(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16

ID   PENCW_16; SV 1; linear; genomic DNA; GRV; FUN; 3652229 BP.
XX
AC   AM920435_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 20)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c20, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920435.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3652229
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        join(complement(2138..2641),complement(1273..2107),
FT                   complement(1054..1224),complement(967..1004))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076626" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946670"
FT                   /orf_name="Pc20g00010"
FT                   /product="Pc20g00010 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85330.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831828"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER0"
FT                   /transl_table=1
FT                   /translation="MSLRPCQPCRHSRIRCSREVPHCQTCVKRGRYSLCVYETKVSDQK
FT                   PALPEPRSKQQKQKQERASDEYHFRWRAFEPQSEQFPRYETSTNEKMQHAMEPANEEHI
FT                   KHMSQRYSEQGSLSPHETPPKSIAAAKAEKASIFQPKHVEDTSERPRSTPVPQPTELYA
FT                   QMIPPTTTLTVNKASLPPRPNFDLTISGRHICGPHTAHQLLLVLNYLFISSMLPADIGA
FT                   LWKVICRRHHDWEESFVLQHEQLQRWLISVRNILTNSDGLHTVTLEDIERQTRYILFIL
FT                   GENTSPHSSFIFECFRSEEPPYRPFGVRASIALICHAFGGIQADELEGYEAKEIWTRDQ
FT                   NFLSTMAFRLKESPLFGAEVSVNHLQSMILGLQKAFQCEEIRVSGMEFQTLRIESELEV
FT                   LGYYRRAFLAFNPILLPKILASLREANDLTTLLWHYQLINMERNLDRTNLALRLANIFM
FT                   SLAPERLDAAFQNTREIQLSKAXRVVAMEMMHVKSFEEAYKLNPTKPTTVRVFHVSP"
FT   CDS_pept        join(complement(4619..4831),complement(4432..4586),
FT                   complement(4116..4212))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977326"
FT                   /orf_name="Pc20g00020"
FT                   /product="Putative uncharacterized protein Pc20g00020 "
FT                   /protein_id="CAP85331.1"
FT                   /db_xref="UniParc:UPI0001831829"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER1"
FT                   /transl_table=1
FT                   /translation="MGTDDHVRQYNAENSRYFSPHIRLHNPGGSGLAQGMLRVSSGLAQ
FT                   GWLKVGSRLAHGWLTVGSRLAHGWLRGMLRVSSGLAQGMLRVSSGSAQGWLKVGSRLAH
FT                   GWLTVGSRLAHGWLTVGSGSINDHASINKELWHCHRVPAAQKSRSKNGKR"
FT   gap             5553..5652
FT                   /estimated_length="unknown"
FT   CDS_pept        8076..9332
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(16269..16609),complement(16081..16191),
FT                   complement(15728..16016),complement(15629..15667),
FT                   complement(14959..15522))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671385"
FT                   /orf_name="Pc20g00040"
FT                   /product="Putative uncharacterized protein Pc20g00040 "
FT                   /protein_id="CAP85333.1"
FT                   /db_xref="UniParc:UPI000183182A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER2"
FT                   /transl_table=1
FT                   /translation="MPPRPFFPRAAKPNGKGAPKKSDGKRKANSESEDAEATPPKKKKM
FT                   TKEEIPQKLDEKRLAADLNTDYSKRRKNLRNIRPQMPKKQKWPKVKGVIREREDAPQGW
FT                   NPEEPDLMPDDFESQIQRCLERITENIMPHVYQHKLTELRAKQAERDALKATEPGLSWP
FT                   VVQRLDDLKFTLDWIMAENDKYKMADTVKSIIAQYRSGELDWHPEFVTYWHAGVQLCLP
FT                   RPFHWEEYRSIHDKCQGHEGFWVEGILGPAPGLSKSSVVRLSLRIPQDQPPAGTKLPSF
FT                   EFPFMDDTGSTHMSIFEDDINILQDNTNHPLPRCLGVGLHYTSDDRRVPALYRELEVNM
FT                   WSVDERGFMSNWEPIPVSIRSGHATRAGADRLSGSWLRHRFYTGTCPDQSMRLYVFNYN
FT                   PGIPPQGERTLPTATPAQLTAPFRTAALRPVGEFPHLDPNFASGHSLI"
FT   CDS_pept        join(complement(17945..20094),complement(17741..17783))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217336" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977327"
FT                   /orf_name="Pc20g00050"
FT                   /product="Pc20g00050 protein"
FT                   /protein_id="CAP85334.1"
FT                   /db_xref="UniParc:UPI000183182B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER3"
FT                   /transl_table=1
FT                   /translation="METADGAVHLRQLPRSSDNRQDAPEYTRHDSSSESPPLHDEELPS
FT                   YSEARSTGQILGRGHSTLLHRSAWVSVFTIIYVGLVLYAWAMTVILSIRPLKDKTWAYS
FT                   FETSRSNYYYEADFDQERKIYRSMRTIQTFIQVVTLPWISTVCASAAVIYAQNQKDPMG
FT                   LRLRQVTTLADRRWMDFSLYPALMYGKWRQYGSTLLATAIFIWVFGLIIFPIQSVFLSS
FT                   QSVKVRTLTQQSASIYDFSPARSLYSSHNTGKDVLRVRNALNKANGDIYQPNLWSNNSG
FT                   VQFLTLNDLSSQTYYSQVPSGFNTGLIRQFAPRVNSTATYETIRASDFPVDCSSRPGAF
FT                   YADYSSSYSPRTHSTSSYSWGVTACMPANMTKSPWQMARNRQDFSEVLYLNMTQEEYRS
FT                   GNYQYLFQVTVNTTAGFFELPNYMNKGVPGPLLDQDPVELCDQHCLSQLNTFYSGSYYR
FT                   RDGVTVEGTLKAASLDPFSTDRKGPLLSAALASFGPGSFIDTFIATAAALEADDKVTGD
FT                   VSSNLRYACVANPPLTNLMGSSPLECVSVGIDIDGNWYPVGSEIARWISLFQKDAKSIP
FT                   KAFTSAAFLANQEFLSSQRGKWSIAHDLGADMNLPSISPAGTIVVTVLMALYLLPLLAL
FT                   SLYAGLSHRWTERLDSFVMLRFGAFAGDKVFPLLIGRKSDKVDELDEMSGVVRDVATYP
FT                   GDEVIKIGRLGFGEGSKLREGRRSKHSRQLPMLFHD"
FT   CDS_pept        join(complement(22174..22409),complement(21371..22115))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946671"
FT                   /orf_name="Pc20g00060"
FT                   /product="Pc20g00060 protein"
FT                   /protein_id="CAP85335.1"
FT                   /db_xref="UniParc:UPI000183182C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER4"
FT                   /transl_table=1
FT                   /translation="MYYARPAALSAVLLQVLPTLAAPAPGGSGNPGEWSQDGFWGSPGH
FT                   GDSAGIGPGGFDNSHCGHNANGNNVGSTVTVTDCPATPTATVTVTIDGDGNGSATVTET
FT                   ISACTATVTTGDDGRSASTTTETETVISTISSCTATTTDITTLTEDGPTVTTTVTTPGP
FT                   VSTTTEFVGTSTVTEPGVTEYETVTDTITHTDTSTVTNNQVVTSTVTSTETQTLQVTTT
FT                   VTADDCSNTGTSDDLDYGSCSDPTINWLYGLDGRTEYSYTTNNQDDFPFGSSPTIDSPA
FT                   DLICNRLRSPCNAPQATIDQCYAAESAVASLSGQEAADTWNDLMT"
FT   mat_peptide     join(complement(22174..22346),complement(21374..22115))
FT                   /db_xref="UniProtKB/TrEMBL:B6HER4 "
FT   sig_peptide     complement(22347..22409)
FT                   /db_xref="UniProtKB/TrEMBL:B6HER4 "
FT   CDS_pept        join(22478..22653,22684..22818,23041..23110,23218..23382)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946672"
FT                   /orf_name="Pc20g00070"
FT                   /product="Putative uncharacterized protein Pc20g00070 "
FT                   /protein_id="CAP85336.1"
FT                   /db_xref="UniParc:UPI000183182D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER5"
FT                   /transl_table=1
FT                   /translation="MGLCRSSPYRNRRLKECDVDDLENNGEDAQLYTLASMLNYITGRS
FT                   HLPIRHFENKGTQSFKNVNSHGSSWEHAAGYFIRMKYPWSLRPITTGLVLEGRGDGIVR
FT                   KIKESRVIMAWIHAKRAPTGITKYGLYHEMEKTPELKLCKNMIAMGWKGGSWVRRLGHI
FT                   PELPNCSFFGERAMVLSM"
FT   CDS_pept        join(complement(24727..25296),complement(24501..24669),
FT                   complement(24030..24430))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175137" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946673"
FT                   /orf_name="Pc20g00080"
FT                   /product="Pc20g00080 protein"
FT                   /protein_id="CAP85337.1"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI000183182E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER6"
FT                   /transl_table=1
FT                   /translation="MKFSLGLLFAAVAVASSPAKRADAVSVTGSPPGFAYGVTGGGDAT
FT                   PVYPTDVKHLIELLGSDDPQVIIIDKTFDFIGTEGTTKGNICKAYGSFEDGCQSTIDIG
FT                   KGCDGKPSEPYEWDTAGTTGITVQSDKTIIGVGNKGVLLGKGLRIVRASNIIVQNIMIT
FT                   NLNPQLVWGGDAITLSGTSKVWIDHVTTQYTGRVHYVFGHEANAHVTISNSFMNGATNF
FT                   STSCDGQNYWGLELVGADDQITFANNYVYRTSGRSPALSGKTLFHAVNSVWEDNSGHAI
FT                   EGTDDGQGLFEGCVFNNVTQIVGDFVGQLFSSPSATANKECAGYLKRDCVTNIQTNNGD
FT                   QFTNADTKFFSNFAGLNIATASAASAAQASVPTNAGNTL"
FT   mat_peptide     join(complement(24727..25224),complement(24501..24669),
FT                   complement(24033..24430))
FT                   /db_xref="UniProtKB/TrEMBL:B6HER6 "
FT   sig_peptide     complement(25225..25296)
FT                   /db_xref="UniProtKB/TrEMBL:B6HER6 "
FT   CDS_pept        join(complement(28359..28502),complement(27948..28316),
FT                   complement(27837..27881))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187741" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128431"
FT                   /orf_name="Pc20g00090"
FT                   /product="Pc20g00090 protein"
FT                   /protein_id="CAP85338.1"
FT                   /db_xref="UniParc:UPI000183182F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER7"
FT                   /transl_table=1
FT                   /translation="MMPPSDSLRHQLHKLAEVRASRNTSSISTSTPTSTSTPGTAPPPY
FT                   TLSNDMDDPWASPINIYIDHSITVTGDENTIMVSSPGMDSPTDPTHQEAPRLSSIAAVI
FT                   IAALNRANALHDDMGYPRPVNIRALAGIRVNGRNNRVCVGGEINKSQNETADAGVRESN
FT                   GRKRRASSEPVDAPSAQRSRSF"
FT   CDS_pept        join(complement(30215..30328),complement(29350..30159),
FT                   complement(29126..29245))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187730" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946674"
FT                   /orf_name="Pc20g00100"
FT                   /product="Peroxin-20 Pex20-Penicillium chrysogenum "
FT                   /protein_id="CAP85339.1"
FT                   /db_xref="UniParc:UPI0000F58A78"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER8"
FT                   /transl_table=1
FT                   /translation="MGDALCGPSNALQNFQKHTSVDRTLQQDRLTSRQSPVQGFRSQNS
FT                   QEGILDPEFAAFEGNLAGPALPNLQHPAHFGAPSQHAAVHHPAAHGASNASWASDFQNL
FT                   QISGPSHPVSQLQRPHIAPAAAHGGWHAEFMAQQQGPMSLAQQTPQMHGAYQPSFTPSY
FT                   QMYGSSMNQMQPLQGMQTEQQNTQQFDESAFEAAFDQARADMELQGVDIAQQDNQEHLQ
FT                   ETNKVDISEPAIQEQIRLGSDLIPQSDKQNPETQSRDADELARTAGQLLDSVRNEQSEK
FT                   FQQSNFLALMRRIRDREVEVEGDDFRETAQSLHPGGRYYPGQPHPDLPGSDIPSSSKEP
FT                   SNPIARV"
FT   CDS_pept        join(30653..30655,30728..30772,30856..30971,31034..31064,
FT                   31136..31545,31611..31935)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216895" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946675"
FT                   /orf_name="Pc20g00110"
FT                   /product="Pc20g00110 protein"
FT                   /protein_id="CAP85340.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0001831830"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER9"
FT                   /transl_table=1
FT                   /translation="MATPQVISNSGHEEMIHDAGLDYYGRRLATCSSDKTIKIFEIEGE
FT                   SHRLVETLKGHEGAVWCVAWAHPKFGTILASSSYDGKVLIWREQPQNATSPSGGSTWTK
FT                   VFDFSLHTASVNMVSWAPHESGCLLACASSDGHISVLEFRDNNWTHQTFHAHGMGVNSI
FT                   SWAPAAFAGSLISSNPGPGQQRRFVTGGSDNLVKIWEYNAESKSYNLTQTLEGHSDWVR
FT                   DVAWSPSILSKSYIASAAQDKTVRIWTSDASNPGQWSSQTLEFDTVLWRVSWSLSGNIL
FT                   AVSGGDNKVSLWKENLKGEWEKVKDIEE"
FT   CDS_pept        join(complement(33633..33653),complement(33179..33598),
FT                   complement(32813..33117),complement(32682..32764),
FT                   complement(32204..32634))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187719" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671386"
FT                   /orf_name="Pc20g00120"
FT                   /product="Pc20g00120 protein"
FT                   /protein_id="CAP85341.1"
FT                   /db_xref="UniParc:UPI0001831831"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES0"
FT                   /transl_table=1
FT                   /translation="MCLYICNILQDIACCLPNDRDILHLSQSCKEMWEKVFSSESGIWR
FT                   DRFGKHYDIAPGRRSGELKYEYQIRAIVLRSPIQFKGEEDARQYLWMEVMQTMLEESLK
FT                   LPVGPGATSKTLQRIHETLKGVDFLSEFRKGRNCSPLFYALQLCLSSFALDPTITEPCR
FT                   RTDYDIKQVYSYADEVGKAFIDHDNLDLAKLLDLRNFWQRHLLNASELTFQESFSELPA
FT                   DMTPKARKDIPTEASRLSPSWLGYYCNVRSACIHPLSDLQKANQRQTCADLETHGYSTT
FT                   LTNGETLDLQPSSGQFWPAQCSKIIPPAGGVDTERVYFDGKQRSYDATHEVGNPVFGFT
FT                   EEIAVPHGGFEGWTRICFTVVEADEDDDEEEQPFSAVMDGEGWIHGYEAVIVPGGRMML
FT                   GRWVDMKEPDARGPFIFWDV"
FT   CDS_pept        join(complement(35796..35986),complement(35423..35719),
FT                   complement(34136..35300))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128432"
FT                   /orf_name="Pc20g00130"
FT                   /product="Pc20g00130 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85342.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831832"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF24"
FT                   /transl_table=1
FT                   /translation="MSGADEQDQSGPHAPLLASSRPSSDHDDNEHDESLASELEYSGGW
FT                   FIWALTFSAGISGLLFGYDTGVISSTLVTIGSDLSGRTLTTLDKSLITSCTSLFALIAS
FT                   PFTGVLADKFGRRKVILGADLLFALGALVQAFTSQVWGMILGRSIVGLAVGSASAVTPL
FT                   YISELAPSHARGRLVTILSLFITGGQVVAYIVGWLFSSTTGGWRWIVGIGAFPAFFQLA
FT                   ILALLPETPRWLVQAGFDAQAKTVLIKIYQDCPGHDKVVDRVLRNISGEIAQEASEMGL
FT                   QEVSDMGLTKSRGTKPQWLHDTIQRGQQLLHGGNRRALIIAMMLQAVQQLCGFNSLMYF
FT                   SATIFSSLSFSSPTLTSLSVAMTNFVFTLLAFVLIDKIGRRRILLYSIPVMVVALVVCA
FT                   FSFSSVDNKWNSQPPSGRQDNHDSVSSVVPLAILFCLTVYTAAYALGLGNVPWQQSELF
FT                   PLNVRSLGSGLATATNWGSNFIIGLTFLPMMEWISPSWTFALYAFVCVVGWVAVWAIYP
FT                   EMSGLSLEEVKGLLADGWGVTESLQRRHLSQHI"
FT   CDS_pept        join(complement(38979..39041),complement(38190..38912),
FT                   complement(38044..38124),complement(37688..37991),
FT                   complement(37466..37639),complement(37330..37416),
FT                   complement(36808..37276),complement(36401..36752))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000271637" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671387"
FT                   /orf_name="Pc20g00140"
FT                   /product="Pc20g00140 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="CAP85343.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0001831833"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF25"
FT                   /transl_table=1
FT                   /translation="MESELQSQIPGLDHIITEYSVGYLTHAANLYVDDACAESPLTEAA
FT                   ESVTELLVSASGDFSPQNYEAIGNLVTRFITTLSSSDGDPERRQMPFKAKKLEQTINVG
FT                   AQRNMSSTLGLTGNTVDLESANARKMESKVDKKKLEKAERKIRAKQDKKSMKNVTYEAS
FT                   RLLNQPDEAMSYEEFFMAVNPLQMGSDSQAKSKDIKLDNIDISISGLRILTDAAFTLAY
FT                   GRRYGLVGQNGIGKSTLLRALSRREIPIPTHVSILHVEQEITGDDTPALQAVLDADVWR
FT                   KHLLSEQAKISEQLAAIEEERSSLADTSKDAARLDEQREGLDITLSDIYGKLSEMESDK
FT                   AESRAASILAGLGFSQERQQYATKTFSGGWRMRLSLARALFCEPDLLLLDEPSNMLDVP
FT                   SITFLSNYLQGYPSTVLVVSHDRAFLNEVATDIIHQHSERLDYYRGANFESFYATKEER
FT                   RKTAKREYEKQMGERAHLQAFIDKFRYNAAKSSEAQSRIKKLERMPVLEAPEAEYTVHF
FT                   AFPGVEKLSPPIVQMSDVCFGYTKDKPLLRDVDLDVQLDSRIGIVGPNGAGKTTVLKLL
FT                   TNQLEPTSGLISTNSRLRIGFFAQHHVDALDMTTSAVGFMTKTYPGKTDEEYRRHLGAF
FT                   GITGTTGLQRMELLSGGQKSRVAFACLSLTNPHILVLDEPSNHLDIEGMDALSDALRVF
FT                   EGGVVMVSHDVTMLQNVCTSLWVCDGGTVHKFDGTVNAYKKKIAAQADAAGVVAKH"
FT   CDS_pept        join(42568..42585,42688..45747)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000187708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946676"
FT                   /orf_name="Pc20g00150"
FT                   /product="Pc20g00150 protein"
FT                   /protein_id="CAP85344.1"
FT                   /db_xref="UniParc:UPI0001831907"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF26"
FT                   /transl_table=1
FT                   /translation="MDHISTLCALSTVGIAPTGLALGRAERTQRPSLFRRKTHAQGIPE
FT                   PLSVNTEPTADVARPKTAIPSRSPAAEWLAAKEEESFQGSQGSDLSKAPLSFSGARRRR
FT                   RGQTLTNPPLRIPEHESTDSSVGTHTRRPSTGWLRRLSMASFPAETPTASSPATPSFNG
FT                   STSPLISHSPRQRRPANKLVKRPTSQHTTTYALTLNPICGPSPAALRRPATSHQRSESM
FT                   ILRTPLTTDFDTYFPKAPVEGPTIEEFELDKQKRWTPFFVPKGGKLAERLSRRFSTSTA
FT                   PKVQSVRQIVSDQGALPALVMANVISPTTAAPRDDRSVPHTPIEFHNPFQTAPSEFGPK
FT                   QPVAPEQPAERSLHRQSYSVNDVEPKIEPKIVMANTVTAHGTPIMGLVRGGSLKRVKGR
FT                   TFSVPPSELSQEENNVAIPSSPEPEPRRNITDPSVFRAPYPISQPGWADSALERRSQVG
FT                   PRSVSQDYNVGLGSRAGSRQMTSDAVALSAWQQASRPGGQTYGSLRRRPKGFSISGSDP
FT                   ASTLIGSDATRVFTSSDGYETDMMSDYWDSVRTRETNRSGAKGLRIETMFDKAGTSLAN
FT                   EEATTLESLLPRGSFAARSLDKDPQLFTDPLLSAPPLVQTSMGENPSIPDDDALSMIGA
FT                   LPSDDRDCFPSSLTRSLAKYAEEPELRVGADNDMPGSFMGELDSDINKKTNIFDWSEQT
FT                   HPNRETSDSGTRPRTMQGKHEGVIDRNSRAVCRKAPSTVHLRSQSVPVASELPINESRQ
FT                   TSGKFGTWGLGSKGVSEDWDSDFDFDESEDTPVAENKPLVEPDINRQSMTVPKAILERQ
FT                   ASLRGQFGQVQELTLLVEELKRLRHQANVLGVVNGPSSELWAEAEQIVNLATIDDEEER
FT                   RSPPGSPQSLTFSFDESDDDGLNASSKRNSDVLWDIPRGENSEPTLPLAQLARDSPKSK
FT                   SVLDILQPRQQEPSSAFNGLELASRAKKLPFDTSSLKNLVVRAGVVTRALKEVIRKADG
FT                   VATSPQDFQDPPFRRIFDKPSHDDIASFEAALADMS"
FT   sig_peptide     join(42568..42585,42688..42744)
FT                   /db_xref="UniProtKB/TrEMBL:B6HF26 "
FT   mat_peptide     42745..45744
FT                   /db_xref="UniProtKB/TrEMBL:B6HF26 "
