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ0"
FT                   /transl_table=1
FT                   /translation="MVQQDPHQGGTLSEMGQGTSMPNDAGKMNTIPSVPRPDQRAEHEY
FT                   YDNEGIAQPSTVMAADNTTDWPRSTRDVGQSGEVISGTGNSMEAGVEAKRAHMGPNHHA
FT                   GHGESREIKGAKYGQSVFDRYQAE"
FT   CDS_pept        join(complement(1086700..1086771),
FT                   complement(1084097..1086646))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823593"
FT                   /orf_name="Pc18g04570"
FT                   /product="Pc18g04570 protein"
FT                   /protein_id="CAP94681.1"
FT                   /db_xref="UniParc:UPI0001831653"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ1"
FT                   /transl_table=1
FT                   /translation="MKGFIGGIPVALLAVAAQAKFAERQENDFHPQAGGTAIGGPSGSD
FT                   GHGHFHPETGATVIGGPSGDHADGFVSPYSANIKTDTKVNEWEKDDHSVKLTHTDVHPH
FT                   PPVVGVPFGHGPQVPGMGPFNGKRDAPHGGTAMGGPSGNDEGQSFDMSVTGNFNTETEE
FT                   ENQDDHSTEIENTDVHPAPVHVHPHGGYPGAAPSIFRPGTFAKRFGQPHGGGTAMGGPS
FT                   GNDGGQSFSAPTNIETDTGINEHNEDDHSTELEHEDIYPQSHAGGFSPFRRSENFGRPA
FT                   HGAPGHIEPHHESHFEPHPESHYAPHSENHYEPHPEPHYEPHPEPHYVNHQEPHVEHHP
FT                   EPHYAPHYSPTYAPHHEPHTTFEHELTAVKNNNNGPSAGSIAFGRRGFPGPESHFEPHH
FT                   ESHFEPHPESHYAPHSENHYEPHPEPHYEPHPEPHYVNHQEPHVEHHPEPHYAPHYSPT
FT                   YAPHYEPHTTVDHEITAVKGNNNGPAAGGIAFGRRGFPGPESHFEPHHESHFEPHPESH
FT                   YAPHSENHYEPHPEPHYEPHPEPHYVNHQEPHVEHHPEPHYAPHYSPTYAPHHEPHTTF
FT                   ESELTAVKNNNNGPGAGGIAFGRRAYAPTPETDATVIGGPSGDDETNGFSAPTNIGVAT
FT                   DVNEHNEDNHAIEGEFTDVHAPADYSREDSPACAAKVQEIVHTVTKTQYHTALETNAIP
FT                   AHAPQKFGADPYANYPEHNVGADPYANYPEHNAGADPYAPSGAGSPNYDSEDVPFVHVP
FT                   MASSAAATSAVYNYPQHSAGADPYAPHKYAASQGPSYSKIAVHVPMATPASYGVFSKAT
FT                   PSGSMGHMVPTGASAQKAAASSASPSPSASHGIMFQGDAARLSGGIFSAAAAVMGVLAF
FT                   IL"
FT   mat_peptide     join(complement(1086700..1086714),
FT                   complement(1084100..1086646))
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ1 "
FT   sig_peptide     complement(1086715..1086771)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ1 "
FT   CDS_pept        complement(1088390..1088899)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944489"
FT                   /orf_name="Pc18g04580"
FT                   /product="Pc18g04580 protein"
FT                   /protein_id="CAP94682.1"
FT                   /db_xref="UniParc:UPI0001831654"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ2"
FT                   /transl_table=1
FT                   /translation="MSLHGLGVIGAQVAASIKSNDEKIPTTPKIAPPRCSITSSPGAHS
FT                   QEFDPSIGAKPCSPFYPHSSPTISHEQLTFETKNANRRSHMRDIESLGPYASCRTDSPR
FT                   RSKLWEEENKPLTWFQTLSNKQRMALKAVVAVVTVGTMIAIALGITAAVGGAGWKTSAG
FT                   KTASGG"
FT   CDS_pept        join(complement(1091857..1092247),
FT                   complement(1091365..1091801),complement(1091271..1091312))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000190015" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944490"
FT                   /orf_name="Pc18g04590"
FT                   /product="Pc18g04590 protein"
FT                   /protein_id="CAP94683.1"
FT                   /db_xref="UniParc:UPI0001831655"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ3"
FT                   /transl_table=1
FT                   /translation="MHFFSLILSSAAIAAALPTRETSEGNQSQPFSQNGLAPWDAGAVT
FT                   QFPIHSSCNATQRRQIELGLNETITLAQHAQDHILRWRNESAIYRKYFGDRPSMEAIGA
FT                   FDVVVNGDKKDILFRCDNPDGNCDLEGYAGHWRGENGTDETVICDLSYETRRSLSTMCG
FT                   LGYTVSESETNTFWAADLLHRLYHVSAIGQGWIDHFADGYEEVVDLAKTNATLTTRDSE
FT                   TLQYFALEAYAYDISVPGVGCPGVQHEHDEATTSQPAPTGTTTDAPSTTAEVPANCHTH
FT                   DGGELHCT"
FT   mat_peptide     join(complement(1091857..1092199),
FT                   complement(1091365..1091801),complement(1091274..1091312))
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ3 "
FT   sig_peptide     complement(1092200..1092247)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ3 "
FT   CDS_pept        join(1092951..1093177,1093232..1093381,1093438..1093681,
FT                   1093734..1094516)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000190004" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823594"
FT                   /orf_name="Pc18g04600"
FT                   /product="Pc18g04600 protein"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP94684.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI0001831656"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ4"
FT                   /transl_table=1
FT                   /translation="MHIFRPFIISLGIAGVYAATPTTSAQSSSVTDCHTHGSDIYCIDG
FT                   NGKEVLVSATSTPTTGVPAQYTGCHSHGSESYCMDADGNDVLVQAEGTATETSSTDSHS
FT                   AQASEESSGETKQNCHFHAGVEHCVGEGESEGGSSGASCGVRSRDYDIPLRIGTLFVVL
FT                   VTSSIGVFAPMLLMKLPSASINGVVSTVIKQFGTGIIIATGFIHLYTHANLMFTNDCLG
FT                   ELEYEATTSAVVVAGIFIAFLLEYIGHRIIVARNSKNHSAETILSESESQQTQPKEHGH
FT                   SPEQQQHSTLAGLSHSHGSYDLTGPNSKFSVMVMEAGILFHSILIGLTLVVAGDSFYKT
FT                   LLVVIVFHQFFEGLALGARIATLHGAIFPSKASMAMAFALITPIGMAIGLGVLHTFNGN
FT                   SRGTLIALGTLDALSAGILVWVGVVDMWARDWVIEGGEMMNAKLGKVFTGGISFVSGLV
FT                   LMGLLGKWA"
FT   sig_peptide     1092951..1093025
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ4 "
FT   mat_peptide     join(1093026..1093177,1093232..1093381,1093438..1093681,
FT                   1093734..1094513)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ4 "
FT   CDS_pept        join(complement(1096001..1096117),
FT                   complement(1095307..1095876),complement(1095212..1095250))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189971" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127875"
FT                   /orf_name="Pc18g04610"
FT                   /product="Pc18g04610 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP94685.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001831657"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ5"
FT                   /transl_table=1
FT                   /translation="MSIEIVPLAQTDIPGAVDCVQKAFANDPYFRWAFNDSSKFNIQRN
FT                   AASLAAHFQYGINCDCPISVAKITRAANESKSNDDIRLPAGTVVGVAWWYSPQAHSTTQ
FT                   SWSVWAQDWLLSFRQLMNNIRFLGRGGLNVRRYWIWKQVQQTAHDAIWQDPRGYYFCNV
FT                   VCVDSKARGMGVGKKLMENVMDKADRENMPCYLESSKGYPNVGIYEKMGFELVKEIECV
FT                   DGGDVCKLYCMIRNPKSKE"
FT   CDS_pept        join(1096247..1096312,1096405..1096475,1096554..1096642,
FT                   1096720..1096934)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670817"
FT                   /orf_name="Pc18g04620"
FT                   /product="Putative uncharacterized protein Pc18g04620 "
FT                   /protein_id="CAP94686.1"
FT                   /db_xref="UniParc:UPI0001831658"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ6"
FT                   /transl_table=1
FT                   /translation="MPMKPLGTVRDKGNRHLSRVEVKSTAPGLRNGAHIAELDGDPRLP
FT                   SSNRNRYRCNVEVLLRTRHPLRPSPCRGPGNILEYLKSFDKIVDLIFRMLYVLWLNAGD
FT                   GLVFGSCGEAKYSANPNQAGRCVIGSSDCGAYQVYQINLDNR"
FT   CDS_pept        1097885..1098301
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944491"
FT                   /orf_name="Pc18g04630"