FT   CDS_pept        48329..50347
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671388"
FT                   /orf_name="Pc20g00160"
FT                   /product="Pc20g00160 protein"
FT                   /protein_id="CAP85345.1"
FT                   /db_xref="UniParc:UPI0001831908"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF27"
FT                   /transl_table=1
FT                   /translation="MPHAHHAGLVMRNHVRRDVIPPHRLPFLVPSTSSIATELPSLVAR
FT                   AEASTTVTGEKPTSNLTTTVLPVVLGAGVPILCAIVVLIVLHRRHVKKLLREDAMDKHK
FT                   SLDFGMDTVGPATRRKGPGMPPMSEPTHTKGLSLDVGPYLMPPGLKNSPESLRSMSIDD
FT                   DKYRPATASIRSYPRGSRFEGADDGNSGLLQNAQRMSRSSPPLYSSPIESHGRSLDQHN
FT                   DYLGEVPGVTHPPAAQQPGMAIGSPNANRIPSPEPLPHLDSSLGLNFGLDNTHGNTYNN
FT                   QHEERLNFPLPEPSQSRDLDHNQAPASQLPRISLPDSVVTSSDYGDDRKSQYTLPTVNI
FT                   HGTEDVQQHNALSHDNKNPELPEEPQNLDAAYDNRRDTRRMTLGLRPLPPEDPADNPEQ
FT                   RANRIRSFYKEYFDESKNGQEPTYYEDFGPEFYEGGGNAGFIYDPITGDYYDATHGVAP
FT                   FAEPMTRRAMTPPPRAPPRFQGAARHMATNSAGYNGMPGPRAFSSASGRMPGPRGPKKP
FT                   IPPPSPLQILPTPHMLTDDSLMTAMDFAPANGFKDRRAGRPETPTGGVRHYIPGVRAHT
FT                   PLASAFDELAVMPSPHALRKSGTFTNLDFVPPPRFKNEGAGSDAGSIRSARTVVSAHHQ
FT                   NNIRMGNYRVSRLPAEAVGTKDDMMATLRPKWDMNNT"
FT   CDS_pept        51962..53227
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000187686" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977328"
FT                   /orf_name="Pc20g00170"
FT                   /product="Pc20g00170 protein"
FT                   /protein_id="CAP85346.1"
FT                   /db_xref="UniParc:UPI0001831909"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF28"
FT                   /transl_table=1
FT                   /translation="MASPSKAAGAAAAAAAIASSAAETVVQTSGSPETSSETSAAQPST
FT                   SSTETTSSSAPAPTTSSSTEPTTTSSTTSSTSSTPTTEPTTSTPDPTSTSPTSTSTSST
FT                   SSSTSSTSSTSSTTTAPSTTSSEEKTTFTSTEGTTVVVVTSTQIASNTGATSTTSSSAT
FT                   DSAALATSGTAAGSGGLSPSGTIAVAVVVPVVSVALIILALLFFWRKRKANKAAEEERR
FT                   KEVEEYGFNPNNDPTLPGIGGVVVPKDDESSGYRGWGTTSAGRKASTNLSSGMGGLAMS
FT                   EGSSPGYHHAATPSEGTVQYSDGARPDSGEIVEPIGVLGAAPVAANNRNGDIHRGPSNA
FT                   SSAYSAANRSDASEESHMSAVHPSAGYYGENPYYGDINTHGAYGGDDYQPVIRDVQARR
FT                   NTRIENPGVYPRQGNAGIAQNF"
FT   sig_peptide     51962..52027
FT                   /db_xref="UniProtKB/TrEMBL:B6HF28 "
FT   mat_peptide     52028..53224
FT                   /db_xref="UniProtKB/TrEMBL:B6HF28 "
FT   CDS_pept        join(54698..54729,54775..54859,54919..55044,55106..55156,
FT                   55220..57704,57760..57929,57992..58204)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946677"
FT                   /orf_name="Pc20g00180"
FT                   /product="Pc20g00180 protein"
FT                   /function="glycerophosphodiester phosphodiesterase activity"
FT                   /biological_process="glycerol metabolic process "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP85347.1"
FT                   /db_xref="GO:0006071"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008889"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000183190A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF29"
FT                   /transl_table=1
FT                   /translation="MYVCPSVSVTGKFGKQIQRRQLDLPEYAASFVNYKALKKLIKQLS
FT                   ATPTIPAQRTAEEIARANADPQGALRANKEVFFFRLEREIEKVNTFYLQKESEFSLRLR
FT                   TLVDKKRVTQSRATSNSKAPSNFAAMFEGFQQFDGDLNKLQQFVEINETAMSKILKKWD
FT                   KTSKSRMKELYLHRAVEVQPCFNREVLRDLADRATTARLELEAWAEGENIQYDASRPLD
FT                   RTATLGSEEDEMDSQILQSASTGNLQTLREWLARLQQLPDARERATRTFLTAINGFSDE
FT                   VLGLLLESKLVDIHAEDDINERNCLHEAAISGRLFVFHAGLQAGVDFARADVYGRIPLH
FT                   YACMHGRVDMVRHLLAAGPHTVDIMDHDNFTPLIHSIVKGQLACAEQVLCSNARVDPEP
FT                   ESPPMKGMDHRPLKGPDHIPLNLACQHGSLPIARMLLERNAKLLPDAEGLYPQHMVARA
FT                   SQSPELLLLLKEHGADLDQKDKLYQWTPLFHAASEGCVPCLRTLLECGVDAQVPDEKGL
FT                   SSMYYAAWEGHLECMLLLWAQPSGKKPTLGPLDILNGVRMQEPGPMGDMSVVTSVSELE
FT                   MADGIPDLELPPPIIPLRRYGHNFLDKKVFVQLLFDQGNVGSIAFDQAGRHPAARMTIS
FT                   SKLSDLIPRTVMLPIQEETRTISFHVDNLDTFAVDFEIFPTFGSKVIAKSVALPDIFRA
FT                   ESSSTGSGCLPLFDPRLRTIGQLRFNFQVIKPYHGDPLEITHFATYWKATSALDSDHNG
FT                   LVTGSSLSGDYVQLFVQLTQDRVAVLYPQFMINHHGVDIPVSHLTYAQFQAIGADCGAN
FT                   HTEILKFLETEATNDMPQTHRLLAASFLSLRDVLQQLPIDLNVNISLLYPSPTEEKKLH
FT                   MTSLADVNSFADVILTDVFDHARVARDKNPEFMRSVVFTSYNPNICSALNWKQPNYPVL
FT                   LCNDLGQIRDLAGNVDSMPHVNSSGRASMSIKESARIAQSNNFMGLICRSSLLNVVPAL
FT                   VETIKELGLVLVADTSDEVSQPDRLEELPTDTMGVAEWAYRMPDGVNGVMRANGILRFN
FT                   DMIDM"
FT   CDS_pept        join(complement(58852..59425),complement(58635..58786))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187663" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977329"
FT                   /orf_name="Pc20g00190"
FT                   /product="Pc20g00190 protein"
FT                   /protein_id="CAP85348.1"
FT                   /db_xref="InterPro:IPR009688"
FT                   /db_xref="UniParc:UPI000183190B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF30"
FT                   /transl_table=1
FT                   /translation="MSLRPTLLKQWISRPSEILKSTPSLTSYLHPSARPSLAHRSIIFP
FT                   SAGQATRRSLTTARLPTRTRPGPSSFHPKQRRFNSGSAGGGGKGSGAGAGAGASEKASL
FT                   SQRLKKLSREYGWAALGVYLGLSALDFPFCFAAVRLLGVERIGYYEHVVVGFVKDKLKS
FT                   VWPQTKSSEAEDGQGQLAQAEERNQEEASIWTQLVFAYAIHKSFVFIRVPLTAAVTPKV
FT                   VKTLRGWGWDIGKRKPKST"
FT   CDS_pept        join(59860..60643,60718..60824)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000100368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946678"
FT                   /orf_name="Pc20g00200"
FT                   /product="Pc20g00200 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85349.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniParc:UPI000183190C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF31"
FT                   /transl_table=1
FT                   /translation="MSPRLGGLLQLSPVWGAPLITPRIPVRSFGIRSLNPPKPSRFNIG
FT                   PGLPVLESTSTAALRRKANSLPLRTGAIGIKKGMTAIYDPESGKRIPCTVLQLDRVEVI
FT                   SHKTRERHGYYAVQVGAGWKHPSNVTKSMLGHFSVNGISPKRHIFEFRVKDEAGLIPVG
FT                   QSIEAGWFQEGQFVDARSNTKGKGFAGVMKRHGFGGQDRSHGVSLTHRSMGSSGPGQGG
FT                   GSRVYPGKKMAGNMGNTQNTVQNLKILKVDSENGIVVVSGAVSGPKGCVVRIQDAIKKP
FT                   WPEVPQAEATEPATA"
FT   sig_peptide     59860..59907
FT                   /db_xref="UniProtKB/TrEMBL:B6HF31 "
FT   mat_peptide     join(59908..60643,60718..60821)
FT                   /db_xref="UniProtKB/TrEMBL:B6HF31 "
FT   CDS_pept        join(complement(61234..61695),complement(61071..61160))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671389"
FT                   /orf_name="Pc20g00210"
FT                   /product="Pc20g00210 protein"
FT                   /protein_id="CAP85350.1"
FT                   /db_xref="InterPro:IPR014807"
FT                   /db_xref="UniParc:UPI000183190D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF32"
FT                   /transl_table=1
FT                   /translation="MVFSRAFTRRAALARQSARPNIASRRTMIAAPGPNTGPLLERRAD
FT                   RELPNPNPGRKWLYTLPIFIIATGAGMLGIFNYQKSSSSIVNSTLYALRTSPRAREILG
FT                   DEIYFAQQIPWISGEMNQLHGRIDISFWVKGTKSQGKMKFRSIRPDRMSYFRTEEWSLE
FT                   TEDGTVVQLLDNDSDPFRKN"
FT   CDS_pept        join(61865..62005,62062..62380,62432..62526)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234634" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946679"
FT                   /orf_name="Pc20g00220"
FT                   /product="Pc20g00220 protein"
FT                   /protein_id="CAP85351.1"
FT                   /db_xref="UniParc:UPI000183190E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF33"
FT                   /transl_table=1
FT                   /translation="MAAVRLRKAFRYPEESEGEREELDEEQQERVIEQLQSQNDARNAQ
FT                   YSMIFTALPVLAATVFVPSVLSASSQAERLFSLLGLASLLTTAYIMKCFPLHPDRKGKK
FT                   PMTFHTERIARLHAALVPGTSAVCLLLAVVYLSTEPSYAVHPVLYLIPGAMLAVILLAQ
FT                   KVMLSVDLASLKDLQYEYKGA"
FT   CDS_pept        join(complement(64947..65214),complement(62861..64872))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977330"
FT                   /orf_name="Pc20g00230"
FT                   /product="Pc20g00230 protein"
FT                   /protein_id="CAP85352.1"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="UniParc:UPI000183190F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF34"
FT                   /transl_table=1
FT                   /translation="MPAHRTRLAFEPLSPLLDIHRVVESTPNFEFAMDITCDAIEDFPL
FT                   EDFEKLVLYQVVLSGRPLVIRGFHQRLDKRIFSEKWLRAKYAKKVEEVRDLVKKKTFNF
FT                   SMGHYLDNLSLLTRQVTVHNYTHKDLQRLYLKDIDCPPEWHAYLENLLPPFLFYLNEGP
FT                   KGFEGSASGKTNLSEIPKSTQGDPIAPSGDLMSSLPPSMRAENLMCYIGHEGTYTPAHQ
FT                   EMCASLGHNIMVEASDGSVENGKPTVPGSSIWLMTETKDRRIVSEYWMSVLGHDIDIED
FT                   FFAPLHAWEIAPFKTWVVEQRPGDLILVPPLAAHQVWNRGTRTTKVAWNRTTVDTLELA
FT                   LHEALPHARMVCRDEQYKNKAIVYFALERYSKLLRQAKKVDHPVVVQLWDDFKRLFNLY
FT                   KGILLSESFSQKNPEKNVEYHEFQSNVTCSFCRCNIFNRFLTCPGCANALGGEEDPYDI
FT                   CMDCYVMGRSCACISHLKWMEQFPWKLLTERYETWRRLIISSDENNKDLKVQFPTFIVA
FT                   RGQVGKKSVAEICQEQLVRRPWNDPKKPKPVVDNTNEDAGSESEGNSRSKKRRKMRQSL
FT                   MAKSDDVHRCHVCLHFEVNWKLAPCSNCDQRYCYGSLFRAFEISPQEAMEKHHWLCPKC
FT                   RKECSCGACQRDPSMKPYEPNCTILGHDTSKVADPRSIETLVDFRKSNLWWLKKFGDDV
FT                   HGRIQKRQKEAEEAELERQKTLEDQGFSFETSPFDPPQNGNGNDENPLGFDDNDGGIPV
FT                   DPSLMT"
FT   CDS_pept        66030..67286
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000003697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946680"
FT                   /orf_name="Pc20g00240"
FT                   /product="Pc20g00240 protein"
FT                   /function="prenyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85353.1"
FT                   /db_xref="GO:0004659"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="UniParc:UPI0001831910"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF35"
FT                   /transl_table=1
FT                   /translation="MLSTSSRLLRARLSPYRQKVNLTGLYNGRLPTFAHNAYSPTQLKD
FT                   PRFLASGSSIALRTTQVQVRHSSQLQSPATQPTETDSAEKNPATHYILPKTGLIASLPS
FT                   SWIPYAELVRLDKPTGTYYLFFPTLFSTLLAAPMAGAAPLHVLGTSALFFSGALIMRGA
FT                   GCAINDLWDRNLDPHVERTKFRPIARGALSPKNAILFTGSQLVAGLGVLLSFPTQCLWY
FT                   GIPSLPIVVAYPLAKRVTNYPQAVLGLAFSWGAIMGFPALGVDLLANHDALMAAGALYS
FT                   SCIAWTVLYDMIYAHMDIKDDVKAGIKSIALRHEHNTKAVLSGLAVTQVSLLAAAGVAA
FT                   GCGPVFFVGSCGSAVLSLGLMIWKVQLKNVRNCWWWFRNGCLLTGGGISLGLFAEYATQ
FT                   YLGLYNTTEPERVVAESTQ"
FT   CDS_pept        join(complement(67794..68109),complement(67334..67734))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187629" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977331"
FT                   /orf_name="Pc20g00250"
FT                   /product="Pc20g00250 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP85354.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="UniParc:UPI0001831911"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF36"
FT                   /transl_table=1
FT                   /translation="MDSQVSPTPFIAEQYTNDNKTHVLLAAATINLRNIAEALCRNKNI
FT                   SVRILVSEPAEKFLAGQSLEQPVLGTLLQIDGVDAIYRDQDEWSPSWTRGGPVLHIELR
FT                   KWAHILLVAPMSANTMAKTANGIADNLLLSVIRAWDTTGVVDMGFKTQKPMIFAALDMD
FT                   PCTYRHPVTEKQLTVLRDQWGWSESNPEGWLTVLPPIEKNLAYGDVGAGSAGSMMDWRD
FT                   IVTVVQHYVAGLAQQS"
FT   CDS_pept        join(68318..68341,68395..68689,68758..68912)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095211" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671390"
FT                   /orf_name="Pc20g00260"
FT                   /product="Pc20g00260 protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAP85355.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0001831912"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF37"
FT                   /transl_table=1
FT                   /translation="MFSRAVASAFRPVSRPTFLRPVRSAIQFPSGPSIPSVLHARLLSN
FT                   ETRTAIDKAVSSAPVVLFMKGTPETPQCGFSRATIQILGLQGVDPKKFVAFNVLEDAEL
FT                   RSGVKEYSEWPTIPQLYLEKEFIGGCDILMSMHQNGELAKLLETKGVLVAADE"
FT   CDS_pept        join(complement(70613..70739),complement(70435..70552),
FT                   complement(69601..70375),complement(69223..69546))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187618" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824084"
FT                   /orf_name="Pc20g00270"
FT                   /product="Pc20g00270 protein"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP85356.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0001831913"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF38"
FT                   /transl_table=1
FT                   /translation="MDSTPIEEQVPLPGKWPVDPQEDVPISEDRLWVDGCFDFSHHGHA
FT                   GAMLQARQLGKALYVGIHSDEAILENKGPTVMSLEERVAAVDACRWATQSVPHAPYVTY
FT                   LPWVSHYGCKYVVHGDDITSDSDGNDCYRFVKAAGRFRVVKRTPGISTTDLVGRMLLCT
FT                   RNHFVKSVKGTLAGLEGYGSPEERQASAKDLLRRIKDYATDESGLQPGPQVWTWTGSGT
FT                   AKMDHVVEEAGLFETLVDGKGPKPGQRVVYVDGGFDLFSSGHIAFLRKVTELEESEGRQ
FT                   RGWYEPDQVAKRLKDHGEDYGPSYIVAGIHDDDVINHWKGLNYPIMNIFERGLCVLQCR
FT                   YINAVIFSAPFTPSEPYLKAIPWGTPDAVYHGPTTFIPLTYDPYTAPKKMGIFREAEQH
FT                   AFQHVNAGEIVGRILKSREAYEARQRAKLDKAIAEDLVKSQEAAQAAQ"
FT   CDS_pept        join(71099..71301,71363..72116)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187597" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946681"
FT                   /orf_name="Pc20g00280"
FT                   /product="Pc20g00280 protein"
FT                   /protein_id="CAP85357.1"
FT                   /db_xref="UniParc:UPI0001831914"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF39"
FT                   /transl_table=1
FT                   /translation="MIPSTFAPGITRRDTAKSSGGHEGAYGIPPPVISGGGLLGPQSAG
FT                   AIYQHIHEMAAKRISTLDYLRKAHEGRVYWFNTVHFSRADIARLPYFEARKLSRRAINY
FT                   LLLGLSLPTILDVNSTPFEYVRALNALLMEFEAFQQVHPPDGSSSSTLARARIPQMFKR
FT                   AAHAGTKTRRASSANEIGLPMQSSDPSDLKSTAGNLGSASSASVTSFPLTESSDLHPGE
FT                   EYTYLLTPSLPFEPDFFETFATLCDVLIDTYSRLAALVSSPSVCTVALGETFSKADARL
FT                   RKIMVAGAVREFEDASRNSVKSEVAGVSRVVLGGLLG"
FT   CDS_pept        join(complement(73073..73225),complement(72590..73009))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977332"
FT                   /orf_name="Pc20g00290"
FT                   /product="Pc20g00290 protein"
FT                   /protein_id="CAP85358.1"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="UniParc:UPI00018319D5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF40"
FT                   /transl_table=1
FT                   /translation="MKVFSSGCTFDYSWDEVSTANWRKYCPWNDKSTHVVGVDTLSRTV
FT                   DPSTGILRTERLITCNQSVPQWVLSLLGGTNTSHVYEISYVDPVAKKVTMCSTNLTWSN
FT                   VLSVRETVIYRQSSLSPATTTEFSQEAKITALCGGWQKIKNKVEEASVDRFRENAKIGR
FT                   EGFETVLEMSRRVFGEQRELEKQRLQS"
FT   CDS_pept        join(73759..74041,74151..74500)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000022344" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977333"
FT                   /orf_name="Pc20g00300"
FT                   /product="Pc20g00300 protein"
FT                   /function="antioxidant activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAP85359.1"
FT                   /db_xref="GO:0016209"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI00018319D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF41"
FT                   /transl_table=1
FT                   /translation="MVELRKRKAPAPLLVAEKKTKQAPKPKQDADATDNDTEKRPAQKV
FT                   PEVDDIIDIETFSGEFETNEGEKTTLKKLLEESKSGVVFFTYPKASTPGCTKQACLFRD
FT                   NYTHLTSTGLSIYGLSGDSPKANTTFKTRQNLPYPLMCDPKATLIAAIGFKKSPKGTTR
FT                   GIFAVDKKGKVLLRAAGGPDATVDAVQKIVANAPSVEDSKEEGDETA"
FT   CDS_pept        join(complement(75774..75834),complement(75288..75726),
FT                   complement(74982..75226),complement(74747..74934))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19824085"
FT                   /orf_name="Pc20g00310"
FT                   /product="Pc20g00310 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85360.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI00018319D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF42"
FT                   /transl_table=1
FT                   /translation="MPVTQSIEREASGSKSQFAPGHKIPVQHLKKPGLQSDLGDPKPVS
FT                   THIPTEDYGYQTYKAAGKLEGKKAIITGGDSGIGRAIAILFAMEGASSVIVYLPEEESD
FT                   AQTTKKRVEEHGQQCHTLAIDLRQKENCRKVINTALEKMGGIDILVNNAAFQDMLSDIS
FT                   ELEESQWEKTFNTNIHSFFYLSKYVLPHMKEGSTIINCASVNPYIGRGDLLDYTSTKGA
FT                   IVAFTRGLSNQQIKKGIRVNCVCPGPIWTPLIPATMQTEAMEQFHAVPIGRPGQPSEVA
FT                   TCFVFLASQDSSYISGQCLHPNGGMMVNG"
FT   CDS_pept        76813..78951
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187542" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946682"
FT                   /orf_name="Pc20g00320"
FT                   /product="Pc20g00320 protein"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAP85361.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="InterPro:IPR007151"