FT                   /product="Putative uncharacterized protein Pc18g04630 "
FT                   /protein_id="CAP94687.1"
FT                   /db_xref="UniParc:UPI0001831659"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ7"
FT                   /transl_table=1
FT                   /translation="MSRPEWFERLLANDPYNQRRIAVLDSLHDAIFHLLHKPHRRDDVI
FT                   TCLREEVAAEMDISISSAVLERDSQYERLCRNLEVVLPTAIRILSKHNDRDTDEEVAAD
FT                   LISCIPTSLQQPVLWEAEAEDSESGQQDRRLVRR"
FT   tRNA            1098903..1099050
FT                   /gene_name="tRNA-Ser (CGA)"
FT   CDS_pept        join(complement(1101549..1101888),
FT                   complement(1100193..1101490))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127876"
FT                   /orf_name="Pc18g04640"
FT                   /product="Pc18g04640 protein"
FT                   /protein_id="CAP94688.1"
FT                   /db_xref="UniParc:UPI0001831732"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ8"
FT                   /transl_table=1
FT                   /translation="MFPKRCLILLACWTLLQSAVAVPDVALEQPGPEDDRLEERDFGLQ
FT                   ERGSRHPALESSLLSVLTEKLASTTPGGGDGGTTVPGGGGGTTTVPGGGGGTTTVPGGG
FT                   GGTTVPGGGDGTTHTGPGGGGTTATPTGGVPPTGGIGTSPTGGATTTTGPAPPTGGNVS
FT                   PPPSGSVSSPSGTTHISTPSGSPHPSPSQTTHPSPSGTPHTSPPGVVTETTNTGQTPPT
FT                   SEQPSTIHTSPLGGGGQTTTPPTSPGGGVPPSPTTGPPVCPTLSCPAPSVETPACPVPS
FT                   TSKETTVVPVTVTCPAAIVSTTTVTVTSGAGLGGGATGCPCPTGAGPGAGPGAGPGAGP
FT                   GAGPGAGPGAGPGAGPGAGPGVGPGVPPGGTATASTATGVVSPPGSLTASATTSVAHSP
FT                   TGSVTGTLTRTGTGTLTHTLTQTRTSTPLIPTLTSTPLIPTTTRQRTITTGSPTTPATL
FT                   VTLPTTSPHVSPSPGKPAHITPRAIVNPDVIRRQVFSNTTATAHFTNMTVAANATTSAL
FT                   NITRIVTETATEPAPAFLPRFHRGRNRG"
FT   mat_peptide     join(complement(1101549..1101825),
FT                   complement(1100196..1101490))
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ8 "
FT   sig_peptide     complement(1101826..1101888)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ8 "
FT   CDS_pept        join(complement(1103073..1104391),
FT                   complement(1102841..1103006))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823595"
FT                   /orf_name="Pc18g04650"
FT                   /product="Pc18g04650 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP94689.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831733"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBQ9"
FT                   /transl_table=1
FT                   /translation="MSTNVGSANKTGDHEFDIVNTQSTTTAQSTTPFDEKTTVHTDNEK
FT                   FDMEAAPEQEPSPEDVYRTASTVAPSQRSTRRDPVSRVTTDAEGNTYPEGGLEAWLVVL
FT                   GSFLGLFGSLGLVNTIGTFQAYIQTHQLKEYSSGSNGWIFGMFAFLTFFCGVQVGPIFD
FT                   ARGPRLLVFAGSVFQMAMIILLGFCTEYWHFMLVIGVLGGVGASLIFTPAISAIGHYFY
FT                   EKRGVATGIAATGGSVGGIVFPLILQDLFPKIGWAWATRVVALICLIVLSIANFLIKSR
FT                   LPQKPFSKENVLPDFRIFRDPRFALTTASVFFIEWGLFVPISYISSYALDHGFPTKFSY
FT                   QIIAILNAGSFFGRWLPGFFADFLGRFNTLIATVALCVLCNACLWLPAGDSLPLLVVYA
FT                   ALFGFSSGSNISLTPVCVGQLCKTENYGRYYATAYTIVSFGTLTGIPIAGEILARCNGS
FT                   YWGLITFTVCCYAAGLACCTAVKVIQVGWRHPLAIY"
FT   tRNA            1105410..1105481
FT                   /gene_name="tRNA-Ala (AGC)"
FT   CDS_pept        join(1106562..1106760,1106814..1107096,1107147..1107373,
FT                   1107428..1108317)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976774"
FT                   /orf_name="Pc18g04660"
FT                   /product="Pc18g04660 protein"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP94690.1"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="UniParc:UPI0001831734"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBR0"
FT                   /transl_table=1
FT                   /translation="MLLKSVLTSALLALSLGSDIATASKHGRFAEIARAPQEKAKRAVE
FT                   ARNQKHVNSDKDYRFLNKNTKRYLVDSLPEVLFDIGEMYSGLVPIDMNNSSRSLFFIFQ
FT                   PTINEPVDEVTIWLNGGPGCSSMESFLQETGRFIWQPGTFAPVENPYAWVNLTNVLWVD
FT                   QPVGTGYSVGTPTAVSQEETAQEFVKFFKNFQKIFGIKNFKIYVTGESYAGRYVPYISA
FT                   AMLDEKDKEYFDLDGALAYDPCIGQFDTVQEEVPVVPFVQQNLNLFNFNESFMAELDKK
FT                   HKSCGYEKFIDKYLTFPPPEVQPPLLSSSLDDDCDLFSLVNNEIFHINPCFNVYEINQM
FT                   CPLLWDVLAFPTSLDYQAPGSSVYFDRADVKRALHAPKTAWSGCSLEPVYVGGDSGPER
FT                   EGDISANPIEHVLPQVIEATNRVLISNGDFDMVVITNGTLLAIQNMTWNGHLGFQKKPD
FT                   TPIDIKMPDLMYADVFAENSQSGVDGPQGVMGVQHYERGLMWAQSYQSGHMQPQYQPRV
FT                   AYRHLEWLLRRTEEL"
FT   sig_peptide     1106562..1106630
FT                   /db_xref="UniProtKB/TrEMBL:B6HBR0 "
FT   mat_peptide     join(1106631..1106760,1106814..1107096,1107147..1107373,
FT                   1107428..1108314)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBR0 "
FT   CDS_pept        join(complement(1111056..1111150),
FT                   complement(1110894..1110973),complement(1110267..1110421))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944492"
FT                   /orf_name="Pc18g04670"
FT                   /product="Putative uncharacterized protein Pc18g04670 "
FT                   /protein_id="CAP94691.1"
FT                   /db_xref="UniParc:UPI0001831735"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBR1"
FT                   /transl_table=1
FT                   /translation="MSLLARSIPFKYRRGFRERSRVDLQMWGAAMGLADGLVSIDTGFV
FT                   AIAVDEMVAGLVQGKRDRDWVGPGTGVVGCSMKAEHIPEIMQWILEPWNVFRTWQVGYG
FT                   LATAL"
FT   CDS_pept        join(1111223..1111478,1111561..1111673,1111725..1111942,
FT                   1111995..1113111)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183590" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944493"
FT                   /orf_name="Pc18g04680"
FT                   /product="Pc18g04680 protein"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94692.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831736"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBR2"
FT                   /transl_table=1
FT                   /translation="MGLEKFNPFKKDSPTFPSVVIPLAQAPAHSLSEKADKESNRSLDG
FT                   SSSSENGAAGSKDSTHLTLEALRAEVESDISTSTNDSAYDRKSRVINRALQDIGMGRYQ
FT                   WQLFILCGFGWTADNLWLQGVALTLTPLSYEFGLSATWVRFSTCALFLGLCIGASFWGI
FT                   ASDIIGRRLAFNATLFLTGAFGLAAAGGPTWIGTSALYACLGLGVGGNLPVDGALFLEF
FT                   LPFISGNLLTMLSVWWPVGQLIGSLLAWAFIPNFSCTSYEGCTKEKNMGWRYLVLTLGA
FT                   ITFVMFILRFFCFHLYESPKFLLSRGRQEEAVASVHGIAYKNGAKTWLTNDILNEIGGH
FT                   AEVHEKETGLTYSQIVGRFFSKFSMERIAPLFANKRMGWNTALLWFCWTTIGMGYPLFN
FT                   AFLPQYLSQSGGETNSNYITYRNYAITSIVGLPGSILACWTVEIKYVGRKGTMAISTLI
FT                   TGVLLFCFTTSTNSDIQLLCSCLEAFFQNIMYGVLYAYTPETFPAPNRGTGTGISSCLN
FT                   RIAGLCAPLVGIYAGSANPNAPIYASGGLILASFVAMCLLPIETRGKQTL"
FT   CDS_pept        join(complement(1115889..1116308),
FT                   complement(1115329..1115573),complement(1114122..1115271))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183591" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944494"
FT                   /orf_name="Pc18g04690"
FT                   /product="Pc18g04690 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP94693.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020650"
FT                   /db_xref="UniParc:UPI0001831737"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBR3"
FT                   /transl_table=1
FT                   /translation="MSTIQNIKNFIRHGKQARLVTPHSEPTTDVSTIHAEPQRQPIGQY
FT                   SPALEAFGPEGRANAVHKPDSQVRQDRSVEIERLVAEENMNRSKMPKYPGLERWILVEK
FT                   MGDGAFSNVYRARDSTTEYGEVAIKVVRKFEMNSNQRANILKEVQIMRNLDHPNVVKLI
FT                   DFSESRQYYYIVLELCPGGELFHQIVRLTYFSENLSRHVIRQVADAIEYLHETSGVVHR
FT                   DIKPENLLFYPIPHVPSKNPKPQQPGDEDKEDEGEFIPGVGAGGIGKIKLADFGLSKVI
FT                   WDSQTMTPCGTVGYTAPEIVKDERYSKSVDMWAMGCVLYTLLCGFPPFYDESIQVLTEK
FT                   VARGQYTFLSPWWDDISKSAQDLISHLLTVDPEKRFTIKEFLAHPWIQGTNEETTAAED
FT                   APPLATPHLQTPEKAAHQLDSSGAEHGPYQPASARFLDQPSVAAERRMDFRSPGAFNLR
FT                   EVFDVGYAVHRQEEEGKRRANARQANRGGTAGFQSALGALNEDYDDEPEYNHGLGGQPP
FT                   AKVAKSQGDMAGMEAKLRSTNLGAQSSAAQARQPPNQTKPKQGYGMHDANVANAAKTSI
FT                   RKHQQPFELTLSGSTLLEKRGRRNQPVA"
FT   CDS_pept        complement(1117665..1118498)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000082822" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670818"
FT                   /orf_name="Pc18g04700"
FT                   /product="Pc18g04700 protein"
FT                   /protein_id="CAP94694.1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI0001831738"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBR4"
FT                   /transl_table=1
FT                   /translation="MESILSAHEIGEGLPVLIIHGWQMEGRAEEVDFEPIFNKTPGLRR
FT                   IYVDLPGMGATPANNVKDLDDIYLGLVQFIDSRLGNSRFLVVGSSCGGYLARAIAQKYI
FT                   EQVDGLLLRVPLIEPKDSVRDLDAFKPLVANEQLMSNISAEDKAHLGNVLVQTPPYVKA
FT                   LKAKCEEVYLPAEKAADNKVLDPIRADPHRYQLSFSLDDQNAKFFAPTLVVCGRQDESV
FT                   GYRDSLRLLELYPRSTYVVLDRGTHGLPIDETGLFEALVRDWITRVGEWRVHSER"
FT   CDS_pept        join(1120200..1121694,1121812..1122917)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183602" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944495"
FT                   /orf_name="Pc18g04710"
FT                   /product="Pc18g04710 protein"
FT                   /protein_id="CAP94695.1"
FT                   /db_xref="UniParc:UPI0001831739"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBR5"
FT                   /transl_table=1
FT                   /translation="MPGVEVMGSSEDLQAFERPLLRSHKTLPRRGVIVPSIEVIQPVSP
FT                   DQNGRHTATPSLPLTPPGAGHEELVVDEQTQKMNSSLSDIPTSGMLTPRRPSKPPTPDV
FT                   TPPRTNSNKRPTLNQFNYFSSSSRADSFQTALENISSEEDMDTPVRVSQTTTQTPKQRR
FT                   QPSKPPASNGYLSHFPNIKGSPLSASQQHSGTECDTGFESFDGHWAANPIDGSPTPLAG
FT                   KRKSAQKHTQPVYNPTPGKDALDVMHLDASLMKEKSLRDRIHGAHEVKASTSMEQSHGN
FT                   IGSPSPDCPAGFGGPDTRPLSVISSASTVEAMIIDSPKRAQRILRHTEKRSSLRSASSP
FT                   MTRSERTSYGSLAESQRRLVHKSARISDQDVRSGPSEMSFSAKTSNSAIQPNIETINVV
FT                   VIPERSSSLSSRPNSHVSSKPGSHRSGRRPPTASTGRTDIQGQKKRTVSDSTSTRSRET
FT                   DSRVCSTGRPVIPPRRSSLSAPTSRNNSRANSLTSNSLRSPIDLEMQKRREHQPEHQPV
FT                   SPPRHNVLASPDRRSLLEPPNMHALFASSDDMATLRPPSLPFTQGSIPSSSPGPIEIQE
FT                   ATAVSLFAHNNHSLLLVDPRVRASSRRPLQALGISYDLPQIPRTPDNPSQIATFDVDSP
FT                   LKNPRPPPKPPSTRPHPPLPLPDAQDENKGLGQRWNSVRRTWSARPRSDSFNTIARSFS
FT                   MKSAKNRTAGMEMDSRLYPFWRPRGFWEDVPGSPEKESSPTREDLPRPDESLIVNNSLG
FT                   LPQRRIVFDGPAALARRSPEMKRLFNGMTSNGSLVDQGMFRTGSPLNPTPFRSLSRWGL
FT                   RFRSMSWRNVRDRLRRVRQRRDERKRAVRREILKQSIGGPVYVASSATAEVAMR"
FT   CDS_pept        join(complement(1123638..1124105),
FT                   complement(1123502..1123543))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976775"
FT                   /orf_name="Pc18g04720"
FT                   /product="Putative uncharacterized protein Pc18g04720 "
FT                   /protein_id="CAP94696.1"
FT                   /db_xref="UniParc:UPI000183173A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBR6"
FT                   /transl_table=1
FT                   /translation="MAPSASSKKSRPLLIPHKRALLPLQTKRQSRKVYKVLNPSAIPAE
FT                   TSIKQSYEEETQERNKPASSSEHNKSAVEDEDYELQPPHFEASFAMPPQPFLDPPTWEA
FT                   MLKHGRERLASQSIKDESGLGAGREDESAERVRQRVERETEYGSMAIRGRSSIPHIWLP
FT                   GQIMTF"
FT   CDS_pept        join(complement(1126446..1126547),
FT                   complement(1126095..1126331),complement(1125860..1126044),
FT                   complement(1125634..1125756),complement(1125413..1125581),
FT                   complement(1125241..1125357),complement(1125012..1125186),
FT                   complement(1124904..1124948),complement(1124644..1124836),
FT                   complement(1124376..1124547))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944496"
FT                   /orf_name="Pc18g04730"
FT                   /product="Pc18g04730 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="CAP94697.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000183173B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBR7"
FT                   /transl_table=1
FT                   /translation="MAFLHNLCWIEVEPRVAAIVLCILVPSIFCSVVAKQVPFPARKDY
FT                   FSVLYQQYKFVVDGPSMIKKGYEQFASGLFEIPRTFRFGQVILCQPELIEELRNKPSTL
FT                   VSPEPWIDQLLQVSHVMPGYFPKGMGWPKIAKTTPGLIRATVYKHLHRYMPSMNQAIIS
FT                   QLQTLDFKDGSNFALVGSRLSRNEEYIKAVKDHILGMIVTTRVQFLVPDRLKPYIGGLI
FT                   GRLATLGTSWDMHASRKIMLKHFDARAAEYHAEIFSGNQRETSLDESDNPVEIFQWLYE
FT                   SSVLRERWTYAEVIGEMLLLQFAFIYTTSYGLYGALAELARRPEYIAPLREEIDLNFSR
FT                   MGPTVPACDGMVLMDSFLKECQRLHPPSALSAHRVCISDLKLSNGVTLKQGSHVAVPSG
FT                   IIQRSSEHYTNPDAFDGFRFVKRAAGGAKDSRLVDLSPDYLVFGMGAHACPGRWMACAL
FT                   MKLAFAHILNQYDILLPNSTSLPLTGSLSFEEFYVPNFGLRIALRRR"
FT   mat_peptide     join(complement(1126095..1126331),
FT                   complement(1125860..1126044),complement(1125634..1125756),
FT                   complement(1125413..1125581),complement(1125241..1125357),
FT                   complement(1125012..1125186),complement(1124904..1124948),
FT                   complement(1124644..1124836),complement(1124379..1124547))
FT                   /db_xref="UniProtKB/TrEMBL:B6HBR7 "
FT   sig_peptide     complement(1126446..1126547)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBR7 "
FT   CDS_pept        join(complement(1129301..1129489),
FT                   complement(1128806..1129230),complement(1128316..1128753),
FT                   complement(1127989..1128257),complement(1127404..1127931),
FT                   complement(1127033..1127346))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183613" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944497"
FT                   /orf_name="Pc18g04740"
FT                   /product="Pc18g04740 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94698.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000183173C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBR8"
FT                   /transl_table=1
FT                   /translation="MAGVNQLPVSVAADGVHGRKRNVTIAGIDSSPGSIEDMDDNEARE
FT                   EKRRQPVKRACNECRQQKLRCDVIQDPWTDCSRCRRLRLGCKIESNFKRVGKRSRNAEM
FT                   EREIMELRKQIASGQPVSGMPQQQARQLTPKQESNQVSPAVYQTPSAMSADQYMGSQEA
FT                   VASLLDLRSGFDGTNFMRNGGQIRRIEDVMVAPEKVTELFNIFFTYYHPFLPFLDQNQS
FT                   PDDYNNSSSLLFWTILSVGARRYQGDSNLLNSLAGPVSRLVWSTLADIPQSYHVVKALA
FT                   LLCSWPFPTSSTSTDPTFMLCGMMVQVAMQLGLHRPSHTQDFSKFRVELIEDELRDKVR