FT                   /db_xref="InterPro:IPR012173"
FT                   /db_xref="UniParc:UPI00018319D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF43"
FT                   /transl_table=1
FT                   /translation="MAKGQSKSKTVSASTAQASEQMPLSFALSSPWSFLRPTNDLHTNV
FT                   VDSAKHILDSLAGSVVDAQTARRQLNKKRKRSDLESDSVTQLQLKNLYVDGFTSNQIWE
FT                   QATRILQSTGDEIERDITLITQHGGYMESADSGQLEDISDPEGAQSDSDSQESMLEDLS
FT                   EGSGAEDDLDEGSDEEVDMGSDDDMEDIEDMDEDNSSVGSAEEEPEVFVEDKFGLNDGF
FT                   FSIDDFNKQSEALERQDAAGGPEQEDSDEEDLDWHSNPLIAGNAATIHDDDKSKNSRPT
FT                   EKEDESMDDSEEEGPTFGNADLNGDSDSDDEDAADMEDGEAAAWVNTSDIKYADFFAPP
FT                   PRKVSNKKHRALPKTQPDAPAIDESDVKRAMDDVRRDLFDDMDADSAEEEDENLDGSTD
FT                   PTAQRSTHEKQRARIADEIRRLEAANVAKKEWMYTGEARAVERPVNSLIEEDLEFERIG
FT                   KPVPVNTNETTEDIEELVKRRILAMEFDEVIRRRPGAEGQQAGRKPRFELDDTKPQQGL
FT                   AEMYETEHLRANDPNFVDTKDRKLMREHAEITSLWNELSSQLDTLCNWHYKPKVAQASI
FT                   NVVTDAPTIMMEEARPTAGGAAGGPVGLAPQEIYAPGDDGRVKGEVVLKTGASISKEEM
FT                   SREQKAKNRRQNKQTQKKADAAKPTQQKPGKAAEKQQMISDLKKGGVKVIDKEGRMTNI
FT                   DGGSVQEGAKNRGDNLKL"
FT   CDS_pept        join(complement(79580..79851),complement(79037..79514))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187553" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977334"
FT                   /orf_name="Pc20g00330"
FT                   /product="Pc20g00330 protein"
FT                   /protein_id="CAP85362.1"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI00018319D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD0"
FT                   /transl_table=1
FT                   /translation="MIETPMTTPPGPELSPPSSPDGLKISESLAPPRELKAATTTDISF
FT                   DGLLKEPLLLKEDLKDGCGGQLWPAGMALAKYLLSRHAADLSDKTIVELGAGGGLVGLA
FT                   VARGCHLEQPIYITDQEPMFSLMKSNIQLNNLGPNATAAILNWGEPIPKQIPSKPNVII
FT                   AADCVYFEPAFPLLITTLQDLLGPNSVCYFCYKRRRRADMRFMKMAKKAFEMELVRDDP
FT                   GAEGYNRESIFIYTIRAKRLDQKSETR"
FT   CDS_pept        join(complement(81164..81179),complement(80801..81105),
FT                   complement(80608..80742))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000187564" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946683"
FT                   /orf_name="Pc20g00340"
FT                   /product="Pc20g00340 protein"
FT                   /protein_id="CAP85363.1"
FT                   /db_xref="InterPro:IPR013879"
FT                   /db_xref="UniParc:UPI00018319DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD1"
FT                   /transl_table=1
FT                   /translation="MTTLHYLPPVKPSAIALGTIFTHTASLGILAPVFGDTYHRAQAAN
FT                   SKEEFIKSKEAAGAAAAWGSSLAGSAVQTYGVAALINATGTLSYKGAAYLGTLIFFASS
FT                   APGIVSQVFSEKRPLDTIAVGAVSRVFETVGLSLFLTWWGTRTHPFD"
FT   mat_peptide     join(complement(80801..81016),complement(80611..80742))
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD1 "
FT   sig_peptide     join(complement(81164..81179),complement(81017..81105))
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD1 "
FT   CDS_pept        join(complement(82771..82830),complement(82187..82695),
FT                   complement(82109..82133))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187575" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977335"
FT                   /orf_name="Pc20g00350"
FT                   /product="Pc20g00350 protein"
FT                   /protein_id="CAP85364.1"
FT                   /db_xref="InterPro:IPR016813"
FT                   /db_xref="UniParc:UPI00018319DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD2"
FT                   /transl_table=1
FT                   /translation="MARGIVNAAKSASNAISINQKYSVQSTGVWERIRRLLAIAPERST
FT                   GVPLNAQYRLPTPGSVPPLAYDDPVTLPAGDIADNPYWKRDVRRSYPQLSTVRQADAVG
FT                   LLTVGSQAAPKEDVLKIGQAGEQQLVAVKEQGEERGLAALFEQDKKSVQGVLGANGLPP
FT                   NPCNINAAPKPSQSKYELGTENGYPEKYTCRTFV"
FT   CDS_pept        join(complement(85982..86175),complement(85920..85926),
FT                   complement(85704..85864),complement(85259..85647),
FT                   complement(84711..85199),complement(84203..84642))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946684"
FT                   /gene_name="Dip5"
FT                   /orf_name="Pc20g00360"
FT                   /product="Dicarboxylic amino acid permease Dip5-Penicillium
FT                   chrysogenum"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85365.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00018319DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD3"
FT                   /transl_table=1
FT                   /translation="MGHPDEINALEAQPGYVDNLGDFKESEQDEPVQLHRELKARHISM
FT                   IAIGGAIGTGLVVGTGSALTAGPGSLFIAYCFMGFVVWTVMCGLGEMAAWLPLSSGFTG
FT                   YAGRFCDPALGFTLGWCYYLKYIILPPTQLTAAALVITYWPRTSAENVNPGVWIAIFMV
FT                   AIIVINYFGVKIFGELEFWLSSFKVIVILGLILCSLIFALGGGPDHDRRGFRYWNKPGA
FT                   FATKYTDGALGKFLAFWSTMVQATFAFLGTELIGVTVGEAQNPRKTIPKAIKLTFWRII
FT                   VFYILSVLFLGMLVPYDSKELAFATEAESSAAASPFVVAMGQVAALPHIINGCILVFVF
FT                   SAANSDLYIATRTLYGLAREKKAPKIFARTNRAGVPIYSLALSASFCLLAFMSVSSTSK
FT                   EVFGYFTDMVSIFGLLTWVSLLITHIFFIRARRAQGVDQATLAYKAPLGIIGSCIALFF
FT                   CVLVLFTRSFGVFIHDPETYGNFDYKTFITSYIGIPLYVAAFAGWKIWNKTEIIKPHNA
FT                   DIWTGKAEIDREEAEYVAMVAIQDQNLSGWNKVYRKSLAWLF"
FT   CDS_pept        join(complement(87826..87836),complement(87539..87655),
FT                   complement(87407..87476),complement(87183..87345),
FT                   complement(87131..87150))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824086"
FT                   /orf_name="Pc20g00370"
FT                   /product="Putative uncharacterized protein Pc20g00370 "
FT                   /protein_id="CAP85366.1"
FT                   /db_xref="UniParc:UPI00018319DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD4"
FT                   /transl_table=1
FT                   /translation="MTQNLIMILTTLLNNTNVYISVHMVNIPLSVVSLSCPTGLSSIAI
FT                   YLGNYLGTRGHDNIIWNRRREISPSSRDYDKEVLAGHKPREGGFGVWGFNSYKIHSPRE
FT                   AAKSLHSIFERELPIQHFLRTL"
FT   CDS_pept        join(87884..87895,88027..88201,88275..88358,88401..88567,
FT                   88606..88997,89046..89215,89270..89504)
FT                   /pseudo
FT                   /gene_family="HOG000175620" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(90583..90625),complement(90331..90529),
FT                   complement(89909..90264),complement(89756..89850))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228249" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946685"
FT                   /orf_name="Pc20g00390"
FT                   /product="Pc20g00390 protein"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /function="iron ion binding"
FT                   /function="quinone binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="photosynthesis, light reaction "
FT                   /protein_id="CAP85368.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0019684"
FT                   /db_xref="GO:0048038"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="InterPro:IPR014406"
FT                   /db_xref="UniParc:UPI00018319DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD5"
FT                   /transl_table=1
FT                   /translation="MFPMAKPAISGALSAARPRFVASLPRAQPLAALSTSSIKSATALE
FT                   RQPSASAQQLTASGKARREVPLPSQEKKEGAMQYALTTLDQIANWARQSSLWPMTFGLA
FT                   CCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPRW
FT                   VISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTSEALMYGIFQLQKKMRHTR
FT                   ITRMWYRR"
FT   mat_peptide     join(complement(90331..90443),complement(89909..90264),
FT                   complement(89759..89850))
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD5 "
FT   sig_peptide     join(complement(90583..90625),complement(90444..90529))
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD5 "
FT   CDS_pept        join(91003..91115,91151..91661,91733..91921)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201389" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128433"
FT                   /orf_name="Pc20g00400"
FT                   /product="Pc20g00400 protein"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85369.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI00018319DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD6"
FT                   /transl_table=1
FT                   /translation="MPERVSPLPRGIGTTTPLLSTLLQSTRPLKGLLNSRALLELPPDH
FT                   SVQTRESVLNSKEPKWSRPVRIHCYLKSYYGNGGSQNCLHWRDWESSTHPYHLVPLELS
FT                   VLTRLQDNPLHISLFPPYSDSTIEFSFLLNSCLDIFDIRCKQTSIDQDLGLLHAIDERL
FT                   AAYGWLTTTGVKLLIIVDLFGQEEASAGKQAGAAINGLRDSDVKPAFRALQSAYIQLLQ
FT                   NPFYSPDDHVPIPGNTASSLSACQPISNKKFIADVKRIGDSWAPGSSL"
FT   CDS_pept        join(complement(93257..93404),complement(92130..93196))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000036504" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946686"
FT                   /orf_name="Pc20g00410"
FT                   /product="Pc20g00410 protein"
FT                   /function="transferase activity"
FT                   /protein_id="CAP85370.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI00018319E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD7"
FT                   /transl_table=1
FT                   /translation="MLSRLHPRGHLRQRSIVHVTLQVLATRSRPTNPNLLPSRRDLHTA
FT                   LFFPGHGVQRVGMANSWIESFPNTAAKVLDEMDSTLGFKLSSIISDGPNSKLNKTENSQ
FT                   PAVMAISVLILRILEQEFGFNTKSRVDVTLGHSLGEFSALVAGGYLEFGDALKLVRGRA
FT                   EMMARCTRQLSEQSGESYGMVALLCEPEHLEGLLRTVQDFVGPESPGIEIDRDNRVPLI
FT                   QQVVVANINSKNQIVLSGSLDRIKILLVQMRQFGGHDPRAVRLKSDSPFHSPAMALAAD
FT                   YMRDAVENISITFPASIPCISNVSALPFQSKEDIRDLLSRQCIETVRWWDSIRYLHQER
FT                   GVRRWIGIGPGKVGRNLVGKEVGRVNTKGGGVWAVCDPREMSEIMVALEQTEAETGDTQ
FT                   PELAG"
FT   mat_peptide     join(complement(93257..93320),complement(92133..93196))
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD7 "
FT   sig_peptide     complement(93321..93404)
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD7 "
FT   CDS_pept        94327..98433
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187531" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946687"
FT                   /orf_name="Pc20g00420"
FT                   /product="Pc20g00420 protein"
FT                   /protein_id="CAP85371.1"
FT                   /db_xref="InterPro:IPR007187"
FT                   /db_xref="InterPro:IPR014908"
FT                   /db_xref="UniParc:UPI00018319E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD8"
FT                   /transl_table=1
FT                   /translation="MFVPKAGGRNTRRRQRTSSDDSVKPPKAKRQRSVLRRPDESPSDT
FT                   NLGRELAKLATPTTPNGDIAPTDQMSELHLSTRVVKQGDVSGNNNEGTVVLVGYFISLR
FT                   VPSDSQVQTANLLGSKSSTDFYTVDQLPSLPDQIRGLQSGISNSIAFSHLGLRFVDTHP
FT                   LNAEPLKCFFGPGHDHALALTRSHAIVWPYSAPASSPSPSETFTVSIPESCRDPKGAVP
FT                   LGVLLSTATGDHPGLLVIIPSTGKVVYWETVSSAASLGLSRQKQNGIQGSTPGMLSGEY
FT                   ATDILNGEPSGIIVTFSSGRVAHITLRDPQGKPSVLVNFLRSTAGTGGGGIFGGLKNVF
FT                   AGGSWRKEVTAVRAGGSHQRGQRDVIIATSTGLVEIWDTHWNHGNTLKKRYDLKEEILA
FT                   ALPEYHAQPTNDTELKVADFAFSTLQSSDDAVQLSDGSWRLFLVVRSPQWLETRALFVA
FT                   QVHLSGNESRVMSTHAVDLRHIPASQLETSKPKIFVPKPEETAFILIGQSLVILSLTSV
FT                   EESPSSQLLLDSNKLPLPFQDTIHLRSGTDHEILGSMSEDQSNDSPCAACVLMLRNFGV
FT                   IRVTVLPRPGIEQDVDEPQVTAKHKLEQAVFFGTMAKNPLNLSSEGDLNFPPSEMEQAS
FT                   LEICRELLQSETRFIPTTAISLEQNLRLRAKALDDLASLLSRQGNPVSRPARWELLWAA
FT                   EKIAAQRAMWKVQEACKIKNGEEGPFLSHVIASMHDKFKTPINPQQGETDPVRQWFLRD
FT                   SYRMEHIIPWIKNAIKLGRSNTSNPARALSEKILAASELFLAVTETAFRYRDEHVALYG
FT                   LRGDFLEDGVLSDGYEDLPEFWTSRGVGYSEAGHLLDLELDSCRSWKTPASAADAPDTH
FT                   VLNQVAKNSYRHLRVIGQMHLERTRWLSAQGDPKLMDESVSIEQAHVEDRKWQLFKLAG
FT                   IDHLADAVELAESFRDMGALVELIIELQDQKATQHPQPPSDVSTNQTDIDADQLIAKYF
FT                   DKFGDIWADAYFSRQIAMGYPGTLFTMRKYQSAVTRFLRSNPAYSRLSWINDVIGEDDY
FT                   DTAATSLEDLAIGSEKDLWSHRVEISLAKLGKLATKERMDSPVVASTLQEDVKRLDDYV
FT                   EVDGIQDILYSHIQPILQGAIDRKAELELVLDQCGEHIFEDRPSLHEILSDALFTLIER
FT                   QVVGADGLIDILTLMGPAQLADDTEGELVRSEFHLALQVLDYGRYGQRDPSYLTALRRL
FT                   IWRRCLIKDDWVARGKAAEGPNGNASNLVADTTLYRSLTACLEGDFVPNINTWTIELTS
FT                   VPCLEPRNAGLHSLYTPLSPAEALMTDSDSDILVSRFRPEQKSRVASDLQTENDILRQC
FT                   IEVGKLDFWFQNLRETAEVHISPPE"
FT   CDS_pept        join(complement(99409..99541),complement(99147..99297),
FT                   complement(98838..99087))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048507" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946688"
FT                   /orf_name="Pc20g00430"
FT                   /product="Pc20g00430 protein"
FT                   /protein_id="CAP85372.1"
FT                   /db_xref="UniParc:UPI00018319E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD9"
FT                   /transl_table=1
FT                   /translation="MRSRVLPPLDCMIPSPVSFCFSSFHLFWDTIHHLPSHQTSTLTPM
FT                   TRSHKSNDREHQAEGMMGTRENIPRYFAKSGPTDADPRKTKKDGGGKGNWGRSGEEMQD
FT                   TDYSFANARRRSNSSTQGLADFNTKFEAFEPEPVFEEEAFDGADMTAGNDNTVTKVESA
FT                   SSNGSQADHVGRKY"
FT   CDS_pept        join(complement(102012..102025),complement(101819..101903),
FT                   complement(101741..101766),complement(101176..101677),
FT                   complement(100966..101109))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000105220" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824087"
FT                   /gene_name="rps1"
FT                   /orf_name="Pc20g00440"
FT                   /product="40S ribosomal protein S1 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85373.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="UniParc:UPI00018319E3"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HFE0"
FT                   /transl_table=1
FT                   /translation="MAVGKNKRLSKGKKGIKKRTVDPFTRKDEYSVKAPSTFQTRDVGK
FT                   TLVNRTSGLKNANDSLKGRIFEVSLADLQNDEDHAFRKVKLRVDEIQGKNCLTNFHGLD
FT                   FTTDKLRSLVRKWQSLIEANITVKTTDDYLLRLFAIAFTKRRPNQIKKTTYARSSQIRA
FT                   IRKKMTEIIQREASTCTLSQLTHKLIPEVIGREIEKSTQGIYPLQNVHIRKVKLLKSPK
FT                   FDLGALLALHGESATDDKGQKVEREFKETVLESV"
FT   mat_peptide     join(complement(102012..102022),complement(101819..101903),
FT                   complement(101741..101766),complement(101176..101677),
FT                   complement(100969..101109))
FT                   /gene_name="rps1"
FT                   /product="40S ribosomal protein S1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HFE0 "
FT   CDS_pept        join(102765..102767,102844..102888,102944..103082,
FT                   103148..103326)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824088"
FT                   /orf_name="Pc20g00450"
FT                   /product="Pc20g00450 protein"
FT                   /protein_id="CAP85374.1"
FT                   /db_xref="InterPro:IPR007808"
FT                   /db_xref="UniParc:UPI00018319E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE1"
FT                   /transl_table=1
FT                   /translation="MGKRKKSSSKPQGPRKREPLATTFSCLFCNHENSVVVKLDKKLGL
FT                   GDLSCKVCGQKFQTGINYLSAPVDVYSDWVDACDAVAKDTANQYDAPNPSQLGQRGISK
FT                   QAIPEETGQDDGYDDDY"
FT   CDS_pept        join(complement(104422..104579),complement(104003..104361),
FT                   complement(103774..103945),complement(103668..103719))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000262755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946689"
FT                   /orf_name="Pc20g00460"
FT                   /product="Pc20g00460 protein"
FT                   /protein_id="CAP85375.1"
FT                   /db_xref="UniParc:UPI00018319E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE2"
FT                   /transl_table=1
FT                   /translation="MASKPESGPSPAQGVGPLYRPDGEKPTATVSKEVSYDNVHVLPQT
FT                   PQLIALLTMIRDKRTSRADFIFYSNRIIRLLVEEGLNHLPVVEQSITTPVGRSYLGVKF
FT                   EGKICGVSIMRAGEAMEQGLRDCCRSVRIGKILIQRDEESCMPKLFYDKLPSDIADRWV
FT                   LLLDPMFATGGSATLAVETLIERGVPEHRILFLNLIASPSGVAEFAERFPKLRVVTSFI
FT                   DQGLDEKKYIIPGLGDFGDRYYSM"
FT   CDS_pept        join(105210..107396,107458..107736)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671391"
FT                   /orf_name="Pc20g00470"
FT                   /product="Pc20g00470 protein"
FT                   /protein_id="CAP85376.1"
FT                   /db_xref="InterPro:IPR022771"
FT                   /db_xref="UniParc:UPI0001831AB2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE3"
FT                   /transl_table=1
FT                   /translation="MDNSHPRNRRLVTYGSAAKSQPPSNTEKTVRSSATRTTSKEMPLP
FT                   SSSRPSRPVYTRLQRDKNGDKQLSGPAKTTTARGVTQPKPITEANVYDFPSSDDEQMSM
FT                   IQRKRRRYSPNGNKAVPATKRSAKPSETGNGVHNVSPPMGKRGSDGRRPLAKKLEADER
FT                   TSSVASTSYSRPGRSVRNQTKLPTVENEMGVSTAEGLGDGESIRKSSPDINQGYATKAN
FT                   VTPGRRRLIDSLGITQSPVETSPAVETPLESPADSQPPPDPTTPDRASPSAAVNECPAE
FT                   SHVQDSPASVPSHLRGSRVTYARQRSFLDDLIMSEDLSTHNASSGLRHRSQSVQRQLNY
FT                   EATSSARLIVPNEDTNDDGSVRSIHELRQAGGNARYRGAVESIFEDIEDSQNSLTGRCN
FT                   AFLQLCGKLLDTGLKRRFVECNFDKRLVDCLSMDLQVVPTILAFCAYALGSSDGHMSYV
FT                   LATSAWPKLQEASPALLGMHDDIPVAARAQASGLSRPLQKTIQNTIPQIAAMLFPDTAL
FT                   SKLSPCILALYCLRSTMSTTQTKGENPSLSKSLLKPLVQALVLEGQRCASLGKIHPESS
FT                   EILCMGFSILESSTALAESFTKDHWDILDPLSELHSLLCLESGTAGQIQLLYIRLILNV
FT                   TNSNPSLCDRFATPEMVGGLVRIVSAKFGDLTEDALGQANSSLDSVILALGALINLTEQ
FT                   SEASRSIFLHSADSSKLFLDQLLHLFMTRVDSISTAHSVLEVHHNVAVGYLAVLLLTLS
FT                   LDPATRSKIKSSLAPNGLTTVISTVDEFLQYHQKIEQEISTSPTQGQPASGFLSRLQEL
FT                   ITRIRLAEQ"
FT   CDS_pept        join(108359..108413,108485..108624,108677..108805,
FT                   108866..109105)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233973" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128434"
FT                   /orf_name="Pc20g00480"
FT                   /product="Pc20g00480 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85377.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003577"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015602"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="UniParc:UPI0001831AB3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFN7"
FT                   /transl_table=1
FT                   /translation="MPSAPKQRKIAIVGSRSVGKSSLTVRFVEHHFVESYYPTIENTFS
FT                   RIIKHNGQDYATEIVDTAGQDEYSILNSKHFIGIHGYIIVYSVTSRQSFDMVRVIRDKI
FT                   LNHLGADDVPLVIVGNKSDLKPDHRQVTLDDGRQLAEELNCAFTEASAFLDFNVSKAFD
FT                   LMIGEVEKSQNPSQPTGNNKCALM"
FT   CDS_pept        join(109708..109840,109891..109961,110016..110177,
FT                   110244..110665,110717..110807,110858..111226,1
FT                   11280..111444)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000035937" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824089"
FT                   /orf_name="Pc20g00490"
FT                   /product="Pc20g00490 protein"
FT                   /function="ATP binding"
FT                   /function="serine-tRNA ligase activity"
FT                   /biological_process="seryl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85378.1"
FT                   /db_xref="GO:0004828"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006434"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniParc:UPI0001831AB4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFN8"
FT                   /transl_table=1
FT                   /translation="MLDLADFVTERGGDIKKIKESQQKRFAPEEAVDEVVALYEEARRA
FT                   RYDVTQMGSQINGVQKAIGMKKKNKEDATELLAQKAELETKKKELEEAAVAKEVQRDRK
FT                   IRTIGNYVHESVPVSNDEADNKLIKTWTPEGAEMQKPGCLSHHEVLTRLDGYDPERGVK
FT                   IVGHRGYCLTGYGLFLNLALINYGLEFLFNKGYTPNQPPQFMLKDLMAKTAQLEQFDEE
FT                   LYKVTESEDKSTDKYLIATSEQPLSALHDSEWLQDKDLPIKYAGYSTCYRKEAGSHGKD
FT                   AWGIFRVHQFEKIEQFVLTKPEDSWQAFEDMMNTSEEFYQSLKLPYNIVAIVSGALNNA
FT                   ASKKYDLEAWFPFQQEYKELVSCSNCTDYQARALEIRYGAKKATDLKKTYVHALNSTLC
FT                   ATERTLCCVLENYQKEDGIEVPEVLRKYIPGAPEFLPYTKELPKDTTSSKAKAKANKGT
FT                   DDAAKKMQGLQV"
FT   CDS_pept        <111963..>112286
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(114651..114856),complement(114095..114554))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824090"
FT                   /orf_name="Pc20g00510"
FT                   /product="Putative uncharacterized protein Pc20g00510 "
FT                   /protein_id="CAP85380.1"
FT                   /db_xref="UniParc:UPI0001831AB5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFN9"
FT                   /transl_table=1
FT                   /translation="MSAATSSASTTHATGSLQDPTKLSSWVTEAQDAKKTPLLFSCIYG
FT                   IYLLGRIVVLLVANALKKRESQAEKDAKCSECPTARSRILELEQRVRIAELSARDANSR
FT                   AERFAVQVRRANELAEEFQRRAMAVEERVGDWRNFEFSANEVGSLHSPQTPSRHSPASS
FT                   AQSQPDSLKTQIKQSRVVSWTRSISRSVRRAVRPRRHKRSETLEAGQQFSKVRNSRSN"
FT   CDS_pept        <115351..>115918
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200305" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824091"
FT                   /orf_name="Pc20g00520"
FT                   /product="Pc20g00520 protein"
FT                   /protein_id="CAP85381.1"
FT                   /db_xref="UniParc:UPI0001831AB6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP0"
FT                   /transl_table=1
FT                   /translation="MSTPYDFDRQKESDISKIVPKLKGESNFAQWQHRLYMALRGNNKT
FT                   YVHLIQGTVNKPTPPDLYDESVETVRELAQHRATSAVFASGSSDPIAPVSDVVVRELVK
FT                   EQKQKNKELLREYQVLVDKWDLFNIHCCNQIFSTLDTIPASYVHNVENPRDAYKLLRAE
FT                   YGSSPWQGDFKRFEVLINLQHKNNNS"
FT   CDS_pept        join(117646..117926,117994..118301,118359..118948,
FT                   119002..119044,119097..119155,119215..119296,1
FT                   19350..119378)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000136696" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946690"
FT                   /orf_name="Pc20g00530"
FT                   /product="Pc20g00530 protein"
FT                   /function="NAD+ or NADH binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /protein_id="CAP85382.1"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831AB7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP1"
FT                   /transl_table=1
FT                   /translation="MSNARDIRPRQDDASLLATSPSASFNSPSSHSSAFNRTVPVNAKP
FT                   LKPFATEDIKVLLLENVNQTGREILSQQGYQVEFLKSSLPEDQLIEKIRDVHVIGIRSK
FT                   TKLTARVLKEAKNLIVIGCFCIGTNQVDLQYAADQGIAVFNSPFSNSRSVAELVIGEMV
FT                   MLARQLGDRSSEMHAGTWNKVSNGCWEIRGKTLGIIGYGHIGAQLSVLAEAMGMSVIYY
FT                   DVLNIMSLGTARQVEALDDLLAEADFITCHVPELPETKGMIGQKQFEKMKKGSYLINAS
FT                   RGTVVDIPALIDAMRSGKVAGAALDVYPNEPAGNGDYFNNDLNSWGADLRSLKNLILTP
FT                   HIGGSTEEAQKAIGVEVAQALVRYANEGSTLGAVNLPEVVLRSLTMDEPDHARVIYIHK
FT                   NIPGVLRKVNEIIGDHNVDKQMTDSRGDVAYLMADISNVDAATIKELYTSLESLPSRIM
FT                   TRVLY"
FT   CDS_pept        join(complement(121575..121684),complement(121443..121524),
FT                   complement(121130..121381),complement(121048..121075),
FT                   complement(120781..120994),complement(120534..120728),
FT                   complement(119746..120478))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977336"
FT                   /orf_name="Pc20g00540"
FT                   /product="Pc20g00540 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85383.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831AB8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP2"
FT                   /transl_table=1
FT                   /translation="MAIKSLEKDENGQARFFGCSNIRDYEFLDKLGEGTFGEVYKARSK
FT                   KDAKIVALKKILMHHEKEGFPITAIREIKLMKALSHPNILQLKEMSIERGKGEGRKKPS
FT                   MYMVFPYMEHDLSGLLENPAVTFTEPQIKCYLMQLLEGLKFMHANRILHRDMKAANLLI
FT                   SNGGILQIADFGLARPYDDAPPQPGKGGGESKREYTALVVTRWYRPPELLLQLRKYTTA
FT                   IDLWGVGCVFGEMFKGKPILAGNSDLNQAELIFNLVGTPNEENMPGWSQLPGCEGVKNF
FT                   GIKRGNLHNFFKDLNPVAISLLGEFLRLDWRKRINAMDALKHPYFTTHPLPARPGEIPQ
FT                   FADSHELDRKKFRSQRVPMPPVPPAASDTSNGAWPSSGSRGPDSRHSRVPGAARGGRPN
FT                   AQGMHGSHGHHAAHGHPQRRAPFPPTQRDTGLPPRPPAPHNPPWDGSQSNRPDNRDDRR
FT                   GQFGQGRPGGRSGNLDSYVPNYSSNDRGSDRGNDRSRDSGEHGSHSNADWRSTSRRDYR
FT                   RDPPPRRRSRSPGYRDGSRG"
FT   CDS_pept        join(complement(127837..127928),complement(127738..127777),
FT                   complement(127137..127679),complement(126743..127084),
FT                   complement(126561..126695),complement(126441..126507),
FT                   complement(126253..126384),complement(125857..126206),
FT                   complement(125648..125793),complement(125485..125592),
FT                   complement(125126..125432),complement(124924..125077),
FT                   complement(124519..124851),complement(124381..124463),
FT                   complement(124198..124329),complement(123775..124131),
FT                   complement(123678..123723),complement(123529..123625),
FT                   complement(123274..123422),complement(123134..123213),
FT                   complement(122902..123098),complement(122771..122830),
FT                   complement(122508..122568))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946691"
FT                   /orf_name="Pc20g00550"
FT                   /product="Pc20g00550 protein"
FT                   /EC_number="3.6.3.8"
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85384.1"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001831AB9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP3"
FT                   /transl_table=1
FT                   /translation="MGSRPQSPSGTGPVDLSMPRNRLRRDSMRSSMSVVSDVEMARNEV
FT                   FDGPISESIPSSVVSFAHRRDRAGSTVSFTYFQDEEDFAEWSNEDEDVVDEEGEDDEES
FT                   LHGIRDPDLESARGSFVSKRMSTSRDSVEHPLLSRYLSASSYGRDRRSGSRLNQKVYIA
FT                   SEDLTAVFAGFSTSSGGFAVYIALCILTGGFAWLLFRWLPRWRVKLIGKATPIGKCQWV
FT                   AIEDQWNQFTIHGVDSQIYGRPLSTVFADSPSHGYDEDNDPNIDSLRFIDYRYLKFFYH
FT                   PIEDKFSLINGWKDPSWTNAKVMRSGLDADERDSREQIFGSNAIEIEQKTIPQLLVDEA
FT                   FHPFYIFQIASLVLWSMDEYYYYAVCIFLISFFSIATTVLETKSTMSRLREISLFECDV
FT                   RVLRNGFWRSVSSQELVPGDVYEFSDPSLHQVPCDCILLSGDSIVNESMLTGESVPVSK
FT                   TPLTDDALKYLDLSTPSIHPQVAKHFLFSGTKVIRARRPQNVDEDEAVALAVVMRTGFL
FT                   TTKGALVRSMLFPKPSGFKFYRDSFRYIAVMAIVALLGFVASFINFVRLGLAWHLIIIR
FT                   ALDLITIVVPPALPATLTIGTNFALSRLKKQNIFCISPQKVNVGGKLDIVCFDKTGTLT
FT                   EDGLDVLGARIVTRGKRFSELLSETSDGFLCPSQNVDSECDIEKQRNIMYAMATCHSLR
FT                   VVDDELLGDPLDVKMFQFTNWRFEEGGNHVSDQTNPKYDTIAPSVAKPPQRHIGDEQDV
FT                   NDSLELGVLRSFEFVSNLRRASVIVRKFGDNGASFFVKGAPESIKDICIPGTLPSDYED
FT                   LLNYYTHKGYRVIACASKYERKLSWMKAQKMTRTDAESDLEFLGFIIFENKLKPSTAGV
FT                   ISELNEAGIRNVMCTGDNILTAISVARECNMLGRDELCFIPHFIEEPGISSKISLIWEC
FT                   VDNPDLQLDPRTLLPMNDAEVDLSIPGNVLTEREYSVAVTGDAFRWLVDFGNEDVLKKV
FT                   LVCGKVFARMSPDEKHELVEKLQSIDYCCGFCGDGANDCGALKAADVGISLSDAEASVA
FT                   APFTSRLFEISCVPTVIKEGRAALVTSFSCFKFMSLYSAIQFSSVSFLYTSGSNLGDFQ
FT                   FLFIDLVLIMPIAVFMGWADPAPTLSRKRPTADLVSRKVLTPLLGQILFLPPQLDLEKS
FT                   NIVNSENTALFLFSCFQYIFISIVLSAGPPFRKPMTQNGPYLFTIIVNTMISGYMLFRP
FT                   SNWVSEMLATRASIRYLRSVLDSREEHIPTCGTDAWTRSCPLAAKLPQKAQDVQSAVGG
FT                   IAPMKYAFKAPTLGSASANRATELPFQKIEKKGGPKGASSPTERDHPSWPGT"
FT   CDS_pept        join(129123..129169,129251..129330,129393..130100,
FT                   130159..130499,130552..130602)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171827" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946692"
FT                   /orf_name="Pc20g00560"
FT                   /product="Pc20g00560 protein"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85385.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="UniParc:UPI0001831ABA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP4"
FT                   /transl_table=1
FT                   /translation="MSEPIRNKKADFPVAPTPQNTPANNAPISSHAQQPGVSSIEEESL
FT                   DKAAAASLFARNPALVSMIQGKLGQLVGRSSGYIESLPPSVRRRVAGLKGIQKEHSKLE
FT                   AQFQEEVLELEKKYFGKFTPLYQRRSTIINGGVEPTEAEVEAGKEDEESDEEETKEEPK
FT                   KEEAETANGIPEFWLSAMKNQISLAEMITERDEEALKHLTDIRMEYLDRPGFRLIFEFS
FT                   ENEFFTNKTISKTYFYKDESGYGGDFIYDHADGSQIDWKEDKDLTLRLESKKQRNKNTK
FT                   QTRVVKISVPTESFFNFFSPPQPPSEDDESVASDIEERLELDYQLGEDIKEKLIPRAID
FT                   WFTGEALQFEELGEDFDGDEFEDDDDEEEEDDEDEEDLGSDRDVDEEDTDEEDGTSKPK
FT                   KEAAECKQN"
FT   CDS_pept        join(131371..131505,131602..131734,131791..131980,
FT                   132039..135891,135944..136017,136075..136393)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171839" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946693"
FT                   /orf_name="Pc20g00570"
FT                   /product="Pc20g00570 protein"
FT                   /EC_number="3.6.4.1"
FT                   /function="ATP binding"
FT                   /function="actin filament binding"
FT                   /function="motor activity"
FT                   /cellular_component="myosin complex"
FT                   /protein_id="CAP85386.1"
FT                   /db_xref="GO:0003774"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016459"
FT                   /db_xref="GO:0051015"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="InterPro:IPR018444"
FT                   /db_xref="UniParc:UPI0001831ABB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG04"
FT                   /transl_table=1
FT                   /translation="MAHIYEVGTRAWQPDPTEGWLASEVKEKLEDGEKVQLIFELENGE
FT                   TKTVETTQSELQVDNNPKLPPLMNPAMLEASEDLTNLSHLNEPAVLQAIKLRYAQKEIY
FT                   TYSGIVLIATNPFARVDSLYVPQMVQVYAGKQRASQAPHLFAIAEEAFADMLRDGKNQT
FT                   IVVSGESGAGKTVSAKYIMRYFATRESSDQPGKYTTSRAEAISETEEQILATNPVMEAF
FT                   GNAKTTRNDNSSRFGKYIEIMFDDRTNIIGAKIRTYLLERSRLVFQPLKERNYHIFYQL
FT                   VAGASDAEKQELGLLATEDFEYLNQGGTPVIDGVDDKAEFEATRKSLAVIGVPKEDQTG
FT                   IFRVLAALLHLGNVKITATRTDSSVSSTEPSLLRACEMLGIDATEFAKWIVKKQLITRG
FT                   EKITSNLTQQQALVVRDSVSKFIYSSLFDWLVDKINRRLATDEVLEQFKCFIGVLDIYG
FT                   FEHFAKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVREEIDWTFIDFSDNQPCIDLI
FT                   EAKLGVLALLDEESRLPMGSDEQFVTKLHHHFAADKQKFYKKPRFGKSAFTVCHYAVDV
FT                   TYESDGFIEKNRDTVPDEHLEVLRNSSNPFIKEILDTAAAVREKDSASMSSKPVAAAPG
FT                   RRIGVAVNRKPTLGGIFKSSLIELMHTINNTEVHYIRCIKPNEAKEAWKFEGPMVLSQL
FT                   RACGVLETVRISTAGYPTRWTYEEFAIRYYMLCHSSQWTSEIRDMCHAILRKALGDEKQ
FT                   DKYQLGLTKIFFRAGMLAFLENLRTSRLNECAIMIQKNLRAKYYRRRYLDARDSILTTQ
FT                   AFIRGFLARQHAHEIRRTKAATTIQRVWRGQKEKKRYTQIRKNFILFESVAKGFLCRRN
FT                   IMDSINGNAAKVIQRAFRSWRQLRAWRQYRRKVITIQNLWRGKEARNAYKRLREDARDL
FT                   KQISYKLENKVVELTQYLQTLKLENKTLVSQLDNYDTQLKSWRTRHNALEARTKELQVE
FT                   ANQAGITAARLEAIEEEMSKLQQGHTEAQATIKRLQEEERISREALQTANEELERLKLL
FT                   DADHEKDKTALRQRISDLEEQLEVAKRSVPLNGMNGDGLPNGGAVQTPTPGLINLVSSK
FT                   KPKPKRRSAGAERIETDRFSGAYNPRPVSMAVTPGSMATRQSAAISPGLESVEVELENL
FT                   LSEEEDLNEEVAMGLIRNLKIPLPTSTPPPTEKEVLFPAYLINLVTSEMWNNGFVKESE
FT                   RFLANVMQSIQQEVMQHDGDDAINPGAFWLSNVHEMLSFVFLAEDWYEAQKTENYEYDR
FT                   LLEIVKHDLESLEFNIYHTWMKVLKKKLYKMIVPAIIESQSLPGFVTSETNRFLGKLLP
FT                   SNNNPAYSMDNLLSLLNGVYKAMKAFYLEDAIILQTVTELLRLVGVTAFNDLLMRRNFL
FT                   SWKRGLQINYNITRIEEWCKSHDMPEGTLKLEHLMQATKLLQLKKATLNDIEIIQDICW
FT                   MLSPNQIQKLLNQYLVADYEQPINGEIMKAVASRVTEKSDVLLLAPVDMEDSGPYEIAE
FT                   PRVITALETYTPSWLQTPRLKRLAEIVSAQAMAQQEKLDWDNGVVEE"
FT   CDS_pept        join(complement(136942..137068),complement(136638..136827),
FT                   complement(136435..136570))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946694"
FT                   /orf_name="Pc20g00580"
FT                   /product="Putative uncharacterized protein Pc20g00580 "
FT                   /protein_id="CAP85387.1"
FT                   /db_xref="UniParc:UPI0001831ABC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG05"
FT                   /transl_table=1
FT                   /translation="MTPDDLVWEQAEEIFDKWLLQFLQHDVLRPIGAFIITHERGFGGK
FT                   GGDGIDSRSKVDGDGHQGSIYRGIQMSTLTFHEQFESQEKAKVENSLEKRMDSEPTHDE
FT                   TSHLQQFPEQSLLVYKPRRHMQLKQMKIMRITVSQRPWIIQASRNP"
FT   CDS_pept        join(137402..137572,137628..137701,137758..137902,
FT                   137956..137992,138054..138118,138171..138239)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000293320" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824092"
FT                   /orf_name="Pc20g00590"
FT                   /product="Pc20g00590 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP85388.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="UniParc:UPI0001831ABD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG06"
FT                   /transl_table=1
FT                   /translation="MTLTKLNFITGNKNKLLEVRAILGKVIEVDNQEVDVPEIQGTIEE
FT                   IAKEKARRAAEAINGPALTEDTALEFHALKGLPGPYIKSFMEKLGHEGLNKMLDGFEDR
FT                   TAEAVCTFAFCRGPGEEPIVFQGRTEGAIVRPRGSGNFGWDAIFEYDGKQTYAEMDKEE
FT                   KNKISHRYKALVKLQQWLAEGQQ"
FT   CDS_pept        join(complement(138844..139026),complement(138591..138739),
FT                   complement(138331..138532))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224472" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946695"
FT                   /orf_name="Pc20g00600"
FT                   /product="Pc20g00600 protein"
FT                   /function="ATP binding"
FT                   /protein_id="CAP85389.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI0001831B89"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG07"
FT                   /transl_table=1
FT                   /translation="MRTSPNVIITGTPGVGKTVHCEQLAQEIGLKHLSINQVAKDRGCF
FT                   DEYDEELKTWVVDEDKLLDALEDEIPNGGYLIDWHACDLFPKSWIDLVVVLRCPTTDVL
FT                   YDRLSSRGYHEKKLEENVDAEIFGVLADEAREAFDEEIVVELNSEQDSDVDSNCQRIAQ
FT                   WVDSWKQSQAENAD"
FT   CDS_pept        join(complement(139895..140326),complement(139811..139842),
FT                   complement(139606..139760),complement(139347..139551),
FT                   complement(139261..139297))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235067" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946696"