FT                   TWAICNIVAQRVSTGYGQPSSTLYDWTLSSSDSLDPNFKLPENIKPRLEIEKFCDKVTR
FT                   ALYTNRRDPVGLTSDHERSTMITFLSRDFEELEEQLKSQNDCITDLFLRAANLHLHLSA
FT                   FFDEPTTKNYRERVLSLYVATTSFLEVVLNLETEVGPVLSYTPYYVYQMMVAAGCTLLK
FT                   LCKSFFASHIDMEYTKNLFNRTIWAIRGVSASSNDLPERLAEVLAQMWRLGGATQRANN
FT                   STDVDDSLRLRVRCRMSMSLLFDSVWRWREDARTKGRNIEAYLKNPTNPDSAADSSATS
FT                   SVGPVHTSTITPGITGNDPSLAPAPLLSQATLGIQPSTSQSNGLPSGFIEPNYEVFDPL
FT                   NWLLDGLVDLPYSYSTMGGIESQGIA"
FT   CDS_pept        join(1130478..1130988,1131042..1132766,1132822..1132857,
FT                   1132915..1132970)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183624" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944498"
FT                   /orf_name="Pc18g04750"
FT                   /product="Pc18g04750 protein"
FT                   /protein_id="CAP94699.1"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniParc:UPI000183173D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBR9"
FT                   /transl_table=1
FT                   /translation="MDMSTDEKSKEALHQPEVIGKSSERPPSYSADQVEQPPLELPQLD
FT                   LSSCLPSSTTVTRDQCVSHLKLLAVFADLRDTISSEDGLFGIHDAVAEEFQRSPDRMNE
FT                   ARARIREKRWAVYTARAVDRYTKWWSDGLPRSRPMATINDLESVHYENILVCDTIVAWD
FT                   TDNLPPLDILMVWHAHCLNPRNFLEDCIRYGKMSTWVTGFPWEVIDRSVNNHTMEYTVS
FT                   EQGQQLFEQKLNIKWNNLHDPPTKQVNCPCCGRLNYVPWTKPFLGTLSEPFRFNQGYAD
FT                   DAFTDICVGCQHVIDHGRLKVAKFRKDLEATLYENLPMPGSFTNLQGIPEGSSTETNHG
FT                   ALRDMLFPTRVLQVAGRDLMDFTDGRVDRCQTIAQLRNQIDVTLWNKKILKQTHGAYID
FT                   TLRRGEGIQLRRMMSRYWENLGPFALDLVGAVIRQGTFVDKMDQIDWLHSPTVFDTMDR
FT                   LIKKYEVFFRIMLENPHNIAVPTLDVDLAWHTHQLSPSRYYKYSTSNVPFGCKRTFIDH
FT                   DDKVDEGKLSDGFAWTSKMYRRATNGGIYSECTCWYCEATRTSDLYNRLIPVGSVSRAR
FT                   TAADRLHDRPDISSDPSKNPHISSHNAVRPNDTYQYQHRPIKDKRSIQRVRLKSDYEKA
FT                   ARRAEKRRQRSDSKSSDNKSDPYYTPYAFGFPIVMPFYAPYMMDPSINCHSYANNPSCM
FT                   GTSLGDVGNCCAGACGKFFHILLGVLSEIDMSKGGTVAAGACAGAFGGGGCGGSGGGCG
FT                   GGGGGGSGGGGGGGGGCGGGGS"
FT   CDS_pept        join(complement(1135274..1135746),
FT                   complement(1134256..1135096))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184310" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944499"
FT                   /orf_name="Pc18g04760"
FT                   /product="Pc18g04760 protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP94700.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000183173E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBS0"
FT                   /transl_table=1
FT                   /translation="MSRPLPNTSQRHHAHSISLGALNPNHRVTRRKSVTTAAANAAAAV
FT                   AASMEGGEATSLPMGAHRRSLGARKGLESGSIGNVSGFSSYLSRSINSPSQESTVARKG
FT                   SPGSDQSDGKPKNRNRRASEGAQLKTEGKRASTAIRCDRCGKGYKHGSCLSKHMWEHDP
FT                   AWSVTSKLLISKHQQVQLLEAASVLVTMNHDDPPDESAELESELSSGSPDALSETRDGI
FT                   SSAETTPPPMDSEEDDDFEMSGVPAQWAKRPSVSNASGFSRSYQSIPSSSYNESAPLHS
FT                   PTFSHFRHSSIDTRPSTADTRLHEDDEADLAAAIGLCNFGTPRTGPVSMTPDVPPVPPL
FT                   PARYLDSSSHPSNHGLHSLQSRPIEEAARRDSEANIDVFLSRSLNPSLSYKVSDEREVR
FT                   TGDEAHKSRQRRNADVDFGNRSAPVDDDDGGVFGHMEE"
FT   CDS_pept        1137835..1138882
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(1140273..1140331),
FT                   complement(1139134..1140067))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184298" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823596"
FT                   /orf_name="Pc18g04780"
FT                   /product="Pc18g04780 protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAP94702.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI0001831813"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBS1"
FT                   /transl_table=1
FT                   /translation="MVEESHPAYLSPSELGTKDYWESYYARTLAHISHEAPKNNPNANA
FT                   KDQNDDDAASTSSDLNEEDDPGTSWFSEHNAPQKVLHFLTRKSFPLSPRNIHRGSRQPS
FT                   VLDLGTGNGSMLALLKKKGGYGGRLVGVDYSRQSVELARELQRVRGHSAYRTDSEDEDE
FT                   DESDDEEDDETEAEAGSDDLPEQETSIQFEEWDILGSKAILSETGLEVSPSSPSEETLP
FT                   WFPYHEGGFDIVLDKGTFDAVSLADDAKTIRVCERYPDIARRLVRRGGFLIVTTCNWTE
FT                   EELVHWFTGGRTNGDRLAVWGRVEYPRFRFGGHEGQGVCTVCFQRLGDA"
FT   CDS_pept        join(complement(1142318..1143180),
FT                   complement(1141237..1142175))
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(1144913..1145245)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823597"
FT                   /orf_name="Pc18g04800"
FT                   /product="Putative uncharacterized protein Pc18g04800 "
FT                   /protein_id="CAP94704.1"
FT                   /db_xref="UniParc:UPI0001831814"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBS2"
FT                   /transl_table=1
FT                   /translation="MSTKRKLLMSQSRVLFLEAHAETSGVSFRIKNARERGSSIWNFSG
FT                   TNQIFGDRVMNTMGISSPDSAYGEVKIQFQDYNPRGEGRSFVIPRKYSGPQASVTLPSL
FT                   HGDNPS"
FT   mat_peptide     complement(1144916..1145182)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBS2 "
FT   sig_peptide     complement(1145183..1145245)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBS2 "
FT   CDS_pept        join(1146802..1147320,1147446..1149296)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184266" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944500"
FT                   /orf_name="Pc18g04810"
FT                   /product="Pc18g04810 protein"
FT                   /protein_id="CAP94705.1"
FT                   /db_xref="UniParc:UPI0001831815"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBS3"
FT                   /transl_table=1
FT                   /translation="MAAGSRDHLQPNQVNQHRDYDHDQHFQHFRHFPHSRSLSLHTRFD
FT                   GPTDETPNLTTKRSLLHRARRSILSFSSPSPQASESPHASKRPRQDELHQDRPDVKRTM
FT                   PSSLAYSGATRTLNENARSLNGSLNGTHRGIEDKSSTDEGRPKNEDVFLNIARADSGRR
FT                   DSIGRSDFRRSRLGYSSQSLRSPTTEQTPSPDQRYSNIDNPLHLQNDSPTAPYSSIHTP
FT                   ASSTHPLDDSGRFRYSGLGSSARSAVGVPRSRFSRTSPETSPRTPTAAEEQERRSSLTD
FT                   PRINRYSGLSTIRSSRQPSASEVTGRPRADTERSRADGTESTLSTTAPSTVWDELDDLK
FT                   DRIKKLELTGRLPPSSSAAMYTPTNERPRTANTAITTLSSSPKQRRKASVSTADTERSP
FT                   VHPILQSALAKAKAVLSGDVYTSLEATITDALNLSTALGVNTAPSGSVSVVNGGYTSPE
FT                   RHARRKADSVCRSLTELCLALTDEQLKSARPASSRETGVQPQLSNGTGVDARMSVPTYQ
FT                   RNGSKEPEGVERRHSTTRISNRLDARRASLVNTSPGNTTDVKQSPSQSPGMSNPASRLN
FT                   RMSSSLRSRRLTIGEESGETESPHSRSVSRANTEIGTPLPAQAIPPPRQRFSQGHTVSR
FT                   SISGVQQDQSSVAYSPRSPQYQSSQVPQPQVQSSQPRTPTLSSSLSFRRSYMNPATYTP
FT                   ATSRSNIQAGSRRYGLTPSFSSNNVQGSGVEEGLRSPQMEPSQTRISTPSSKVATSYTP
FT                   IQSPRLRTNSLGARRFGLRNRAPATPNNVNLDDSID"
FT   CDS_pept        join(complement(1151987..1152386),
FT                   complement(1151145..1151845))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184255" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944501"
FT                   /orf_name="Pc18g04820"
FT                   /product="Pc18g04820 protein"
FT                   /function="RNA binding"
FT                   /protein_id="CAP94706.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI0001831816"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBS4"
FT                   /transl_table=1