FT                   /orf_name="Pc20g00610"
FT                   /product="Pc20g00610 protein"
FT                   /protein_id="CAP85390.1"
FT                   /db_xref="InterPro:IPR012462"
FT                   /db_xref="UniParc:UPI0001831B8A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG08"
FT                   /transl_table=1
FT                   /translation="MPSWLKKMLGKGGNISKQTQITSDGKLTRRKTVENETDHLIPVLA
FT                   RLCEQDNSVQRAFLCSPKVRHICKMRREGGFCGYRNIQMMVSWVKKSGSFGHEHFPKEG
FT                   PTILELQDMIESAWDMGFNSSGRVETGGIKDTRKFIGTPEAQALFMSLGIPCEARSLPE
FT                   RSDVRACDALYIDVADYFRSACPPEDETKVIQTDLPPIYFQHQGHSMTIVGFEIRDNGS
FT                   ANLLVFDPMFKTSPAMERLIGAFVKPSDPTRLLKAYRRGTPYLQKYKIFELLKLCITSP
FT                   KQDAT"
FT   CDS_pept        complement(140374..140913)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946697"
FT                   /orf_name="Pc20g00620"
FT                   /product="Pc20g00620 protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85391.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831B8B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG09"
FT                   /transl_table=1
FT                   /translation="MTDNNTASCPFCPFTDSDAGFVSQHIEFCHPETGVTGFLEETPQE
FT                   FTAQNPAPLPVDEDGADKYVDCPHGCGETIEIAELSSHLDLHVAEDMALDDIGATSARS
FT                   TPDAHGHEYDETFDDEDPLDMLESYKGGKRGMQRDSTRANTAKPPRPHSPPRTINADGI
FT                   KRLGVFVSYLHFKDKY"
FT   CDS_pept        join(complement(143385..143935),complement(142882..143325),
FT                   complement(142234..142638),complement(141272..142169))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234943" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946698"
FT                   /orf_name="Pc20g00630"
FT                   /product="Pc20g00630 protein"
FT                   /protein_id="CAP85392.1"
FT                   /db_xref="UniParc:UPI0001831B8C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG10"
FT                   /transl_table=1
FT                   /translation="MFHKRQEHDAEETTRKSRSLWIFRSWSWFPNYAKEPEMQQLTVHS
FT                   DPVRKWIKGVVICSWIIGGVLALNIILTVVAAGLAYSGNSGQMFDFASLYMGKCSTSKY
FT                   WTTGLHLLINILSTALLGASNYCMQCLAAPSREQVDEAHSQKTWVRIGVPNIMDLLRYQ
FT                   TGRRRLLGSILLITSLPIHLIYNSAVYFSIGPTEYSIVAAQDKLIQEHGNSTEFEQCFT
FT                   ENVGMDLPSFNAAIRDGRFNTLSKQECIDIFAQDYASGYGTVVLVTKDPMPQNESVALV
FT                   GTGNRHSFEGGFSQFSWLCDEEYPCTKSIAEEDTQDWSVDALTWSRPTIHLTARSYSID
FT                   HCMTLPVEETCQLFFSPLICLVVIGCNLVKLICALLAARENRKDIFLTTGDAIASFLAK
FT                   PDPATEGVCLLSGSLVKKRTQGWRKYKGRERKSLDLLETKQESPLRLPSRKRWFQAASV
FT                   SRWVYTVLLFVCMLVPSVIVLRLGILNYNKASKSKSIWDSGLGEASSGTTLAGLSISAT
FT                   STGIFSMILMANIPQILVSLAYFFYNGLLTCMLGAVEYDNYATKRKPLRVSWPRGAQRS
FT                   TYYLTLPYRYSIPLLIVSAVLHWLVSQSFFFVQVIPFDRHGVPQERYPEVLVTCGYSPV
FT                   AIIFGIIVGGLLPVVAALMGLRRFRSHMPLAGQCSAAISAACHPMTTAVDHALKPVQWG
FT                   EVPGSVLSHSGFLNTITTDIECDARSSVGSDEQRLPLARELDRNDSRAVGFLHCTFTSE
FT                   DVSEPSTSHLYL"
FT   CDS_pept        join(146670..146797,146849..146929,147003..148252,
FT                   148352..148449)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000293094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671392"
FT                   /orf_name="Pc20g00640"
FT                   /product="Pc20g00640 protein"
FT                   /function="amino acid binding"
FT                   /function="aspartate kinase activity"
FT                   /biological_process="cellular amino acid biosynthetic
FT                   process"
FT                   /protein_id="CAP85393.1"
FT                   /db_xref="GO:0004072"
FT                   /db_xref="GO:0008652"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="UniParc:UPI0001831B8D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG11"
FT                   /transl_table=1
FT                   /translation="MATTILDSNLPVTAQAHSSWVVQKFGGTSVGKFARNIIEQVVEPS
FT                   LVNNRVAVVCSARSSSTKAEGTTNRLLRAARDAESPRSRQYLTLVEAVRLEHVQVAQEE
FT                   LKSVEIRDQVIADITGECERVLKFLEAAQTLGEISARCVDKVMSTGEKLSCRLMAALLQ
FT                   DRGVDSQYVDLAEIIDFPIGPHGLDQDFYNTLAAAFGSKVEACGHRVPVMTGYFGTIPG
FT                   GLLDQIGRGYTDLCAALVAVGTRAQELQVWKEVDGIFTADPRKVPTAHLLPAITPAEAA
FT                   ELTFYGSEVIHPFTMEQVIRARIPIRIKNVMNPKNEGTIIFPDSVAELERTTPGHDPRL
FT                   FRTRSPSLANTPKRPTAVTIKHNILVINVHSNKRSLSHGFFAGIFSVLDKWRLSIDLIS
FT                   TSEVHVSLALHSEMPLLNGNGRDEYQVIDDDLQGALNDLKRYGTVDIIPEMAILSLVGK
FT                   QMKNMIGVAGRMFTTLGENSVNIEMISQGASEINISCVIEERDADRALNIIHTSMFTFL
FT                   D"
FT   CDS_pept        150771..152876
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946699"
FT                   /orf_name="Pc20g00650"
FT                   /product="Pc20g00650 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85394.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniParc:UPI0001831B8E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG12"
FT                   /transl_table=1
FT                   /translation="MGSTRSTGAHYSSVLAPSAQEIIRSQPRLQPSPLPLQPIQNPSSH
FT                   PSSGPHRPSPTKGLHPQGSHPRHGKLGFVPISAPTPPMFTTDSPAKKAPFPLYSTTSMP
FT                   HSALFTTFSSINTESSKENHLPEEPSNDNFADFPEPSYESKLPMKRTLMEAAPLKERSN
FT                   KKQKRDDAPVAYLPEPHDMPPVEDDGTKPPYSYATLIGMSILRATNRRLTLAQIYKWIS
FT                   DTFSYYKNSDPGWQNSIRHNLSLNKAFIKQERPKDDPGKGNYWAIEPGMEAQFLKDKQV
FT                   RRATMSSLPLPAAPQRDLIPQSQTASTTTWMVPPQPVYNAPSHHAPTPRPAPNDLSSDA
FT                   TLPASDPALQDDADEVVPVPAPRAAPRSSPPAIRSSPPIAPPRFARQGTPPTPTQSNPT
FT                   PAPRPRKRKSITMNDSGYFSSLESSALRPNKAGHILTSDLDIEPPRIKRGRAEEEIARM
FT                   RSSSHDISPGQPAARKNPNPPIGSSPLRSQYVSMQPPPLTPIIKFKKPARPPPSVSPNT
FT                   NLRNHRRKIQQMVNSPIKHLGLSEDALPWSPAFNLQDEAYTPNDHFHTSFDVFADPGSA
FT                   QISYGSPEKRSVKRPRNDGSNTVLSDITSVNINTRLGVPSLSRSKSAIFPESPSKLPDT
FT                   SRFGDAGQEDFFSFHLFDEGNDSSGEVDGVDLLQGFQKIGGVSKDDTLKPRALHRPQMG
FT                   RTNTTLF"
FT   CDS_pept        join(complement(153929..154100),complement(153729..153859),
FT                   complement(153528..153671))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235066" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824093"
FT                   /orf_name="Pc20g00660"
FT                   /product="Pc20g00660 protein"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85395.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR001748"
FT                   /db_xref="InterPro:IPR018230"
FT                   /db_xref="UniParc:UPI0001831B8F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG13"
FT                   /transl_table=1
FT                   /translation="MPPIRTSRNRKPPPAGFDDIEDTLLEFSNKMKDAENASHEGKKKY
FT                   EVLWPIFQISHQRSRYIYDLYYEKEAISKELYDFLLKNKYADANLIAKWKKQGYEKLCC
FT                   LRCVQTKETNFNSTCICRVPKAQLKEDQTIQCVSCGCNGCGSSD"
FT   CDS_pept        join(154391..154490,154624..154799)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977337"
FT                   /orf_name="Pc20g00670"
FT                   /product="Pc20g00670 protein"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="CAP85396.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI0001831B90"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG14"
FT                   /transl_table=1
FT                   /translation="MEQQLDLTKLSESDKKELNQVLTNEAQKSNIQQTVHHLNEVCWEK
FT                   CITSKITSGTLDKSEEACAQNCVDRWMDTSLSILSKLDSMRGGPGH"
FT   CDS_pept        join(complement(156451..156475),complement(156071..156120),
FT                   complement(155712..155998),complement(155566..155653))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671393"
FT                   /orf_name="Pc20g00680"
FT                   /product="Pc20g00680 protein"
FT                   /function="nucleotide binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85397.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR005633"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniParc:UPI0001831B91"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG15"
FT                   /transl_table=1
FT                   /translation="MAPTDNKTGKNKANAAAKAVAKGASLHKSRKVRTSSTFHRPKTLQ
FT                   LSRSPKYPRVSVNHGPALDFNKIVLYPLNTESAMKKIEENNTLVFIVNVKSNKRQIKQA
FT                   LKKLYDVDTVKINTLIRPDGTKKAFARLTPDVDALDIAATKLAIV"
FT   CDS_pept        156841..157692
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946700"
FT                   /orf_name="Pc20g00690"
FT                   /product="Pc20g00690 protein"
FT                   /protein_id="CAP85398.1"
FT                   /db_xref="InterPro:IPR021867"
FT                   /db_xref="UniParc:UPI0001831B92"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG16"
FT                   /transl_table=1
FT                   /translation="MAPQKRSKRPMLLSHSRPRIVKSKDAALSAKATRTLIRTHHRLLK
FT                   VRAQALAAGDEARVSSIDAQIEANGGLESYQIASKLGQSMDRGGDSSKVLIDWIKPQLK
FT                   QWNKAIPKLRVLEVGALSTKNACSTHPALDVTRIDLNSQEPGILKQDFMERPLPSSDDE
FT                   RFNIISLSLVLNYVPDATGRGEMLKHCVKFLTSKCPIELVPSLFMVLPIACVDNSRYLN
FT                   EERLGEILTCLGFRLAQSKRTSKLVFHLWEHTGTYAPKAFKKEELRSGKTRNNFAVILN
FT                   KK"
FT   CDS_pept        join(complement(159741..159892),complement(158717..159687),
FT                   complement(158538..158666),complement(158388..158485),
FT                   complement(158171..158337),complement(157751..158120))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946701"
FT                   /orf_name="Pc20g00700"
FT                   /product="Pc20g00700 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85399.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI0001831B93"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG17"
FT                   /transl_table=1
FT                   /translation="MSRAERTDEDLDNEPVYGSLRIPAAAPSSYDYGHLNSGSPTAESE
FT                   IGGRQRSSSYSIRVRQAGGPNSIDNFARSWQRAAAFPEILPRRSSFVSAHSDDELAIAT
FT                   GQEYGSRSSPSWGRHSDVERPLLRGDSDSDQDDGDTRAPESSKRALPSTGLLSSSFDRS
FT                   FANSYGTISSRVSESTRRHAIQFHREHHPQVHVDGSGDSDRGPLLIKHVQHEDGTEEDI
FT                   VVGQSTLPQTIFNSVNVLIGIGLLSLPLAMKHAGWVLGLVFLIFSAVATSYTAKILAKC
FT                   LDVDRSVVTYADLAYISFGQHARLITSFLFCLELLGACVALVVLFADSLYALVPGLSIL
FT                   QWKIVCGVVLLPLNFLPLRFLSITSILGIISCTSIVVLICIDGFIKPDAPGSLRQPANT
FT                   FLFPENWATVPLSFGLIMSPWGGHGVFPNIYRDMRHPQKYGKSLWVTYIFTFALDCSMA
FT                   IIGWLMFGDIIRDEVTANILTITDYPQSLSVCIVVFISIIPLTKVPLNARPLVATFEVL
FT                   CGLGGGHVPAENGSKTLQKVSRAMVRVFVVATIVILAIVFPAFDRIMAFLGSFLCFTIC
FT                   IIFPLAFYLKIFGKEIGRGEYILDWVLLIVSSILAAVGTVWAFLPQDMLSAN"
FT   CDS_pept        join(160884..161004,161059..161108,161167..161538,
FT                   161593..162349,162423..162572,162630..162661,1
FT                   62691..162696)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946702"
FT                   /orf_name="Pc20g00710"
FT                   /product="Pc20g00710 protein"
FT                   /function="translation release factor activity, codon
FT                   specific"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85400.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016149"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="UniParc:UPI0001831B94"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG18"
FT                   /transl_table=1
FT                   /translation="MSAPPPNEAEKNIEIWKVKKLIKRLESARGNGTSMISLIIPPKDQ
FT                   ISRAAKMLAEEYGTASNIKSRVNRLSVLSAITSTQQRLKLYNKVPPNGLVVYCGEIITS
FT                   EGKERKINIDFEPFKPINTSLYLCDNKFHTEALSELLEADQKFGFIVMDGNGTLFGTLS
FT                   GNTREILQRLTVDLPKKHGRGGQSALRFSRLREEKRHNYVRKIAELAVQNYITNDKPNV
FT                   AGLVLAGSADFKNDLNQSDLFDGRLQSKVIKVVDVSYGGENGFNQAIELAGETLSNVKF
FT                   VQEKKLIGQYFQEISQDTGRVCYGIEDTLKAMELGAAEILIVHENLEITRWVMKNAAGN
FT                   QVIVHTNKVQESQKDLFQDKETGLDMEVVESGSFLEWLAEAYKDFGANLEFVSDRSGEG
FT                   NQFVKGFGGIGAILRYKVNFEQLADLSDDDEFYDESEDERPEAPAASLLTARPVDHASG
FT                   SRDGTKASVKDNQKRPGPRSLKLLRVSSKLQGTHTEV"
FT   CDS_pept        join(complement(164091..164144),complement(163128..164027))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000018970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946703"
FT                   /orf_name="Pc20g00720"
FT                   /product="Pc20g00720 protein"
FT                   /function="prephenate dehydratase activity"
FT                   /biological_process="L-phenylalanine biosynthetic process "
FT                   /protein_id="CAP85401.1"
FT                   /db_xref="GO:0004664"
FT                   /db_xref="GO:0009094"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="UniParc:UPI0001831B95"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG19"
FT                   /transl_table=1
FT                   /translation="MAPFKVAFLGPLGSFSHQAAAESFCKLSADLQPQVSFPDAFAALQ
FT                   KKEVDYAVIPCENSTNGSVMQTLDLLADRDGSYKDVKVCGEYYLTVHHFLMVRKGTYPG
FT                   GWAEYDGSITKLYTHPQAWGQCEAFLTKYFKGIERQDVTSTSKAAEIVSKETTERGAAI
FT                   ANRFAAEQHGTDVLVENIEDRADNTTRFLIFRNVLDERTSEFKFEQPNPPTLEGELALE
FT                   TTHKTLISFTIDHSSPGALANALLIFKAHGLNLTSINTRPSLKKPWQYIFFVECGRTPS
FT                   DENKEAVHKALNDLRQVTETCRDLGTWKDQLSASNA"
FT   mat_peptide     complement(163131..164018)
FT                   /db_xref="UniProtKB/TrEMBL:B6HG19 "
FT   sig_peptide     join(complement(164091..164144),complement(164019..164027))
FT                   /db_xref="UniProtKB/TrEMBL:B6HG19 "
FT   CDS_pept        join(164406..165090,165156..165532)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171873" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946704"
FT                   /orf_name="Pc20g00730"
FT                   /product="Pc20g00730 protein"
FT                   /protein_id="CAP85402.1"
FT                   /db_xref="UniParc:UPI0001831B96"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC4"
FT                   /transl_table=1
FT                   /translation="MKTNPLRPLISLRGGRHACRTYSSLSERLHYELTTRKLPLTYDYL
FT                   HPQPSHLLNLTLRDLLPQSKNSSGYATLPTLQNPSPLPVGHHLIYFPPQVTLSQLLPDC
FT                   TDTLHTPGEPFNRRLWAGGNLRFPVRSPPLDGSRAVCIESIRNVTVKGREGDEKVTVTI
FT                   ERRIGNVAEQETAEETWERIWKENEDNSGESSVIENRDLIFMRLKTSAQIEADKAQFGK
FT                   PGRTVKPPSGATFRHALIPTKALLFRFSALTFNAHSIHLDKSYTQNQEGYPNLLVHGPL
FT                   TLTLLLSVLQQQLSRLNLCISDIEYKNIAPLFVEQELVICGKPKNDTGAWDVWIEGPDG
FT                   GLAVRGTARTRLE"
FT   CDS_pept        join(165868..165902,165957..166135,166194..166279,
FT                   166655..166697,166751..167178)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824094"
FT                   /orf_name="Pc20g00740"
FT                   /product="Pc20g00740 protein"
FT                   /protein_id="CAP85403.1"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniParc:UPI0001831B97"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC5"
FT                   /transl_table=1
FT                   /translation="MDVFWAAPPVTRTLTALTLVQSALMYGGLLSFYWAPFLPSLIFSW
FT                   RPQIYRLVTPFLLTGPKLGFFFDLYIMYRYGSAAEKSMAPGEFLIYLLFVAFSIMLTAG
FT                   GYLGAAILLPPLTMAFVYTFSQTNRGTKTRFWFIDIPVVFLPYAMLLVTMVSNGWDAAL
FT                   VESTGILAAHTYDFLTRIYPTFGGGRNFITVPGFLERYFTEHDPNSGYRGYGTASRAPR
FT                   PAGQPSSASASGSTWGSWTSSSSWNGRGAGRRLG"
FT   sig_peptide     join(165868..165902,165957..166053)
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC5 "
FT   mat_peptide     join(166054..166135,166194..166279,166655..166697,
FT                   166751..167175)
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC5 "
FT   ncRNA           166354..166552
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR43"
FT                   /db_xref="Rfam:RF01256"
FT   CDS_pept        join(167606..167714,167770..167926,167994..168625,
FT                   168685..168911,168965..169261)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231224" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946705"
FT                   /orf_name="Pc20g00750"
FT                   /product="Pc20g00750 protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="RNA processing"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="CAP85404.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI0001831B98"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC6"
FT                   /transl_table=1
FT                   /translation="MAVVKTSEMDYAIKPEASVPSVDTSDWPLLLKNYEKLLVRTGHFT
FT                   PIPAGSSPLSRDLKSYISSGVINLDKPSNPSSHEVVAWMKRILRSEKTGHSGTLDPKVT
FT                   GCLIVCIDRATRLVKSQQGAGKEYVCVIRLHDKIPGGEAQFVRALETLTGALFQRPPLI
FT                   SAVKRQLRIRTIHESKNYEFDNERHLGVFWVSCEAGTYIRTLCVHLGLLLGVGAHMQEL
FT                   RRVRSGAMGEGEGMVTLHDVMDAQWVYDNNRDESYLRKVISPLESLLTGYKRIVVKDSA
FT                   VNAVCYGAKLMIPGLLRYEAGIECHEEVVLMTTKGEAIAIGIAQMSTVELTTCDHGVVA
FT                   KVKRCIMERDLYPRRWGLGPTALEKKKMKTAGTLDKYGRPNDATPAQWKSEYKDFNLPI
FT                   TGTAAVAPSAETKTETEAPKVESPEPVKEEVEDKKRKRDGETAEEKAERKKKKKEKKEK
FT                   KERRKSKQDDSDDSD"
FT   CDS_pept        join(169815..169868,169927..170466,170524..170718,
FT                   170771..171202)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000241232" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977338"
FT                   /orf_name="Pc20g00760"
FT                   /product="Pc20g00760 protein"