FT                   /translation="MDSAEIHQTTAVDHDEPMTDNFNDNLADQGDLEAPLKTEEEYAIA
FT                   DLTLRAIVSSKEAGVIIGKAGKNVADLRDETGVKAGVSKVVPGVHDRVLTVTGQLRSLA
FT                   RAYAIVAKGLLEGAPQMGMGGIVSNNGTHPVRLLISHNQMGTIIGRQGLKIKHIQDASG
FT                   VRMVAQKEMLPQSTERIVEVQGTPEGIEKAIWEIGKCLLDDWQRGTGTVLYNPAVRASL
FT                   SGSQPLNNNPPAGNGYQNNTSSRQYNRTGNGADFSDGGYNRRSNSDAGNRGYPLVTEDG
FT                   EEIQTQNISIPADMVGCIIGRGGTKITEIRRSSGARISIAKAPHDETGERMFTIMGSAQ
FT                   ANEKALYLLYENLEAEKTRRSQLPQE"
FT   CDS_pept        join(complement(1154185..1154333),
FT                   complement(1153979..1154125),complement(1153812..1153908),
FT                   complement(1153290..1153754),complement(1153015..1153239))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294694" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944502"
FT                   /orf_name="Pc18g04830"
FT                   /product="Pc18g04830 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94707.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831817"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBS5"
FT                   /transl_table=1
FT                   /translation="MAPATSDSGMMQAVVFHGPYKVAVEQRPIPKVQNPEDIVVKVGYT
FT                   ALCGSELHMFRGVEPAGTGFIMGHEFVGEIVEMGSAVKTLQMGDRVVTAFTTSCGECFY
FT                   CKQGWSSRCDKNSLFGCDSLDGGQAEYARIPNADGSVMKAPEGVDEKYLVLMGDIFPTG
FT                   WFAANNAFKNSTPEQIAEQTVVLIGCGPVGLCALINALEYKPKHILAVDSVPSRLELAK
FT                   SLGAEPWNFQLDRAGLDKRVQELTNGRGADAVIEVVGLSPALRTGFELLRPWGTISSVG
FT                   VHNGEIPWDGNDAYSKNLTVQMGRCPVRSVAPQALEVLKRNQHKLGFMADKMMPLSQAV
FT                   EGYDLFNAHQVQKVIFEADK"
FT   CDS_pept        join(complement(1155405..1155503),
FT                   complement(1155088..1155321))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184254" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127877"
FT                   /orf_name="Pc18g04840"
FT                   /product="Pc18g04840 protein"
FT                   /protein_id="CAP94708.1"
FT                   /db_xref="InterPro:IPR004910"
FT                   /db_xref="UniParc:UPI0001831818"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBV6"
FT                   /transl_table=1
FT                   /translation="MGLSYNVYLTANKIFGCKGCKTHLADFNEIMSRNFRGQHGKAYLF
FT                   NKVVNVTQGEAVERNMTTGRHIVRDIACRQCKETVGWKYDKAYESSEKYKEGKFILEEE
FT                   LFCVVC"
FT   CDS_pept        join(1155563..1155606,1155655..1155784,1155831..1155872,
FT                   1155954..1156052)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127878"
FT                   /orf_name="Pc18g04850"
FT                   /product="Putative uncharacterized protein Pc18g04850 "
FT                   /protein_id="CAP94709.1"
FT                   /db_xref="UniParc:UPI0001831819"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBV7"
FT                   /transl_table=1
FT                   /translation="MAAEVLRGEFETAERGSVFACFLRYGVVGPALGSTWEDLCGSPAV
FT                   DLLIDLSLYVLANGSMERGCRTSQPPKGSRLKAFQNGQLVQGVQRSQESQESAQASSEV
FT                   "
FT   CDS_pept        join(complement(1158188..1159241),
FT                   complement(1156345..1158116))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183346" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670819"
FT                   /orf_name="Pc18g04860"
FT                   /product="Pc18g04860 protein"
FT                   /protein_id="CAP94710.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000183181A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBV8"
FT                   /transl_table=1
FT                   /translation="MDIHRCRFVSYNPQAINALAFSHPPSADLAGRGVPTLRLAIGRAN
FT                   GDIEIWNPMRGAWFQETVMRGGKDRSIEGLAWTLDPQEDGPDGTKLPGKLRLFSIGYST
FT                   AVTEWDLENGRPLRHSSGNYGEIWCLAAQPRWQATKGKDGKVLPPAEGEHIGQHLAAGC
FT                   ADGSIVILSTADNELKFLRLMRPSTKRARVLSVTFQNRHTIVAGYADSSIRLFDIRSGQ
FT                   MLRTISLGKGPTGGPKELLVWSVKCLPDGTIVSGDSAGEIRFWDAKNYSLVQRIQGHLA
FT                   DTLDIAVSANGDTVVSGGADQRTVVYRKKEGEKGDKKGRWAEIMHRRYHTHDVKTFAVY
FT                   ETKDISIAVSGGPDATPVVLPLREFGKEHHRKLSSLPQIPQLTSAPSSRLVMSFWDREV
FT                   SLWRVSRGPASLHENIDGQRHRLVGKVLIQGEENISSAMLSSDGKTLAVATIAEVKLFS
FT                   LRRRKGDEKGALRIQKIDVPKVLSDEGARLVTISPDGRWLSIVRPNSDIYMARVQPASV
FT                   SNEKPQVVPQFAKLKRVARHVRHEKASHGTLGDYERTIRSVVFSDDSKVLACGDISGCV
FT                   DTWVLGAGAANGAAKRSGASESDDDSSDDEDEDVVIEGECWTTAATESPIPRMKSGITL
FT                   LSFRPKSAPTQKLLANATHRSDEDRLMVLTSEHQLIEFDARDGKLSDWSRRNPKAYLPA
FT                   EFRGVKDRAMGCMWDLCEGRERLWLYGASWLWMFDLLQDFPSPEEAEAKTEEGKTAGQL
FT                   AKASKRKREALDDDEYERRKHNTGAGDRIPQSQMDVHFGTKVRKIVGSDESQGEWIALD
FT                   KERPRVPGEDDEAYEYDETFAATNETTLARLRRGDGTAVETETPQKGSQKHTGDTPKKQ
FT                   LVETNGASAQPTRRWWHTYKYRDILGIVPLNTLSDDDSDDQSPSGILEVAVVERPMWDV
FT                   ELPGRYVKDYE"
FT   CDS_pept        join(1159250..1159396,1160058..1160174,1160225..1160448,
FT                   1160589..1160738,1160810..1160975)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127879"
FT                   /orf_name="Pc18g04870"
FT                   /product="Putative uncharacterized protein Pc18g04870 "
FT                   /protein_id="CAP94711.1"
FT                   /db_xref="UniParc:UPI000183181B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBV9"
FT                   /transl_table=1
FT                   /translation="MGASKPESSFRTVLSGVQIRNGRAEDQFRNSSARAVKPAFRQSSL
FT                   GHKWEAITDQQPDLVVLQSRSGVRRGTIGYQSKFRRCKQNTRPAIVYGDYHATCKGASG
FT                   KYAAKMQAQLNMSARVDKFRRELCCLQPTVTCNHEWVWQVPIRLALNREQRDGHRRAAT
FT                   GQCTYDCYHNLSLDEHERAKRQGGDAEMDVHMVIGRSRIKVRIRRPQTDRVLYFHAVMK
FT                   HSVPRGKFLVWASWDFTRLQAAAAGWLLETPLSAWLGPNPGALDG"
FT   CDS_pept        join(1161241..1161306,1161676..1161741,1161784..1161981)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127880"
FT                   /orf_name="Pc18g04880"
FT                   /product="Putative uncharacterized protein Pc18g04880 "
FT                   /protein_id="CAP94712.1"
FT                   /db_xref="UniParc:UPI000183181C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW0"
FT                   /transl_table=1
FT                   /translation="MGRDLEDIPPTVGTLRQTRSSVGDRAANPVSISTVDYNIETLNPL
FT                   RERGSVGREPGNDGIVFRGLCRVPLKYLGTWRTGVHRALTKRSFIRLETLSALIKAAAA
FT                   KIIAT"
FT   CDS_pept        join(1163509..1163647,1163783..1163840,1164824..1164871,
FT                   1164976..1164999,1165106..1165146,1165525..1165670,
FT                   1165744..1165868,1166131..1166216,1166308..1166442,
FT                   1166725..1166897)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127881"
FT                   /orf_name="Pc18g04890"
FT                   /product="Putative uncharacterized protein Pc18g04890 "
FT                   /protein_id="CAP94713.1"
FT                   /db_xref="UniParc:UPI000183181D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW1"
FT                   /transl_table=1
FT                   /translation="MVDISRHGPGITVGGCGVLVMSATVCSEFAMVPWFRRRVDVGEHY
FT                   LDYCKSRVVFKYSVWNMEYGMRCGTTPAGRIGSASASGMCPIATTIQGTLPRTEYGVSD
FT                   TAQLSGLLRSITIKVLAINLNAGMVGDNNSPWHAMRCEFLQGTKFAEQSRQHPLMAIAY
FT                   HFPLSFPASAARGGNTPLSIGDHCFGNCQPRGYGIKWLRSIPGGPYRAFSSNLGIGRGQ