FT                   /protein_id="CAP85405.1"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="UniParc:UPI0001831B99"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC7"
FT                   /transl_table=1
FT                   /translation="MAAELTSTKLNPESHIILDQPLLRLPHELARRNFKTVQRAVEREK
FT                   EYIIPAIKETAAASLSNTQTPDQTLAALDAMISRMQGLKRKMESLQEEEKKIHNQSRKR
FT                   IQHLETLHKIPSLADVKYDQWSRVRLDRLLVDHMLRSGYSESAKQLAQDRGVEELVDLG
FT                   VFTQCQRVVDSLRRGETKEALQWCGENKAALKKSQHNLEFELRLQQYIEMVRTQDKSKK
FT                   IEAIIHAKKYLIPNHQSQNSEIMRAAGLLVFTQDTRAEPYKSLFALDRWRVLAQLFIQT
FT                   HHELLSLPSQPLLHIALSAGLSALKTPLCHSAYTSSSSNSQSTSTSVCPICSTELNELA
FT                   RKMPYAHHSKSYVESDPIVLPNGRVYGKQRLMEISRKMGSVGPGKVKDPTTGEVFHESE
FT                   MKKVYIM"
FT   CDS_pept        join(complement(172515..172740),complement(171294..172264))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171895" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946706"
FT                   /orf_name="Pc20g00770"
FT                   /product="Pc20g00770 protein"
FT                   /protein_id="CAP85406.1"
FT                   /db_xref="InterPro:IPR019446"
FT                   /db_xref="UniParc:UPI0001831C6E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC8"
FT                   /transl_table=1
FT                   /translation="MPRNNKKVKNAPPPRPRGPSKPAGLSSYPAKGQQHGNGQKQGNSN
FT                   ANVPKKASMQANQRPIVPFLRKDRILLIGEGDFSFGRSLAKQYKCRNLCATCYDSKEAL
FT                   YDKYPQAPQNVSDILSASAKPKPASDETEKQPEENKSEDQDSTNPSQQTPKVVFSVDAR
FT                   KLGAPTGGGKEIRTGFARRERKRPAWYQQNEPAGPPYQPGGPWDVICFNFPHVGGLSTD
FT                   VNRQVRANQELLVAFFKACVPLVSKPPPLMDAEDDEWVYADGEESDEEDEDEDEEGGEG
FT                   EELGKDDDTTGKGFRTGPGQILVTLFEGEPYTLWNIKDLARHAGLVVVTSFRFPWTSYE
FT                   GYSHARTAGHIEGKDGERGGWRGEDREARMYVFEVKQKEPAKKGGKKRSRDDDSSDSE"
FT   CDS_pept        join(complement(173782..174306),complement(173521..173725),
FT                   complement(173058..173254))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977339"
FT                   /orf_name="Pc20g00780"
FT                   /product="Pc20g00780 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85407.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831C6F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC9"
FT                   /transl_table=1
FT                   /translation="MFTCTPCNRRYNDQASLDYHLLFSPCHAHKCGSCSKYFTSEADLI
FT                   AHAAEARHHAFECKPCGQIFKSGNLLRVHRESNLHRRMINSPLNTFFRSWPNFPFHVQL
FT                   PPHKSWEQLHMFYGWDDQTPEYRAAWIRYQDALASEVTIWFGDVLELDSWQKLCRAVGI
FT                   APLPGTCADGYMAIRNLYVNLIDLIQWARTGKADGEVQRWKNNVDLFEYSIATKRIFER
FT                   DMTTNDKPNVVLRHLANCMLPRRELILPGAALLLVSWLISTTYVWLSPFLLGYSKGRGI
FT                   LVFFWNALLVVAFSFLPLCLEHQLRPS"
FT   CDS_pept        join(complement(176076..176318),complement(175935..176022),
FT                   complement(175504..175875),complement(175014..175447))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000031183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977340"
FT                   /orf_name="Pc20g00790"
FT                   /product="Pc20g00790 protein"
FT                   /function="nucleotide-sugar transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85408.1"
FT                   /db_xref="GO:0005338"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004689"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI0001831C70"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD0"
FT                   /transl_table=1
FT                   /translation="MAEDKKSDDYTVDMNKVDQGNKEFEAAPPPTPSPRASSTVSNNPA
FT                   FPVLAYCGSSIMMTVMNKYVLSGLDFNLNFLLLCVQSLVCIAAIQTCKSMGLITFRDFN
FT                   TDEARKWFPITLLLIGMIYTGSKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGSVTNL
FT                   TLFSFGLMVFSSLIAAWADIKHAVESTGDTSSKVSTLNAGYVWMLINCLCTSSYVLGMR
FT                   KRIKLTNFKDFDTMFYNNLLSIPVLIVLTLLVEDWSSANLARNFPEANRDGIFFAMVLS
FT                   GASSVFISYTSAWCVRTTSSTTYSMVGALNKLPIALSGLIFFDAPVTFPSVSAIAIGFV
FT                   SGIVYAVAKIKQNSKPRTGVLPTPVSASSQSMRDSLRS"
FT   CDS_pept        177119..177811
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171916" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977341"
FT                   /orf_name="Pc20g00800"
FT                   /product="Pc20g00800 protein"
FT                   /protein_id="CAP85409.1"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0001831C71"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD1"
FT                   /transl_table=1
FT                   /translation="MPDSDDDALFAALENEDDTHYRDQRIHQLNAELAATKNNHSARAT
FT                   SGNTGLIQNEVYPTLSTDQSVLDFTTRTSRCLVHFAHPDFLRCAVMDMKLGELANAHYE
FT                   VSFARVDVRNTPFIAQKLGIKVLPCVIGFKDGVGVDRVVGFEGLEARGFDGVEGFDVKV
FT                   LEKRLVFKGILLAVKIGAGDDDDVREEEESDDGAGGRGFGRKKGRRGIRGSNPNVRNRG
FT                   DDDDDDWD"
FT   CDS_pept        join(complement(180070..180080),complement(178423..180007))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171917" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977342"
FT                   /orf_name="Pc20g00810"
FT                   /product="Pc20g00810 protein"
FT                   /biological_process="cell wall biogenesis"
FT                   /protein_id="CAP85410.1"
FT                   /db_xref="GO:0042546"
FT                   /db_xref="InterPro:IPR009203"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniParc:UPI0001831C72"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD2"
FT                   /transl_table=1
FT                   /translation="MANMLTSTWRSFWHTMTSYDRHASHDSPYRTGRHVPLSQSRHEPL
FT                   TSVATSAIESRPDLSNPYDDEPTKGSASAQASEWNGSPDGLGSPTQPYSPGMRSVASQK
FT                   RRSNDQGEGAPEIQMQSFHDGAPPPPPVAHSWRKIERWLEHNYEELHDQLGEGCTQNDI
FT                   NELEHELDCSLPLEVRESLMVHDGQERGGLPTGVIFSAMLLDCEEIVQEWRNWKKVNDE
FT                   YLSNATVMQNPPASSSAASSSAAGPSQQASTLWQSDLLDRQDSQPPGAVQKSYAHPAWI
FT                   PLARDWGGNNLAIDLAPGPAGKWGQVIIFGRDYDCKYVVARSWAGFLATLADDLCSGHV
FT                   IVDEETNELKLKQFKAQNVEPPYLEILRWRADQKYGRRVPRRKGPVPNGLGVNAAGNRS
FT                   SSRESPYGSPTRAEERGRSPHRFSKGGNAQSPKTPFGVSSPLARVTEETTSPVVTAGPT
FT                   ISEDAKENGKEPQTEDLMEVVTPQISNKENEGFSKPNELKESDKAEKSEKTDSVESSTA
FT                   IESEVLGEMKNVAI"
FT   CDS_pept        join(complement(182958..183035),complement(182088..182902))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        183895..184422
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824095"
FT                   /orf_name="Pc20g00830"
FT                   /product="Pc20g00830 protein"
FT                   /protein_id="CAP85412.1"
FT                   /db_xref="UniParc:UPI0001831C73"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD3"
FT                   /transl_table=1
FT                   /translation="MNLNGLSWPTKHLHASTRNGSTWGYVIYRTTYTPHSNAAFLRIIE
FT                   LLNSYMKQGLYSECVSSENNTSMDTDLTTYHEIWAQHRPIVMNHPRFDGASIDSIRAHF
FT                   RCWVGQQEDQGYCTQYRMCMVIDEESLQTLLDAPPPQESSDEKIIDPMRHVKVVTLLPD
FT                   SDDDEFDSFLGG"
FT   CDS_pept        complement(186091..187497)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171930" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128435"
FT                   /orf_name="Pc20g00840"
FT                   /product="Pc20g00840 protein"
FT                   /protein_id="CAP85413.1"
FT                   /db_xref="UniParc:UPI0001831C74"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD4"
FT                   /transl_table=1
FT                   /translation="MSTQSPHSPTPKGSRNNRRPQKKNTTPHAQKPALLSTPPSSPPRN
FT                   MSSGAIQVDPSNNFNSSKKKPMRSGKKSRDNKASPAPHSGYHSNGYNSGPRHTPSRPAV
FT                   TSPQTKPSPAYAGPTFHASPAPSALPIPSFFSKSAPDANLVPPMETDSDDADVDPELEM
FT                   TPSKPRNRNNQSKGEEPKPSPLDFLFKAAVQARDQKSTSSPEVNKVLQSPQTEPRVVRP
FT                   NADGMFTFEMGNSDYNRNSNIGPSFAPSYQDRMNALRPSSTPQSPDMTEEERRTKTEEL
FT                   KHLLLNPPPQKPPSSAYASPEYAGPFGSRPSNVPPYATPMRTSSGPQLTASHGSFSSPQ
FT                   LQQQQISQNNGRRHYQYPTHSHSPLRREVDMVPPPSMPPYRGPVSNNTSNGGSPAPYGN
FT                   PYMTMSQQQQQQQQSGYASPHPDYAPSSFQIPVNSPSPSRVVDTAQIENDIRRVLKLDA
FT                   SGPPVTQSSA"
FT   CDS_pept        join(188262..188366,188422..188500,188562..188632,
FT                   188698..188796)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977343"
FT                   /orf_name="Pc20g00850"
FT                   /product="Pc20g00850 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP85414.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001831C75"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD5"
FT                   /transl_table=1
FT                   /translation="MTDVEMKEAATGSSKGKAVAKGSDNADKKKFEVKKWNAVALWAWD
FT                   IVVDNCAICRNHIMDLCIECQANQGSSTTEECTVAWGICNHAFHFHCISRWLKTRQVCP
FT                   LDNRDWEFQKYGR"
FT   CDS_pept        join(complement(189470..189517),complement(189331..189390),
FT                   complement(189072..189269))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171962" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128436"
FT                   /orf_name="Pc20g00860"
FT                   /product="Pc20g00860 protein"
FT                   /function="peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="signal peptidase complex"
FT                   /protein_id="CAP85415.1"
FT                   /db_xref="GO:0005787"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR009542"
FT                   /db_xref="UniParc:UPI0001831C76"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD6"
FT                   /transl_table=1
FT                   /translation="MDELLAPIQDVIEGQIDFHGQRLAELLSTVLLVISGAASFVIGYI
FT                   YQDIHLTLWTGLAGTLFTAFVVVPPWPVYNRNPEKWLGSTSANAAPGITVDGVKVQ"
FT   CDS_pept        join(complement(190997..191414),complement(190588..190886),
FT                   complement(190187..190531))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000247199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977344"
FT                   /orf_name="Pc20g00870"
FT                   /product="Pc20g00870 protein"
FT                   /function="ATP binding"
FT                   /function="homoserine kinase activity"
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85416.1"
FT                   /db_xref="GO:0004413"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001831C77"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD7"
FT                   /transl_table=1
FT                   /translation="MSSFVIKIPCSSANIGPGFDVIGLALSLHLDLHVTIEAKPSSQEP
FT                   FNCAITYEDQSKSVEQISLDPEVNLITRVALYVLRCHDQRAFPVETKVHIVNPIPLGRG
FT                   LGSSGTAVVAGVMLGNEVGKLGLSKERLLDYCLMIERHPDNVAASLFGGFVGTYLNELK
FT                   PEDVARKEIPLSEVLPAPAGGVDTGIRPPEPPMAIGHYRKFNWAPEIKAIAIIPDFVVP
FT                   TANARNVLPQSYSREDVVFNLQRAALLPAALGSSPPDPDMIFLAMQDKVHQPYRKTLIP
FT                   GLTEILQFMTPATQPGLLGICLSGAGPTILALATERFTEIADRIIAQFASNGISCQWKL
FT                   LEPAHDGATVAYN"
FT   CDS_pept        192852..194792
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171963" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946707"
FT                   /orf_name="Pc20g00880"
FT                   /product="Pc20g00880 protein"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85417.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI0001831C78"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD8"
FT                   /transl_table=1
FT                   /translation="MSESPRSERYMYLTRYSTPVPELDDHRLQMQTPPRIEVPVERSYS
FT                   PHDTTQGPEILDRPDLLSAQDARRDGPIPRDFEKVDDNRSLNELNGLGRRFSVDHNATY
FT                   QTPRRISIVNPDLANASAASSVSARSSSPPNSVEAFADPRRRERANTLDSHAPPDLEAI
FT                   LQRTVSGGTHNRRPTFSNASAIHPQLGDVPFDTAEEACFEEPGRIPVIDYEELEEFVAL
FT                   NPSIKVADADRRKYSMSSQSKRPRIFYDLRPGAESPEIGAIKKNGSSDTLSEDEKKNAA
FT                   VTDEKERFKTRQNVNQRSRFGFFSSESQSTVHAADLGDLVLPGETFRDLFELGPEGGVW
FT                   WLDVANPTDEELGAISRAFSIHPLTTEDIQTQEAREKVELFKQYYFVCFRTFFQTDKTS
FT                   EEFLEPVNFYMVVFRDGVLTFSFEDNPHAANVRKRIGKLRDYVALSSDWICYAMIDDIV
FT                   DSFGPVIRDVELESEAIEDHVFIARVDDFESFLPRIGGLRKKVMSLMRLLGGKADVIRG
FT                   FSKRCNEQYSVTPRGDIGLYLGDIQDHVVTMMSNLAHFEKMLSRSHTNYLAQLNVTNLV
FT                   LGNHVNKVLSKVTLIATILVPMNLITGLFGMNVEVPGQHTDGLNWWFGILGVIAGIVVV
FT                   SFGLARWQKLV"
FT   CDS_pept        join(195772..196993,197047..197711)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946708"
FT                   /orf_name="Pc20g00890"
FT                   /product="Pc20g00890 protein"
FT                   /protein_id="CAP85418.1"
FT                   /db_xref="UniParc:UPI0001831C79"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD9"
FT                   /transl_table=1
FT                   /translation="MRRHYNALQCYITATISAIFLLFALTCDSVAYAYSDAPNGPDTES
FT                   TLNLRGVVTSDGAGLPFALDSFNGLELRESVEEDGESNGLELVRRNPNAAKALGNNQFE
FT                   APDLEIGAVHWFYLPKTVVNGKHDPKGAGLPAYMNATEGDNDANDSASELRKRDEDFSK
FT                   RALTTVYLSLTTCKKPHTNKTDSQGGFPQLQVYVSNSEKLQQPGPGKDDSQQDIHTAVG
FT                   GYVGITIDTDSDVFIGVAAPNSTDYTGSYTYQIAASIDDFFHNIVDNDPNLFFVDADVS
FT                   AALLVTNNLTQSAENSTNYQQWMNIVPPYTMFAHNINDTALQGLEKSFCALDTLSQVGR
FT                   ISNSTEVGMTNRGLGNKPKEQFYVTGLNRSSSYSGLLAMVGNSTASGNGIVGGGGKVWQ
FT                   PMNFTTKADDNCAVLFNLTFCSEVAYAVPSNPKISVDKLRTIYDDHAAAFYQNFTYSLQ
FT                   QVQCKTNEESMFSLAVNCSDCERSYKQWLCSVTIPRCADYSSNATYLAVRNAGQPFING
FT                   SSLPDDSPYRQSVASNTSRNSIIDEKIKPGPYKEVLPCQDICHTLVKDCPSALGFGCPE
FT                   GAWMNASYGYRNLDGIITCSYLGAVYYLSLGTRLGAWHWVFSLVVMGVMYLL"
FT   CDS_pept        complement(197868..198476)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671394"
FT                   /orf_name="Pc20g00900"
FT                   /product="Pc20g00900 protein"
FT                   /protein_id="CAP85419.1"
FT                   /db_xref="InterPro:IPR019180"
FT                   /db_xref="UniParc:UPI0001831C7A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE0"
FT                   /transl_table=1
FT                   /translation="MSIETSESETASLATPIKTPAAEEEEEKEKDTCRPSIYSPANLLS
FT                   SLLSPFSFSSTSPESTTTTSPNNDKDKEKEKTKSPSKISIETPTSASTQSTPEPYYTPE
FT                   ETPLFKTLYKTRLTKTRTKQLLRAGERGYDDPPPPPGLGDCCGSSCDPCVRDLWKQEIG
FT                   IWRERWGDRGVEDGVGVSTDEKKSEKKEEKLAKRKDLEW"
FT   CDS_pept        complement(199003..200487)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171985" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946709"
FT                   /orf_name="Pc20g00910"
FT                   /product="Pc20g00910 protein"
FT                   /protein_id="CAP85420.1"
FT                   /db_xref="InterPro:IPR019148"
FT                   /db_xref="UniParc:UPI0001831C7B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE1"
FT                   /transl_table=1
FT                   /translation="MASSSSQELVKQSAGQLMPPPPPPKRIKRPATVLDEDVYTNTLSH
FT                   IIARDFFPGLLETQIKQEYLEALESKDKSWIASSKKKLADVMRTPTPGSNARRKSDYAS
FT                   VPSTPQHFPAGRAGDTPHGWGGDTPMSVISTSTSATETQDRNIPDVSNMGLVAFQAKYT
FT                   SEDNESFNKVLDKQNEKRREKYPWLWSGNKVPSARQIAHHQQEIKRITAQGGKPEMGLI
FT                   KRDEHVQSAIKTDLDARPAKPNSWKSRPDNTLMFLPSSVEDTHETLAQKAEITSRAGPK
FT                   RTLYQNTRLLDPHAAAAADAANAVPPSPSLSAIQDAIAGRPHLSESEAASAFAGSETPR
FT                   VNGYAFVDEDEPEPEFTYGSSSKTDDDMEADWRLLGPTSEKPNPFQLGETRKREALHHR
FT                   MVDRVARNKRAEKAARVTKTPVSLTPRFASSPRLDFGSASTPGAGSSRGSVYAGGHQGK
FT                   MLTPAAQKLLQQVGTPRPRERKSGLGNAWTPTPKRK"
FT   CDS_pept        201091..202338
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128437"
FT                   /orf_name="Pc20g00920"
FT                   /product="Pc20g00920 protein"
FT                   /protein_id="CAP85421.1"
FT                   /db_xref="UniParc:UPI0001831C7C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE2"
FT                   /transl_table=1
FT                   /translation="MLVSMKRNPPSIRQAPKAIPIKSSSWVGDIHQYLKSTFVTYPILK
FT                   ALGLDLLDAFPVELVLSIADFLPLEDIYCLSLCNSRLLAIFRSWKKREYLDRKARLSFL
FT                   HRLERDHPRYLTCDDCLILHDLDSISEPLELSYSTKTYPPRIDCPALRPGYSTCGRSWI
FT                   NLHNDSSVQHTYALHFSHLQLAMRRFYSDSQYGISTDALSFTEVTNEFVEGDRVLKPTT
FT                   LFSVEAQICPEAPSLYLRIQDVVSMKDMRLLGDDKYYEEVEKEYFAALPICKHQQKTMG
FT                   IQSIPRDVLTHECSNCSDCNTDWEIELFENRPSGHVTMVMTRYIDLGPGLSLDDPRWSV
FT                   HAWTEWEESVCKLDSKYMISSPRHTFEALTDTSLEDLTSRNLSYLENERYQTVMVPGPR
FT                   SWSHSWVLWNGAAVHS"
FT   CDS_pept        join(complement(205095..205557),complement(203251..205028))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171996" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128438"
FT                   /orf_name="Pc20g00930"
FT                   /product="Pc20g00930 protein"
FT                   /protein_id="CAP85422.1"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="UniParc:UPI0001831C7D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE3"
FT                   /transl_table=1
FT                   /translation="MSTFPPPMAKPWDNDDGSDRPSTNSSNEHPEHAAHIRSRSTAHAH
FT                   SPKRLSVFSGRSRSNTTTSTSSRRSPGSSMTSTDSSIASDERAGSSLGLRSDKQDKPSR
FT                   SFLARGSRILRRQGSKINIVATLDEEDEADREKARPEREMFGRRARHADHSERLKSIIS
FT                   DPFDFHHLTHTNPSQFQSLDQTRENDLVTEFSAIRASQRPQTDLKGIRAEDIHFRNFSS
FT                   DDLGSLGTATTVDVPSISPPASPKTRQYPAHHARRESRVNENFSRPVSRYPRSCPTTPP
FT                   PPAVPETPPPETDEPAPRAIDEILGLSTAMTYPDLQSVQPTRFFSPEPADNSARTSSMS
FT                   SHYDLEDVPEEEEGTRYWESPESSMGCPHSRTTSQASQPPANAQSPSTSERKAPMSIYV
FT                   AEELSRKFSEAMGSPTLPQPPHDKDTPRAQVEVTPPEPIASLHQFSYEDELYDSWDADI
FT                   DYCYEHAAESTSNFDWSRTSLDEARPQIGVACSDGPWLAPKTRQLQPSPLSTSALATPD
FT                   LDPSPAQSMPSQLAPTPSTTDYEQDFIARGADYFHPVSSSILPSMGKQISHEPLYEEYM
FT                   TTDGESDRHFPFAQGMMGPISPRSSFSPISKCNSQESLMLSRAASIVRKHRSSVSTTNS
FT                   VPELVHSLSSSRELMPTDRMTAVEALTRPASSSHHRQTKSLAEAHFRQSGSSTSLEGPD
FT                   LTVSVHDRAKSISEVESQPTKFEAPLPPVPVRNPNRRKARSPSYSLFPTTAH"
FT   CDS_pept        join(complement(209539..209880),complement(208904..209040),
FT                   complement(208344..208647))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946710"
FT                   /orf_name="Pc20g00940"
FT                   /product="Putative uncharacterized protein Pc20g00940 "
FT                   /protein_id="CAP85423.1"
FT                   /db_xref="UniParc:UPI0001831D4F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGQ8"
FT                   /transl_table=1
FT                   /translation="MRYALIAPVLLAATALAVPVPNQGDVSVANRDVGDGIDAAADANV
FT                   SGDASVNVKRDGGDGIDADAELSGDVSADVKRDGGNDIDADAELSGDVSADVKRDGGDG
FT                   IDADVDADADYTKEERELTISNSLPFVCLLFGSFRRAQTRKSHVSQICLQNERSPLLIH
FT                   SPQDSSNGRIHMYFTQIGDRWIVAQAKRIARYATLNYNLRSPSSGRDTVAIDFEGTEYG
FT                   VARNITTGVGDQLLVSGELDLSILGKHEEERVRDRRTM"
FT   mat_peptide     join(complement(209539..209829),complement(208904..209040),
FT                   complement(208347..208647))
FT                   /db_xref="UniProtKB/TrEMBL:B6HGQ8 "
FT   sig_peptide     complement(209830..209880)
FT                   /db_xref="UniProtKB/TrEMBL:B6HGQ8 "
FT   CDS_pept        210768..211541
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128439"
FT                   /orf_name="Pc20g00950"
FT                   /product="Pc20g00950 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85424.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831D50"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGQ9"
FT                   /transl_table=1
FT                   /translation="MEICEKAEAFVDQDDDIVFDHTRLILRRDNEYFYARTDWRILDLH
FT                   PSAADISQLELNKIPMENVWPPMDPRFTPAPDPLPPNCYVKQPSLLYYSDTPASLEPAR
FT                   QVLAEVEACEVLQQHPHPNIAQYFGCVTMDGKITGLCFHKYPITLSQKLKEATPFDKAF
FT                   CLEGIESGVRHMHSLGLIHNDLNPRNIMMDGERPVIIDFDSCKREGDELGLKAGTSGWE
FT                   LEGIIYAKPENDYFGLSKIREIMIGGEDGKPEEQS"
FT   CDS_pept        join(complement(215671..216525),complement(212858..215596))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172007" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946711"
FT                   /orf_name="Pc20g00960"
FT                   /product="Pc20g00960 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85425.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001831D51"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR0"
FT                   /transl_table=1
FT                   /translation="MAPLENGQTNGLNGDAVPPASPLNNLRFSDIPDAIDIPASSFDSE
FT                   VEVSLLELPDDPTELCTLLENEKAAKNFWVIIALAYAKRKQIDHAIDILTKGLASVAHG
FT                   ATKEKLGLLGWICWMLLLKSRHAPRVAPEGELYSEAKTKDHYLQLATSTLNEASRLNPA
FT                   YPPLFLARGVLCLLRASLYPPRAVRPGAVDTSERVESLRQALKCFDESSKAFGGRNIMA
FT                   ILGRARAHYMLGRYADALEGYQKALIKMPNLTDPDPRIGLGCCLWQLGFKDQAKVAWER
FT                   SLSLNPESKVANVLLAVYYLHDSSRRATTDPMFGSMYKLAMTQYTQKAFKLDKEYPMTC
FT                   SMFASYFLLRKQYPTVETLARKAIEHTDVMSIASDGWYLLGRKSHYEGDNARAAEFYNR
FT                   SDQARGGVDKGYLPAKFGAVQMQITNKDFDGAKFRLEKIVQQSKNPEAMTLLAAIHAEE
FT                   VFAAQKSGSKEDKSTETKRAITLLESVRSMWKDEKQNISPDESVLVYLSRLYEGTAPDK
FT                   SMQCLTQLEQIQIAEIPEDARPDIEDQEKMNAALRESLPPQLLNNMGCFLYQNDKIALA
FT                   RGLFQSALNACVQSKEKEDGTDTDALVTTISYNLGRTYEAADMWDEAKKVYEGLLERHS
FT                   DYTEANARLTYIALRQSPTDEGPKKIGKLYEAESTNLEVRSLYGWYLSKAKKRVANLAE
FT                   DSEQRHFKHTLQYYDKHDRYALTGMGNVHLLAARDMRRDTDQEKEKRRKIYQRAVEFFD
FT                   KALQLDPKNAYAAQGIAIALVDDKKDHSSAVQILSKIRDTIKDPSVYLNLGHVFAELRQ
FT                   FSRSIEHYETALSKDRQRDVQILACLGRVWWLRGKQEANLAAMKTALDYATRARDIAPD
FT                   QLHLQFNVAFVQNQIASLAYGLQPTQKTLQDVQEAAEGLKEAIETFERLSKEKNPPYPS
FT                   AALEQRANMGRTISKQLDRAMQSQKEYEEKNAAKLQQAREAREAAARVREEELRKAQEV
FT                   EMERKKRIAEERAQMVEEVQRHALQRAEEERAREEAELTHDSETGDRVKRKKKPASKRK
FT                   KKGGDDFIADEGEGEAAHSAAESEGEAPKKRRRLGRRSGGKAQVDKPEKPGKYKSSEMV
FT                   VDSDDEEAARSAGEDKDDMFGDDEEPAEEAAPRRRGKASRRIADEDEDEDEDEEVQQEV
FT                   QAEKSVHEDDKDDDLFGEEPSKTTEDTEMQE"
FT   CDS_pept        join(complement(217379..218238),complement(216925..217312))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172018" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946712"
FT                   /orf_name="Pc20g00970"
FT                   /product="Pc20g00970 protein"
FT                   /function="acyltransferase activity"
FT                   /protein_id="CAP85426.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniParc:UPI0001831D52"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR1"
FT                   /transl_table=1
FT                   /translation="MEPTEVRQRKPPTTKDAGELQKLSTKPPSEPRLKHGIPMQILRSL
FT                   LLITWADCCIMAICVTQLIGCPLYLINRYYYYSYMAYTKQCFGLVLGSVTQWSSPTLFR
FT                   VSGDASVRGQIHLSKDGLLETRFPERLVMISNHQVYTDWVYLWWVAYTNQMHGRIFIIL
FT                   KESLKYIPIVGTGMMFYGFIFMARKWMSDKPRLQHRLDKLKTAYTGSNSARPQYDPMWL
FT                   LIFPEGTNLSINTKRRSDIWGEKQGLPSFKHVILPRSTGLFFCLQQLRGTVDWVYDCTM
FT                   AYEGPPKGSYPDKYFTLRSTYLQGRPPTSVNMHWRRFQVSKIPLDDQKEFEEWMTARWA
FT                   EKDQLMDQYFETGRFPTELAGSIKADHAVDGQQAAALAGYVESYGSLHHWSELGLIFVV
FT                   LVSVAVLCKFVTSWMQ"
FT   CDS_pept        join(218842..218968,219037..219151,219209..220259)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172029" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946713"
FT                   /orf_name="Pc20g00980"
FT                   /product="Pc20g00980 protein"
FT                   /function="NAD+ kinase activity"
FT                   /function="metal ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85427.1"
FT                   /db_xref="GO:0003951"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniParc:UPI0001831D53"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR2"
FT                   /transl_table=1
FT                   /translation="MLRAILRRSPRLALRQHFSTSRPRHEIKDIGSLSQRLIPKYQESC
FT                   DGELLCLQWPAPPRNIFLVRKDCAPAVTDSLIEFVNHVSSAYPSIAVILESKTAAEVHS
FT                   SLSFPVYSVSLDEKTTALHDKVDLTVTLGGDGTILHAASVFATCSNVPPVLSFSMGTLG
FT                   FLSEWKFSEFKRAFREVYMSGAGAGDRTHVLEGVPGAGLTEQESEMGPTGWSSVRGKSM
FT                   GSTRGARILMRNRLKVGLFAADGTETTPIRTKTDQGQGVYVMNELLIHRGKEPHLAVVD
FT                   VFVGGRFLTEAVADGIIISTPTGSTAYSLSSGGSIVHPLVPSILLTPICARSLSFRPLV
FT                   LPSSTPITLRLSEKNRGRELEVSLDGVHLGQGMAVGMEVRVWNEEMRHGKNEWQGGVPS
FT                   VMRRSVGCEAHEGWVGGLNGLLKFNHPFGEL"
FT   CDS_pept        join(220869..220885,220946..222959,223018..223527)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234202" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946714"
FT                   /orf_name="Pc20g00990"
FT                   /product="Pc20g00990 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85428.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831D54"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR3"
FT                   /transl_table=1
FT                   /translation="MTSYGNNMYSSEQFMNPGPAPRPPTDRPPKLTLPTNNTATSFGQM
FT                   SLDSPSTPAPSTANLSLFPNTSSPSLAMTRSNTGQNGISIIKEGTVRCKEDKFLATWNT
FT                   RYLILREYKLEFLKSDSGKVVITFPLSSVTAVARSEDSKMAFEVTRLANPKDANSKASL
FT                   LARDLPTKTITCEVKSDDEIYEWIDKIYERCPGMGGVSNPTNFSHRVHVGFDPNTGAFV
FT                   GLPPEWEKLLTSSAITKEDYKNNPQAVIEVLEFYSDIKMREQNPQYYAGINSPSNGQPK
FT                   AYGSSVGSSIAPPRPPPPGPMQRLDSSQSKSDGSMRSASSSVGQSDRAADHQQQVERMK
FT                   EMADQERRRVEEERRNKEEQDAYNASIPKSRPNMAQQELGGYGGDEASQNSRYQPSRPA
FT                   PQAPGSAARQQDPRQLTAQRPAPAPPSQSPYGQNAPRAPGAPRTDDRQGSPSSRYPPSD
FT                   PRAPGSASRHQQNGSKGQAGPPPTRLPAPVQAVKPLNIANKQNGNKQNVPDGVRQAEAA
FT                   LTKKADQPRQKEVRMSAMSENEVMERLRSVVSKDNPNESYSKQRKIGQGASGSVYVARV
FT                   KESAPSSVAHELYRTYGPRCQVAIKQMDLRSQPRKELIVNEIIVMKDSQHPNIVNFLDS
FT                   FLQESSNELWVVMEFMEGGALTDVIDNNQVITEGQIATICAETCKGLAHLHNQSIIHRD
FT                   IKSDNVLLDRVGHVKITDFGFCAKLTETKNKRATMVGTPYWMAPEVVKQKEYGPKVDCW
FT                   SLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKKPEKLSKELKSFLSVCLCVNVQ
FT                   SRASADELLAHEFLQTGCSLASLAELLRWKKATG"
FT   CDS_pept        join(224159..224229,224374..224644)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977345"
FT                   /orf_name="Pc20g01000"
FT                   /product="Pc20g01000 protein"
FT                   /function="poly(ADP-ribose) glycohydrolase activity "
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85429.1"
FT                   /db_xref="GO:0004649"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR007724"
FT                   /db_xref="UniParc:UPI0001831D55"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR4"
FT                   /transl_table=1
FT                   /translation="MADGPPWTKYCMTDQGQRLTGATGNTRKPYSFVTTGLWGCGAFGG
FT                   NRQVKAIIQWYAASLANVLELRYVLGGEEQKVFRDVFDVLVRLGTDLQNGKAAVPKPDE
FT                   IFEYVLQSL"
FT   CDS_pept        join(complement(227954..229540),complement(227526..227884),
FT                   complement(227166..227346),complement(225175..227052))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128440"
FT                   /orf_name="Pc20g01010"
FT                   /product="Pc20g01010 protein"
FT                   /function="ATP binding"
FT                   /function="glycine-tRNA ligase activity"
FT                   /biological_process="glycyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85430.1"
FT                   /db_xref="GO:0004820"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006426"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniParc:UPI0001831D56"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR5"
FT                   /transl_table=1
FT                   /translation="MATVNTKTGQAVDRTVLDSMLRRRMFYTPSFEIYGGVSGLYDYGP
FT                   PGTALIANMTDLWRKHFVLEEDMLEVDTTMLTPHEILKTSGHVDKFADWMCKDPKTGEI
FT                   FRADHLVEEVLEARLKGDKQARGEKIEVDEEKEAKKKRKAKSTEAKKLDDALVKEYEET
FT                   LAQIDNYGGPELEQLIKKHDIRNPVTGGEVLPPVSFNLMFQTSIGPSSNMPGYLRPETA
FT                   QGQFLNFAKLLEFNQQSMPFASASIGKSFRNEISPRAGLLRVREFLMAEIEHYVDPEGG
FT                   KKHSRFDEVKDTELSLLDRNVQLSGSTNLTKMTVGKAVETGLVDNETLGYFLARIQSFL
FT                   LKLGVDPAKLRFRQHMANEMAHYATDCWDAELQTSYGWIECVGCADRSAYDLTVHKDKT
FT                   GAPLVVRQTRAEPLRIEEYQIDLEKKKFGPRFKKDAKTVEAAIEALSQDLREKLSLDLE
FT                   KDGKIEVDVEGVGSGKVEIEKDLIKIEKRTRVENVREYTPNVIEPSFGIGRILYSVIEH
FT                   SYWYRAGDETRGVLSFPPAIAPTKVLLVPLSTHASFKPLTQRLTSKLRKAGVSNRVDDS
FT                   SASIGKRYSRNDELGTPFGVTVDFQSVQDNTFTLRDRDTTKQVRASEDEILQAVKSLVE
FT                   GDETWEDIRKRLPEIRGTSVIDLSSFHSPLSTTMAPTVHSAKLTLSCPLFAADFDPRNN
FT                   GRLLVGGGGGEGRSGITEAVELNLSRDEDSVTSLAAAPLAGDEAGSLVALAGINSSVEQ
FT                   QKKNNNQHLRAFRFEAPRKTTEDRKQDEKAKKDAKSEEEVIPGRAIALSQASLFRTKNG
FT                   PGSSDTYQRVTRLSPWPKGKDGTEKHTRIGAVATGLAQSGEIVFFRATETPSEKDIIGR
FT                   IQLSSNEEAEDMDFVSLEHDLEKTDDGHGRFLVAYTNGTDVMVGEISCSSSSNSSPDVR
FT                   SVYNIPLPASGARTARPKFRALRFLSPRTLLLLQNAPNRGGSELVLLQLPSAKSSKSKV
FT                   LQRRKLPRTVKIGLGLDICQLGTNPQGQQQTVIAASGSDNSIPLFTLEYGPNRGYSNFR
FT                   PYTTLRDVHPFSMTKLTFSTFIAPPHPVTPDVGPQNIKLASVSMGNTVVVHTFPLSPFP
FT                   TSSRTPRYVLVTPGPAEIWELIYSIIVLLFSISAICVAMLAFAEIRGGTPPVLGATEWL
FT                   PESIRGAIAREYVIPPRDKLTYFDTLLAPRGSGGDTDTPVATIVPTESQIESLREILDR
FT                   VHRAGAAPADLETVAPQSLSVIVRCGAGQNAEQSVIVETAVSASGEAEQSEEEKLQAWK
FT                   DLSASEQSVWKQRLADAGRWTASEGESVLLGVLFGEACGGLGRAVRDELP"
FT   CDS_pept        229921..231216
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172062" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946715"
FT                   /orf_name="Pc20g01020"
FT                   /product="Pc20g01020 protein"
FT                   /function="ATP binding"
FT                   /function="aminoacyl-tRNA ligase activity"
FT                   /biological_process="translation"
FT                   /protein_id="CAP85431.1"
FT                   /db_xref="GO:0004812"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI0001831D57"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR6"
FT                   /transl_table=1
FT                   /translation="MGVPGRSGPPPGVMGDIKTGNKLRRKMNHVKRKRAKDAARREERY
FT                   AFKKEEAKNPKLKEERLRRNIPLTLERKRVWNEADNDTEETGLGLSVDVERIKRAKKEE
FT                   EDELNRPLEEGEDDSEVPESDNESVDSMLESDNSEDEDEGEEKNEDQDASRGRKKTSLR
FT                   TATERATSPTQSTRSTNLSLAPEALAAKFPTLFTEGPPPTPKILITTGLNSTLHVQAET
FT                   LTDVFPNSVYIRRNAHRYSHKFSIREISKFASNRNFTAVVVLNEDQKRPSGLTIVHLPV
FT                   GPTFHFSISNWIDGKRLPGHGRATDHWPELILNNFRTPLGLLTAHLFRTLFPPQPEFEG
FT                   RQVVTLHNQRDYIFVRRHRYVFREKRETEKAVVGADGKEMAGAEGIRTGLQELGPRFTL
FT                   KLRRVDKGIQRASGQEWEWKGGMEKTRTLFQL"
FT   CDS_pept        complement(231386..231958)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946716"
FT                   /orf_name="Pc20g01030"
FT                   /product="Pc20g01030 protein"
FT                   /protein_id="CAP85432.1"
FT                   /db_xref="UniParc:UPI0001831D58"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR7"
FT                   /transl_table=1
FT                   /translation="MRTGPTRKTIADLGKSSFWYEWSLAIPSAFGIDFAKRTVTLFDEG
FT                   EAMISTSTWPQVGRTVAGLLSMPIKAERGNGACLENLKNQVVYADPFTVSQKNMFESAF
FT                   RVTGTTEKDWTITKESAKERYENGVKEMNQGDRIEFVKILDTRIFFEDGAGNFESKGTL
FT                   NGLLGLPKEDIDEVTRAAIERSKSTTW"
FT   CDS_pept        232049..232843
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946717"
FT                   /orf_name="Pc20g01040"
FT                   /product="Pc20g01040 protein"
FT                   /function="aminoacyl-tRNA hydrolase activity"
FT                   /biological_process="translation"
FT                   /protein_id="CAP85433.1"
FT                   /db_xref="GO:0004045"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="UniParc:UPI0001831D59"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR8"
FT                   /transl_table=1
FT                   /translation="MTLREKKNTTYNSQYPLEYTPNLSPLLPTNMEVLPRRLLFIASIG
FT                   NPAPYYNTRHSAGHLLLDALKPLLETTLPNTGLYHETWQSPTQMNITGPKLVRRLEQWA
FT                   TERASRLERIANVAATRASTSSSSSQPPNLPAQTTYPTTLIILHDELSIAQGKVRVVRG
FT                   GPESLSLRGHRGLISICDTLRKKGLYPRSSGASKGVTGPLADLSILRVGLGIGRPSSHE
FT                   TAAVSDYVLKTVTDKELKAYHAAAAPVVETIRDELFRPAGKV"
FT   CDS_pept        join(complement(234385..234397),complement(234256..234306),
FT                   complement(234069..234114),complement(233922..233995),
FT                   complement(233711..233858),complement(233199..233652))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172086" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946718"
FT                   /orf_name="Pc20g01050"
FT                   /product="Pc20g01050 protein"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85434.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="InterPro:IPR003005"
FT                   /db_xref="InterPro:IPR004148"
FT                   /db_xref="InterPro:IPR010504"
FT                   /db_xref="UniParc:UPI0001831D5A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR9"
FT                   /transl_table=1
FT                   /translation="MSWAGFKKNVNRATTQVMMKTGHVERTNDRDYEIEERRYRTMETA
FT                   ATRLQKESKGYLDSLRAMTASQMRIAETIDAFYGDAGTKDGVSRSYKQAVEDLDAETIK
FT                   ALDGPYRTTVLDPISRFCAYFPDVNECIKKRNHKLLDYDAMRAKVKKLAEKPDKDVTKL
FT                   PRTEREAEMAKQAYEQLNEQLFNELPQLIDLRVPYLDPSFEALVKIQLRFCAEAYSRMA
FT                   QVQQYLDAETRDQYAKGDLDNRVEEVLQEIRDLSIAGTV"
FT   CDS_pept        join(complement(236757..238220),complement(236568..236699))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172097" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946719"
FT                   /orf_name="Pc20g01060"
FT                   /product="Pc20g01060 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85435.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015729"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0001831D5B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS0"
FT                   /transl_table=1
FT                   /translation="MTPPSPSPVPSAVSSAAASQHSHDPRDGDASVTRAIAGMNLAAHA
FT                   NGEALPPPASPAAKPTRSTMAARLTRMFSSTGKNTPPRENNEVPRDLSDSSLESIQPLN
FT                   GRTSKPSSRPASRPPSRPPSRGENSRTPSRNPSLKSEPLEKYDKKKMDDKKKDGASVHK
FT                   RFEVLTEALGNHSHNLRSARRQEKLTDLLRDMMGGRKKDDQVDEQQLSLMSTWIDQFKT
FT                   ERDKLAADKKGGPNATASLVDKYGKCQEIVGRGAFGIVRISHKVDPQDSKCEQLYAVKE
FT                   FRRRPQETTKKYQKRLTSEFCISSSLRHPNVIHTLDLLQDAKGDYCEVMEYCAGGDLYT
FT                   LVLAAGKLEVAEADCFFKQLMRGVEYMHEMGVAHRDLKPENLLLTTHGALKITDFGNGE
FT                   CFRMAWEKEAHMTAGLCGSAPYIAPEEYVEREFDPRAVDLWATGVIYMAMRTGRHLWRV
FT                   ARKDEDEFYQRYLDGRKHEDGYAPIETLHRARCRNVIYSILDPNPSRRINASQVLKSEW
FT                   VRQIKLCKAGEEGF"
FT   CDS_pept        join(complement(243833..243869),complement(243572..243770),