FT                   IQHGVKAGILTAKPVNLDESRRLQTLSRVEKLGTNQVHLRCHRRCWQSQASGPVTTGRR
FT                   RPLGRDRIGGFVWSKREREPLQPIAALVTKVLDDEPTMAEDWP"
FT   CDS_pept        join(complement(1168596..1168647),
FT                   complement(1168292..1168370),complement(1167927..1168204),
FT                   complement(1167551..1167846),complement(1167410..1167472))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127882"
FT                   /orf_name="Pc18g04900"
FT                   /product="Putative uncharacterized protein Pc18g04900 "
FT                   /protein_id="CAP94714.1"
FT                   /db_xref="UniParc:UPI000183181E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW2"
FT                   /transl_table=1
FT                   /translation="MWCRSLIVALTFGMSSNRNDAKSEVYDVGAAVCLEHGPEAIPIIK
FT                   FEYPLLVYPSGRSDIDTMHTSKYQKEKKKRISYPSFKAQCQSDTENEFVSTQSQSEWVS
FT                   YAVARVTGRSWNRRVRIVKVRGSGRHRADKEEAGRMRLRRLECRRILTQPVDQTLSPQD
FT                   WQGEERGGKKGKRKGYEEEKERGTRRRFLTFSLQAGVGGRKKEKEEVKKLRRRYTAGLY
FT                   GNPRDRVEAEHLKVTRASSLQGHKTGVETCKTA"
FT   mat_peptide     join(complement(1168292..1168359),
FT                   complement(1167927..1168204),complement(1167551..1167846),
FT                   complement(1167413..1167472))
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW2 "
FT   sig_peptide     join(complement(1168596..1168647),
FT                   complement(1168360..1168370))
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW2 "
FT   CDS_pept        join(1169611..1169823,1169886..1170983)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944503"
FT                   /orf_name="Pc18g04910"
FT                   /product="Pc18g04910 protein"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP94715.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniParc:UPI000183181F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW3"
FT                   /transl_table=1
FT                   /translation="MDYHRNYRPCPTFFVEEDYGMESRIRQERQAKQEHDKQMARERQY
FT                   VMADELSNLTSEQLRDDVLSHMLEMDNQTLPDVESIDIQTEIQWFMRPYLLDFLIEAHT
FT                   AFQLLPSTLFLAINLLDRYCSKRVVYKRHYQLVGCAALLIAAKYNDKKDRVPTIKELKS
FT                   MCCSLYDDDMFTQMEWHVLQTLGWSIGHPTVDAFLQHAVLDDAYDPEVEHMALYILEIA
FT                   LFHRDFVAKLSSELARAALALSRCILNRPQPRHTHWSSQYDSMTLVALSQQLHQPSTVV
FT                   ARKYASAHYSRVSKVMEHFLNRQASLATYARCTPPVETPIESKPYNGEIGLATPQKSQQ
FT                   LTAIPHGYLTPPITPDNEALVHAHAQMANHDMTRGIPTVHHGCSPSPAPSAEMQYMNSE
FT                   AYQQQQEAMYMAQQAALQQFPMAPTHMGMGQTYQGGM"
FT   gap             1171491..1171590
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(1177656..1178024),
FT                   complement(1174977..1177595))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183390" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944504"
FT                   /orf_name="Pc18g04920"
FT                   /product="Pc18g04920 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="CAP94716.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="UniParc:UPI0001831820"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW4"
FT                   /transl_table=1
FT                   /translation="MDPILDGLNHAQREAVTSSGSILQVLAPPGSGKTKTLTARVAYLL
FT                   SHHKYQPQDVICCTFTIKASREMRERLAKLIGEKLESRLILGTFHSICRRYLVKYGYLI
FT                   GLRKGFGIADSDDTRAIIRRSIKRLKSSIEVKAAQGRISRHKAHGLSPDALADRAKAEE
FT                   LELVDIYRDYESALAASNLLDYDDLLLRCGDLLRDHPECVSNVQAVLVDEFQDTNIIQY
FT                   ELMNLFAAKNRRITIVGDPDQSIYGFRSAEIQNLKRMQRRYSNTTVVLLEDNYRSAASI
FT                   LNAAQEVIEQDTSRPAKALQATHSFGTLPVLRRLPNPNAEAQWMVLEIKRCAAMTGGLL
FT                   RMSDFAVLLRSASLSTQIETAFGRAGIPYKMVGGRKFFDRTEVKILLNYMRVVSHTGHS
FT                   DALMNIVNVPPRRIGDETIKQLTSGAEKAKIPLWNFIKDVIQGRRSTEKKLQKAAEQGL
FT                   CTLVNLVEASRQKLQECEDASAPRVLIEFIAERLSFQEYLIRTYPLDEDSRWANVRELM
FT                   HQASEVAAFEEEEVDKEMDLPEIEGVQQQQAHSGEEALTRFLANVALATEITTKEESKE
FT                   GDQPSEKVTISTIHAAKGLEWPVVFVPAVYNGSIPHSRAEVVEEERRLLYVAMTRAQAL
FT                   LYLSIPIRQPRLGEGEDGATTLTPFLPPKLTKTRFRPTGPSLHEKVVYAIADILRRPRP
FT                   SLDDMYKGLEFLPSTLDDRWTPEGEEDRSKFDSTSTSHDASDEPNPKRRRSDMNQGPKS
FT                   TTYVSSAGYTMSNSTGFTIPTTVSSGFTSARDYIAANPEPPAESASKPPAGAGADAAGA
FT                   NKPKSVSSAGRKDGLTQASISNFFAGPGLSQKREPVLSSHPQPPPSRRYEVVPSQNQRS
FT                   GARSIVPAPLSSHRVQPRPLVPTRPTLEPTNPNGYTWLAAPSKPTLKPARTSMTQEQRN
FT                   STSGGRAGADEVKPESSTRGFQPVTTFHSTTMSMVQQAPRRTLGIRRSMNGWQDRMKRE
FT                   GGGQSS"
FT   CDS_pept        join(1178315..1178381,1178529..1178687,1179089..1179180,
FT                   1179242..1179421)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944505"
FT                   /orf_name="Pc18g04930"
FT                   /product="Putative uncharacterized protein Pc18g04930 "
FT                   /protein_id="CAP94717.1"
FT                   /db_xref="UniParc:UPI0001831821"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW5"
FT                   /transl_table=1
FT                   /translation="MSVFDLLGFVGAFSWHFSRQGVGPYFVQPGSASLTAPLPNSAMKL
FT                   PRLEGDASNSTRSKEIDEWEEQTLYEQASPVSGVRCCNLELLYKRHTKEQLGHKCIPRT
FT                   LEGLLPTFTGSGPDVSRRAGFRPAYLIQALQKSGTESTSMSKYARSGIAWRSSGMRCRS
FT                   TP"
FT   sig_peptide     1178315..1178374
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW5 "
FT   mat_peptide     join(1178375..1178381,1178529..1178687,1179089..1179180,
FT                   1179242..1179418)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW5 "
FT   CDS_pept        complement(1179863..>1180254)
FT                   /codon_start=3
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19823598"
FT                   /orf_name="Pc18g04940"
FT                   /product="Pc18g04940 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="CAP94718.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="UniParc:UPI0001831822"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW6"
FT                   /transl_table=1
FT                   /translation="ENSSDYGLGFNYGRLIGRDMASFAKWTAECLPSHHSFYPLSFHDV
FT                   HLRRLRGKSFETTCRTQTSPDNWQYVHQMLNQRPIEIMQKWHQEYGTMLTIRYGRQLAI
FT                   SVSNLDIAHGLLSKRGAIFSLQLVL"
FT   CDS_pept        1181080..1181532
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976776"
FT                   /orf_name="Pc18g04950"
FT                   /product="Pc18g04950 protein"
FT                   /EC_number="4.2.3.6"
FT                   /function="trichodiene synthase activity"
FT                   /protein_id="CAP94719.1"
FT                   /db_xref="GO:0045482"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniParc:UPI0001831823"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW7"
FT                   /transl_table=1
FT                   /translation="MNYLPYGVLILFLVAILAACVYFKWPRNEPPSVMGNIRPGSTVSK
FT                   RNYEQVVNGFLRDISFQTPIFKLDVDLKTCVENSLESHGISRGLIAQIGTCIDTATEIT
FT                   SCTYPFASHEVQEAIALYASYVITIDDLTGDIVRGHVTSFAPSHIS"
FT   sig_peptide     1181080..1181148
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW7 "
FT   mat_peptide     1181149..1181529
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW7 "
FT   CDS_pept        1183835..1184191
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        1184390..1187056
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(1187209..1187212,1187362..1188047)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823599"
FT                   /orf_name="Pc18g04980"
FT                   /product="Pc18g04980 protein"
FT                   /EC_number="4.2.3.6"
FT                   /function="trichodiene synthase activity"
FT                   /protein_id="CAP94722.1"
FT                   /db_xref="GO:0045482"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniParc:UPI0001831824"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW8"
FT                   /transl_table=1
FT                   /translation="MYILPDLKGYVNQLVQGQPHQHEVLGGFTKFLGAQQQLFGQFGGD
FT                   MVVKGSMEFVAAAVIEQTQDKRLHLPPEGSDYVCFFRAKTGVAEPFAFFCFPEDTNPED
FT                   RDLAGYTAAIPSIMLFLGYANDLLSFYKEEGKAGDYPGFIQNHAKVHGLTSLQSLHQIR
FT                   IETIKEVQKVRSILSNDAVMAERINQFIYGYIFYHLYSGRYKLYELNIPAAAEARSRFH
FT                   DMPKVRR"
FT   CDS_pept        join(1188359..1188448,1188498..1188753,1188824..1189433,
FT                   1189497..1189630,1189694..1190139)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170996" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944506"
FT                   /orf_name="Pc18g04990"
FT                   /product="Pc18g04990 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular
FT                   oxygen, reduced flavin or flavoprotein as one donor, and
FT                   incorporation of one atom of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP94723.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016712"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002974"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI00018318F6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW9"
FT                   /transl_table=1
FT                   /translation="MAMKSLIGLVLILIIGRLCYLTFAKIKTYRNDSALGAQHGCALPP
FT                   ELPKKWPLGIDRIKDLWETNADGRLLAYLCKVAEDYEPRNNLSQYLLFGPRAFHVLHPS
FT                   NVEALLSTNFKDYGFGARPKIFAPLLGNGIFTQEGSAWKHSRELLRKQFVRVQSQNLSH
FT                   FREHVDNLITRLPSSGVIDLQPLFLDLTLDIATALLFGRSVYALRADIDQDKENKLFAE
FT                   SFSIAQEGLAKRFRIAPWHFLYNPPAFRKACANVHRFVEGYVKELGLEDVENYDKNQYG
FT                   FIKQVAEESKNMKELRDQLLNVLLAGRDTTACCLSWTFRLLVRHAHVMERLRREIASVM
FT                   EGGTTPSREQIRRMPYLACVIKESLRIYPPVPLNNREAVRTTILPTGGGPEGDKPMLVR
FT                   KGEIVVFSQYVNSRKKNIYGHDAYEFRPERWESGELANIGWGFFPFSGGPRQCLGEDFA
FT                   QMEVSYTIVRMLQAFSHISLPVGEPNEPVGSEKQQLTLVLSSAEGCKVEISKG"
FT   sig_peptide     1188359..1188430
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW9 "
FT   mat_peptide     join(1188431..1188448,1188498..1188753,1188824..1189433,
FT                   1189497..1189630,1189694..1190136)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBW9 "
FT   CDS_pept        join(1190241..1190245,1190374..1190746)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670820"
FT                   /orf_name="Pc18g05000"
FT                   /product="Pc18g05000 protein"
FT                   /protein_id="CAP94724.1"
FT                   /db_xref="UniParc:UPI00018318F7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX0"
FT                   /transl_table=1
FT                   /translation="MFVRGSILDNTERCGISLDHQGICKFHSPADQGFRTAVAALRRYT
FT                   RDAPSVIQRRYQRSANVQRDEKMPQAAELLGTIPPRIPGPCQIFAHSLEAADGVFLGKT
FT                   RGPPSSVQQRSNLKDCIVQEG"
FT   CDS_pept        complement(1192169..1193122)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000080363" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670821"
FT                   /orf_name="Pc18g05010"
FT                   /product="Pc18g05010 protein"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /protein_id="CAP94725.1"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniParc:UPI00018318F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX1"
FT                   /transl_table=1
FT                   /translation="MAPKQWSNFHVGRECSHQKWSRRNTPKFTVSSGDTVSFDAIDSSN
FT                   GQLDTSSKASAIKTLDLGLANPVFGPIYMNDAQPGDVLKVEVLNLEVADWGWSAIIPGF
FT                   GLLADEFPEPEIKIWELNREAGFAQFKNMRIPLRPFLGCMGLAPANDEELSTVPPTNAG
FT                   GNMDCRELSVGSTVFLPVQTAGALFSCGDGHAAQGHGEVCGTAIETPIRATLRFELLKN
FT                   QPWMTAPQFQTPPLAQIPNPLPDLGTYGALGVAPDLYEATRSATRNLIQWLVQTKGLTR
FT                   SEAYILASVTGDLHIAEVVNVPNFEVAMTLPLGIFS"
FT   CDS_pept        join(complement(1195233..1195328),
FT                   complement(1195061..1195200),complement(1194544..1194965),
FT                   complement(1194119..1194453),complement(1193928..1194024))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        1195845..1196930
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183401" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944507"
FT                   /orf_name="Pc18g05030"
FT                   /product="Pc18g05030 protein"
FT                   /function="heme binding"
FT                   /protein_id="CAP94727.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="UniParc:UPI00018318F9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX2"
FT                   /transl_table=1
FT                   /translation="MGWVGAGVLIATIGYFLYRYPPSSWAEPRSSSPEPKPGAPVAAAT
FT                   ANEPVQRKHGSRTSTPSIETEEEDSQNTPKASALSVPTPISAVPTFSLDSGESETSQPA
FT                   TMPSISQTMNGTTEQVSSTNRDHEEPKIKPPPQPSLAPPPKPQPSSIPPKATTTGASSL
FT                   MPPPPRPRPANQANRLTPTSTLQPPRLSGNSLGPPPSAAASQRGLGPPSSGSRLSNSTL
FT                   APTQVSLKKSSSRKVILEPGFSPLDWAALAANPKNNLRGKGLPPGLLRVTPSMLKEQNG
FT                   RKGRDAWTSYFGKVYNISPYAPYHPGGKGELLRGAGKDSAQLFQEIHPWVNWEGILGEC
FT                   LVGILVSENDIQTENALDAMD"
FT   sig_peptide     1195845..1195922
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX2 "
FT   mat_peptide     1195923..1196927
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX2 "
FT   CDS_pept        join(complement(1197431..1197660),
FT                   complement(1197151..1197316))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154887" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127883"
FT                   /orf_name="Pc18g05040"
FT                   /product="Pc18g05040 protein"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP94728.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI00018318FA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX3"
FT                   /transl_table=1
FT                   /translation="MRLTSILVAALGSLAAAADLGIEVTHAVECTRKTTSGDGVAMHYR
FT                   GTLQSDGSEFDSSYKRKAPLTFKLGTGRVIKGWDQGLLDMCIGEKRTLIIPPEFGYGDR
FT                   GIGPIPGGATLVFETELVGIDGVKDEL"
FT   mat_peptide     join(complement(1197431..1197609),
FT                   complement(1197154..1197316))
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX3 "
FT   sig_peptide     complement(1197610..1197660)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX3 "
FT   CDS_pept        join(complement(1199884..1200021),
FT                   complement(1199726..1199775),complement(1199551..1199667),
FT                   complement(1199334..1199485),complement(1198890..1199258),
FT                   complement(1198149..1198840))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670822"
FT                   /orf_name="Pc18g05050"
FT                   /product="Pc18g05050 protein"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94729.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018318FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX4"
FT                   /transl_table=1
FT                   /translation="MASERDLTALPGCDSSKAVAQDTVNHIDTDPAHSLKKQSLSDLFT
FT                   IFASGFALISDGYQNNLMTMTNVLLKKEYPKEYTSTVSTRVSNALLVGEVIGQVVIGLT
FT                   CDYLGRKTAIVFTTLMIVIGGILATASHGITIDGMFWMMTVARGVVGFGAGGEYPASST
FT                   SASEAANDLTPKHRGPAFIMVTNFPLSFGGPFAVSIFLIVLMACQQSHYSTVWRVCFGI
FT                   GCVWPLSVFYFRIRMLNSVLYRRGAIKKHVPYMLVLRYYWKALIGTCGAWFLYDFVTFP
FT                   NGVFSGTIISSVVHDGTILKTGEWQLLLGAIALPGVFLGAILCDRLGRKPIMMIGFSGY
FT                   LIFGLIIGCAYDRVTKIVPLFVVFYGLMQSSGNFGPGNMLGLLSSESYATGVRGTCYGL
FT                   SAAIGKAGAAIGTQAFQPIKNHLGNKWTFIIAAICGVAGILVTFFFVPDLTGEDLRVRD
FT                   EKFRAYLVSQGWDGDMGEDDLKAAANQVMVRGLPNDDDKSVSQTVKG"
FT   CDS_pept        complement(1200598..1201650)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944508"
FT                   /orf_name="Pc18g05060"
FT                   /product="Pc18g05060 protein"
FT                   /function="zinc ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP94730.1"
FT                   /db_xref="GO:0005385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniParc:UPI00018318FC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX5"
FT                   /transl_table=1
FT                   /translation="MESYATLLKRADACESGNEFDGRMGLRISSIFVIMVGSMFGALFP
FT                   VFARRFSKGGGFPKWAFFVAKYFGSGVIIATAFIHLLGPAEEALKNECLTGPITEYSWV
FT                   EGIILMTIIVLFFVELMVMRFSRFGQGHLHDEEGNTHTQLDDHSVVNQANEPKIHMPGQ
FT                   DHLGHSREHHDNSDSEHGVQAAEDYAAQLTSIFILEFGIIFHSVFIGLTLAVSGEEFIT
FT                   LYIVLVFHQTFEGLGLGSRLATLPWPKSKRNTPYYLGLAYGLSTPIAIAIGLGVRNSYP
FT                   PTGRTTLIVNGVFDSISAGILIYTALVELMAHEFMFSHSMRKAPIRDVLLAFFLLCAGA
FT                   ALMALLGKWA"
FT   CDS_pept        join(1202813..1203041,1203099..1203610)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183412" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823600"
FT                   /orf_name="Pc18g05070"
FT                   /product="Pc18g05070 protein"
FT                   /protein_id="CAP94731.1"
FT                   /db_xref="UniParc:UPI00018318FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX6"
FT                   /transl_table=1
FT                   /translation="MAPIRRYLRISKYSVLECRVYLEFPSDSRWLLDSRDPVLPRVISA
FT                   VRPLVLPKLREENERLFMRKKGKPVKDVIAEDDFEVAIFLRESRTRHSLLTRNKTLHGK
FT                   ERQAQNLKLELNQEHVSEDTAANPVNPGDGEIMIESDSEPDLGLHNIPESADEVVPGDR
FT                   RRSSRRTQANREDQVPEDTGSDEKKLGFSTHYESFNIYGWVLCLLITRKGDKTRPSAVA
FT                   SESNRQPLMEEWISTQAQVSVDDE"
FT   CDS_pept        join(1210894..1211044,1211115..1211253,1211320..1212322)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183423" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127884"
FT                   /orf_name="Pc18g05080"
FT                   /product="Pc18g05080 protein"
FT                   /biological_process="protein targeting to mitochondrion "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="CAP94732.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0006626"
FT                   /db_xref="InterPro:IPR019564"
FT                   /db_xref="UniParc:UPI00018318FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX7"
FT                   /transl_table=1
FT                   /translation="MVLQLHVWGPAFALPSIDAQCLAAIAYCSEVLPKDSWELIASSDP
FT                   SVSPTGELPALQNGSIWVSRFRNIVDYLRQYSEGAWNLDQDLDDVQKADSVAFSSFIES
FT                   RGQSLIDLYLYVTSQNYYNNTSPAYGSLLQWPNQWILPPKLHGAAKTRTEHLGLSSLDL
FT                   QAMEDQRKREHSAAVASGQIPSNLIQQPRDTVSKLLGRTAQTNQFRLEALTADFFEPLE
FT                   AMLARSKTCLLPADDNNNPSSLDCVALGYLSLALVPELTFPWLRDAMRAKAPLLAAYTE
FT                   RMRSRCFGDAPVEPSHAFQPVPAALPWRAPERISVAAVGSTLLGTLADNTPFLREVRQN
FT                   RRLKQAVEADSEFSSVEKQVLSSYADSSNKDMLLSVATAVAGTAALVGYMVHVGLLSFS
FT                   TGGVEEEEEFEQDAGVLQIDPGSAADFLGAF"
FT   sig_peptide     1210894..1210950
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX7 "
FT   mat_peptide     join(1210951..1211044,1211115..1211253,1211320..1212319)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX7 "
FT   CDS_pept        complement(1213379..1214425)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178363" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944509"
FT                   /orf_name="Pc18g05090"
FT                   /product="Pc18g05090 protein"
FT                   /protein_id="CAP94733.1"
FT                   /db_xref="UniParc:UPI00018318FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX8"
FT                   /transl_table=1
FT                   /translation="MHFSNSMLLMTALTAGSAVARLHGHERRHAHPRDINIESNPVVTA
FT                   APEVLDVEKRGEEVFATINGKLVSWINNWFGEQTSEAAEAAESTVAPTSTATPTAEATS
FT                   EAEAISTVSPTPVPSSSSSSGSSNWASYPSNGQYSTSGFGSSTASKRIGALDWDYIGNV
FT                   GSPWGSNMIRVEEDAASEYKHVIRFENDNSKAWTVVMWNSYGPSGGLNGFWAPNSALSF
FT                   TVEPGHSIFVAIDDDSQGGWGASEGEGLPTNFVGQYASTWGEFDMSNSQNDYFSGWDVS
FT                   CIIAELANLDIAGMQICNHEGGKCSSITNGATSVVNAYTAADQGKPDKAVSQGPGPVRL
FT                   VVNLGWSS"
FT   mat_peptide     complement(1213382..1214365)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX8 "
FT   sig_peptide     complement(1214366..1214425)
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX8 "
FT   CDS_pept        join(complement(1217136..1217270),
FT                   complement(1216291..1217073))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000220040" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944510"
FT                   /orf_name="Pc18g05100"
FT                   /product="Pc18g05100 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP94734.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000918"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="UniParc:UPI0001831900"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBX9"
FT                   /transl_table=1
FT                   /translation="MALPSAATSLRRSLQDPQVFITAPGVYDGMSARLALAAGFDALYM
FT                   TGAGTAASVHGQADLGICTLNDMRANAEMLANLSPRTPLIADADTGYGGPIMVARTTEQ
FT                   YARSGVAAFHIEDQVQTKRCGHLSGKQLVDTATYTSRIRAAVQARERIGSDIVIIARTD
FT                   SLQQHGYEESLARLRAARDAGADVGFLEGISSREMARRVVADLAPWPLLLNMVEHGSTP
FT                   SISAKEAKEIGFRVIIFPFATLGPALLAMREGLEKLKREGLPGLDKEVTPQMLFRVCGL
FT                   DDSLKLDAAAGGVAFEGGVDLEEK"
FT   CDS_pept        1217992..1219509
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976777"
FT                   /orf_name="Pc18g05110"
FT                   /product="Pc18g05110 protein"
FT                   /function="histone deacetylase activity"
FT                   /biological_process="histone deacetylation"
FT                   /protein_id="CAP94735.1"
FT                   /db_xref="GO:0004407"
FT                   /db_xref="GO:0016575"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="UniParc:UPI0001831901"
FT                   /db_xref="UniProtKB/TrEMBL:B6HBY0"
FT                   /transl_table=1
FT                   /translation="MARSSIVQEYASPSTPTATIDHKSAAELQNLQVARPQGYRVSWHA
FT                   NPAVEPHHFGQSHPMKPWRLTLTKQLVMAYGMHHAMDLYLARAATYEEMADFHDTDYLD
FT                   FLQQIMPGDIDRPEQADNVVRFNFGDDCPIFDGLYSYCSLYAGGTVDAARKLCNDQSDI
FT                   AINWSGGLHHAKKAEASGFCYVNDIVLGTLQLLRHHPRVMYIDIDVHHGDGVEQAFWST
FT                   DRVLTVSFHKYDKDNFFPGTGAREDTGPAHPLNPGAHHAINVPLNDGIDDESYIALFKE
FT                   VIGACTRTYQPGAIVLQCGADSLGCDRLGCFNLNVRAHGACVAYTKTFGLPLLVV