FT                   complement(243345..243490),complement(243175..243278))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824096"
FT                   /orf_name="Pc20g01070"
FT                   /product="Pc20g01070 protein"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /cellular_component="cis-Golgi network"
FT                   /protein_id="CAP85436.1"
FT                   /db_xref="GO:0005801"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="InterPro:IPR007233"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI0001831E3E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS1"
FT                   /transl_table=1
FT                   /translation="MVVYSFYIFDRHAECIYKRRWLPRPTSTVGKSRSDTVSGAAPTGL
FT                   GQTVRSTDDDSKLVFGTVFSLRNMVRKLGGEDDNFVSFTTSQYKLHYYETPTNTKFVML
FT                   TDLKSPSMRIALQQIYINLFVEYVVKNPLSPTEHPGGVGVNNELFEESLEQFVVRAL"
FT   CDS_pept        join(244217..244296,244364..244448,244505..244654,
FT                   244733..245527,245578..245715,245767..246966)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172119" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671395"
FT                   /orf_name="Pc20g01080"
FT                   /product="Pc20g01080 protein"
FT                   /EC_number="2.7.11.17"
FT                   /function="ATP binding"
FT                   /function="calmodulin-dependent protein kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85437.1"
FT                   /db_xref="GO:0004683"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020657"
FT                   /db_xref="UniParc:UPI0001831E3F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS2"
FT                   /transl_table=1
FT                   /translation="MSDISAEPSTSSLEGMSDARPQASRFPQSPPRSTASHDSYARHRR
FT                   RNPRSRRPVKETLNARSSYYTSQDDGTAEHRINQYIIKQEIGRGSFGAVHLAADQYGNE
FT                   YAVKEFSKSRLRKRAQSHMLRRPRGPIRGGTDFNSPLHRHPSGDDTETAKNPLYLIKEE
FT                   IAIMKKLNHNNLVSLIEVLDDPTEDSLYMVMEMCKKGVVMKVGLEEKADPYDDEQCRCW
FT                   FRDLILGIEYLHSQGIVHRDIKPDNCLVTNDDILKVVDFGVSEMFEKDSNMFTGKSAGS
FT                   PAFLPPELCVAKHGDVSGRATDIWSMGVTLYCLRYGRLPFEKQSIFELYDSIRGDTLVY
FT                   EDESDEVFKDLIGRILEKDPEKRIDMFALREHPWVTKNGTDPLLSFEENTSQIIEPPTE
FT                   EEMNSAITRKMGHLVTVMKAVQRFKRLTDPMKPQSPIQSTFGSILGGDHDAFLVEPPME
FT                   MDPDEPFPTVGAALQTHDSNGPDVRKNFPRRPFAGFRENAGCIGSTDSASFSSQPEHSP
FT                   SNSKIPSGVTEPERRDSGSIRSWGSTAQPDVGHEAQPHSQSASPHIPLSRASSSRTKRS
FT                   MEGTRGHARDPLEEEFPYLFIGPSTYNGSSQQDTVPGDEPASILQEPGHSMDPSDQMED
FT                   EEPVQFVSESPGAADFNIYETAYRKELDRIKNNLKDRDTGRKVYLTRFVEENSAEVLKL
FT                   SKEKELDLQMGDDFTPSPLSRTPSGFGTAVSALRSQILQKRQAEEPEEQGGDARKDKDY
FT                   SQNREPHPHPPKRLSVPSQSIPEPESSSLEATGVSSTEGNGDSKAQLRRILDRVRGKSD
FT                   GAE"
FT   CDS_pept        join(complement(249825..249866),complement(249658..249772),
FT                   complement(248711..249558))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216941" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946720"
FT                   /orf_name="Pc20g01090"
FT                   /product="Pc20g01090 protein"
FT                   /function="DNA binding"
FT                   /protein_id="CAP85438.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI0001831E40"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS3"
FT                   /transl_table=1
FT                   /translation="MSNPSDRPWTEEDKYTLLTEILKKAGFPSSYLVRMIKEYGITPSW
FT                   EHIPLPQGRSLSSCKTAYLNMVQQPVHPPHPVAPFPPRSDITGPPASMDPSTMRKRPLY
FT                   PSDKPIPRAIQPRPPASTASYSSESGASAQLSPRLDTGPGEPPRKRGRPSKAETERRKL
FT                   LAEARGETYPAPRRSGSGRLKVPPSPTSPAAGPSSTPFPPAPQAFHGPKPGPVPMLYDT
FT                   SAMRSAIPPGPGPASNDERRDMPARGMGTNMRELPRPTEMGHPLPSPHALQLGPPDAFP
FT                   RLSNPVERPYSFSADRFSPPDSGRRDSVTSRSDQPGPYSEGRMSTTPAEQAPR"
FT   CDS_pept        join(252120..252516,252636..254252,254305..254357)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172130" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946721"
FT                   /orf_name="Pc20g01100"
FT                   /product="Pc20g01100 protein"
FT                   /function="DNA binding"
FT                   /function="histone-lysine N-methyltransferase activity "
FT                   /function="transcription regulator activity"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85439.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0018024"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR006560"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="UniParc:UPI0001831E41"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS4"
FT                   /transl_table=1
FT                   /translation="MSAHDYADSEEPAKMERDSPVNGNHLKNGDSRTSSRSPLPPKKES
FT                   SPNSDAPDPMKENIGEIVLKQEPGQPPKLSRSSSQKVASRPPPLYTHLPDSTQDALATF
FT                   EQIPGCIYANKYMGYTEHAMECDCAEEWDPKIGRNIACGEDSDCINRATKIECAGECGC
FT                   GPDCQNQRFQKRQFAPVSVIKTEKKGFGLRAEKNLDPGELIYEYVGEVVGEQQFRKRMR
FT                   QYDEEGIKHFYFMSLNKGEFVDATKRGNLGRFCNHSCNPNCYVDKWVVGEKLRMGIFAE
FT                   RAVQAGEELVFNYNVDRYGADPQPCYCGEPMCTGFIGGRTQTERATKLSNATIEALGID
FT                   EADGWDTVVAKRPKKKKMEEDDEEYVDSVQPKSLDEDGVTKVMAALVQCQEKWIAVKLL
FT                   GRIQRCDDERVRNRVVRMHGYQILNSQLAQWKEDQNVVLQILNILDGFPRLTRNKIQDS
FT                   KIETNIRPLTTCDDERVPKKAVALLESWAGLEVAYRIPRMKRGKDAKQAINQFERRETG
FT                   QEQRQRSLTRSPSPVYDAPRGPAQQRRDRGPQRSRQPNRRGPRPLPEGWYTAEAEGRVY
FT                   YYSASGKTTWERPTLPATPATPAPGQPAKNQQNLALQSIIDGIMNTQEDTPSENRTATP
FT                   VTPQPSADQPERRHKDGEKWRKLPLEKQKRIYENTVTFPAYQARGGSVQTQDP"
FT   CDS_pept        join(254424..254430,254587..255023)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128441"
FT                   /orf_name="Pc20g01110"
FT                   /product="Putative uncharacterized protein Pc20g01110 "
FT                   /protein_id="CAP85440.1"
FT                   /db_xref="UniParc:UPI0001831E42"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS5"
FT                   /transl_table=1
FT                   /translation="MKSKYVDRGKHEAEKSQDATPNPGSEVHSTGDDEAVAGASASSPL
FT                   EDDDAASLKRKRNGTLNVDGAEDGASSPSKRQKSTPPPPPPPPPPADLPQDDADGDTSM
FT                   GNTGNDSSHPKDDSGAGVDVNMEIEAENNPQTERPQISVEGQV"
FT   CDS_pept        join(complement(256807..256841),complement(256675..256746),
FT                   complement(256416..256502),complement(256134..256322),
FT                   complement(255666..256026))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230605" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977581"
FT                   /orf_name="Pc20g01120"
FT                   /product="Pc20g01120 protein"
FT                   /function="ribosome binding"
FT                   /biological_process="mature ribosome assembly"
FT                   /protein_id="CAP85441.1"
FT                   /db_xref="GO:0042256"
FT                   /db_xref="GO:0043022"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniParc:UPI0001831E43"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH38"
FT                   /transl_table=1
FT                   /translation="MAVRAQFENSNEVGVFSCLTNAYAIVAVGASENFYSVFESELQDV
FT                   IPICHATIAGTRIVGRLIVGNRKGLLVPTTTTDQELQHLRNTLPAEVKIQRIEERLSAL
FT                   GNVICCNDHVAIVHPDLERETEEIIADVLGVEVFRQTVADNVLTGSYMALSNQGGIVHP
FT                   KTSIRDQDELSSLLQVPLVAGSVNRGSPVVGAGMVVNDWLAITGLDTTATELSVVESVF
FT                   RLGEMAPGGAGGAAVNKDSIVESFY"
FT   CDS_pept        join(complement(261579..261666),complement(260225..261528),
FT                   complement(260064..260172),complement(259228..260013))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(263597..264763)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671671"
FT                   /orf_name="Pc20g01140"
FT                   /product="Pc20g01140 protein"
FT                   /protein_id="CAP85443.1"
FT                   /db_xref="UniParc:UPI0001831E44"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH39"
FT                   /transl_table=1
FT                   /translation="MPHLSYSLAAASLLATFIVTILSGICYATSKASPDVASTILSAVS
FT                   CMALIALGLLHHQNIQTGRRLWICFAGGYLLIAAAASAGAMARSPQASVFVVRSVFWAL
FT                   SVFAQGLYCGFLAMTLAQEKSNPQWPRAYSQEVHSQELKDIPQSPNFLPSPPRVCDLSE
FT                   LFEPKRSSLRKFPRRSSRYSDTTLCPTSTKEEKNASIDNSSSTHTSPSPSPTRDRMPDT
FT                   LPDRDTRPLLRGTHSIRSMPSLRRNPPTALPLDSRVHPSMPSPTASTIRIDSPTQSSSN
FT                   NSTWEYNPFSENNIHPLFRSTSPCPSPTFSPGTMVKASPSAGQTITAGTITRMRSARSL
FT                   HDHAMRAPSPLPGSESEETIRTRPNPTLGFAHSQSVKRYDLNESPYEK"
FT   mat_peptide     complement(263600..264679)
FT                   /db_xref="UniProtKB/TrEMBL:B6HH39 "
FT   sig_peptide     complement(264680..264763)
FT                   /db_xref="UniProtKB/TrEMBL:B6HH39 "
FT   CDS_pept        join(266302..266319,266382..266429,266493..266568,
FT                   266647..266726,266794..267126,267179..267649,2
FT                   67704..267820)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172162" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947735"
FT                   /orf_name="Pc20g01150"
FT                   /product="Pc20g01150 protein"
FT                   /function="damaged DNA binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /biological_process="proteasomal ubiquitin-dependent
FT                   protein catabolic process"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85444.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="GO:0043161"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR004806"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015360"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI0001831E45"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH40"
FT                   /transl_table=1
FT                   /translation="MKLTFKDLKQEKFVIDVEPSETVREVKVKIAQEKGEYEAERMKVI
FT                   YSGKILQDDKTVESYNIQEKDFLVCLPSKQPKAAASTASSQVPSTPAARAPVSTPAAPP
FT                   APHAAAAPPPSVAPATPSPAGAAPAPSSGPAFGDPSALTMGPAAEGAVVQMEAMGFART
FT                   DIDRAMRAAFYNPDRAIEYLLTGIPDNIQEQQQQQQQASETAPTGAAPAAPAAPSGGDE
FT                   PHLNLFEAAAQAGGEGGRPRGAAGAGAGAAGGEALGSLEFLRSNPHFQQLRQLVQQQPH
FT                   MLEPILQQVAAGNPQIASIIGQNSDQFLQLLGEELEDEEGALPPGAQAISVTEEERDAI
FT                   ERLCRLGFPRDSVIQAYFACDKNEELAANFLFDQPDEDEQ"
FT   CDS_pept        join(complement(270614..270722),complement(269869..270447),
FT                   complement(268849..269705))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172163" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671672"
FT                   /orf_name="Pc20g01160"
FT                   /product="Pc20g01160 protein"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="CAP85445.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniParc:UPI0001831E46"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH41"
FT                   /transl_table=1
FT                   /translation="MWRRTYLLLLVIRVYFALSPSYLHPDENFQGPELFADHQNAGRIF
FT                   SFPSKLPWEFTVEHPIRSIFPLWATYELPMSLLKWFYTEIGSGSPPPHLVYYALRGGMF
FT                   LLSFVLEDWAIYELVPSPRHRRAIVVLVASSYVTWTYQTHTFSNSLETLLVAWGLVLIR
FT                   RIVENKVRRDKASKYTIHADLTPSDTRPSSPTPCSPSSPWWASSTASPSRLSFYSRVCN
FT                   CCLSSSATSLLSALRDPIITPLNNLLYNTDTSNLAQHGLHPRHQHFTANLLQLLGPVYI
FT                   TMLVSLFSWPLVPYWMRNVRALSALSATMLLSLFPHQEPRFLLPAVPLLLSCVPMRRSR
FT                   LLLAVWVIFNAAMGFLMGVYHQGGVVPTQLAMRDIVSSSTTHHIPSATVFWWKTYSPPL
FT                   WLLGGDNQTTEIQTLDLMGMSGAEMMLQLEKVVPACSTPSPVFLVAPTSAAFLDPYAVS
FT                   ARQSRDQNLQLHPLWSYRKHLNLDDMDFGEDGILPTLKRVVGRRGLGVWSVRRSCK"
FT   mat_peptide     join(complement(270614..270653),complement(269869..270447),
FT                   complement(268852..269705))
FT                   /db_xref="UniProtKB/TrEMBL:B6HH41 "
FT   sig_peptide     complement(270654..270722)
FT                   /db_xref="UniProtKB/TrEMBL:B6HH41 "
FT   CDS_pept        join(271717..271795,271824..271909,271970..272137,
FT                   272189..272362)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172184" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947736"
FT                   /orf_name="Pc20g01170"
FT                   /product="Pc20g01170 protein"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAP85446.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniParc:UPI0001831E47"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH42"
FT                   /transl_table=1
FT                   /translation="YKDLFRAELPTALPLEYNIAYKIDIGTYIPININVYRLSFKKLDE
FT                   XARXVKDLIKKGLIRESNSVXGFLVVFAXKPNRKXRIYIDYRALNNIIVKNGYPLPRIX
FT                   ELLDIIGNVRILSKIDLIAGYXXIRIGEGSIEKIVFNTIXGKYEXLAIPFRLYNAPTTF
FT                   XSIINKTLXPLFSYNIVVYLDDILIFLATLDKYRKYIEEVLALLXKXXLYVLPTKCTFA
FT                   TXELEFYSYIVRNRTIRPLPAKVEAIXAXPRLKTIYNVYXFLGLATYYYRFVYNFLKVY
FT                   ILLYKLLKESDSTLYKXRFRPITXIEAYKSAFRKVKDLLTSALVLKXLDRNRLYVIEID
FT                   TSEXALSIVLIXEDDNRKLHLVIYNRRKLYSAELNYPIYKKELLAIKEAIYIXDRYIDR
FT                   DRFETVIITDNTSLXYLNTIREYSKRLARXIAEFXXYRLSIRYRKGSENVIADTISRRL
FT                   DLIGTT"
FT   CDS_pept        join(273241..273294,273385..273792)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128694"
FT                   /orf_name="Pc20g01180"
FT                   /product="Putative uncharacterized protein Pc20g01180 "
FT                   /protein_id="CAP85447.1"
FT                   /db_xref="UniParc:UPI0001831E48"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH43"
FT                   /transl_table=1
FT                   /translation="MAKACCSKFGCGRHIMKRNGRAEGANTEGPLRPSGSTYASGGAWR
FT                   CICFSSVSAIRSIQCNSRISFSPLLGSCGRRVDGYVRFPFLSRVSVSLFPQMANSDIKM
FT                   DFGSRKQRCDLPDGVVGAQTDPLGDGAVLTLSFGKLLLGAEGLVALCGK"
FT   CDS_pept        join(273853..274014,274059..274124,274236..274358)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824353"
FT                   /orf_name="Pc20g01190"
FT                   /product="Putative uncharacterized protein Pc20g01190 "
FT                   /protein_id="CAP85448.1"
FT                   /db_xref="UniParc:UPI0001831E49"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH44"
FT                   /transl_table=1
FT                   /translation="MANVFFENGGNRSLTYRHLEGLIATASLLDGRMKLSTFECGWFVC
FT                   GRAWLRFGWAETISAKWVNFYECSVYAHTAQDRWKQSSYNAICVLQCQAVLYCRISKLA
FT                   LEALIRNLVSRE"
FT   CDS_pept        join(complement(275355..275438),complement(274462..275301))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048593" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947737"
FT                   /orf_name="Pc20g01200"
FT                   /product="Pc20g01200 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85449.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001831E4A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH45"
FT                   /transl_table=1
FT                   /translation="MEIQQSLPLSNPSIYKIDPMAWMRPLSDPHSRDLEGDFPLDGKDF
FT                   DSVTDKTLAILLESAPVLHEFGAIKVVRLSRDLVMKGGGTVLPCEAKTLNLVASRTGIR
FT                   APRVHRSFQVEDDTQYFGTKGYIVMDFIPGQPLDKCWADLTSDNQRQIAIQIAEMIKEM
FT                   QSVVISQPGPPGGGPFRGRFFTDYSAGPFKDSAEFQGWFNHKLDICKHVKQCPKDIPPF
FT                   QFTTFVLTHQDISPRNLILDQNGEVWLVDWAFAGAYPPAFESAALLAQQFFTGFNEAVL
FT                   SLIPRFPEEERQLDSIAYGLTTAALA"
FT   CDS_pept        <276081..>276425
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        278175..282176
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20671673"
FT                   /orf_name="Pc20g01220"
FT                   /product="Pc20g01220 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85451.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0001831E4B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH46"
FT                   /transl_table=1
FT                   /translation="MQQPQEGVTAVEKVADGPQLNEKPVDKRDSDSASTSTAKEHESKT
FT                   PVASDEDALYAHLPEHEKDILKQQLDAPPVNISYFGLYRYASRIDILIIVISTLCAIAA
FT                   GAALPLFTILFGSLATAFQKIMLRTIPYDEFYDQLTTNVLYFIYLGIGEFVTVYVSTVG
FT                   FIYTGEHVTQKIREHYLEAILRQNIAYFDKLGAGEVTTRITADTNLIQDGVSEKVGLTL
FT                   TAVATFVTAFIVAYIKYAPLAGICTSTMVALVLIMGGGSQLIIKFGKLSLESAGAGGTV
FT                   AEEVISSIRNATAFGTQDKLAKQYESHLLRAERWGMRLQMSLAVMVGIMFGLMFMNYGL
FT                   GFWMGSQFLVDGKVDVGQVLTILMAILIGSFSLGNVSPNASAFTNAVAAATKIFATIDR
FT                   DSPLDPTSDEGIILDHVEGHIEFRNVKHIYPSRPEVTVMNDVSLGIPAGNTTALVGPSG
FT                   SGKSTVVGLVERFYLPVGGQVFLDGHDIQTLNLRWLRQQISLVSQEPVLFGTTIYQNIR
FT                   HGLIGTRFEHESEEKIKELIENAAKMANAHEFITALPEGYETNVGQRGFLLSGGQKQRI
FT                   AIARAMVSDPKILLLDEATSALDTKSEGVVQAALDRAAEGRTTIVIAHRLSTIKSAHNI
FT                   VVFVQGSIVEQGTHSQLTEHDGPYFKLVEAQRINEEKDADALDADEDEDGLEEMTKSHI
FT                   ARVKSIASGSTCVKDEAETFQDAMHRQESRKSVSSVILSQKTAEGGRKHSLLTLIKFIG
FT                   SFNKEERWFMAIGLCFSILAGCGQPTQAFLYAKAISALSLPKTQYDKLRSDANFWSLMF
FT                   FIVGIVQIITFSVHGIAFAFSSERLIRKARGNAFRVMLRQDINFFDREENSTGALTSFL
FT                   STETKHLAGISGQTLGTILMTSTTLIASIVIALAFGWKLALVCMSVIPILLGCGFYRFY
FT                   MLAAFQARSKAAYEGSASYACEATSAIRTVASLTRETDVWSFYHGQLERQGRTSLISVF
FT                   KSSLLYAASQALVFFCVALGFWYGGTLLGHHEYDVFRFFVCFSEILFGAQSAGTVFSFS
FT                   PDMGKAKNAAAEFLRLFERRPTIDTWSEEGENLDHCEGTIEFKDVHFRYPTRPEQPVLR
FT                   GLNLTVKPGQYIALVGPSGCGKSTTIALLERFYDALSGGVYIDDKNIADLNVNSYRSHL
FT                   ALVSQEPTLYQGTIKENILLGSPNQDPTEEELVQVCKDANIYDFIMSLPEGFNTVVGSK
FT                   GGMLSGGQKQRVAIARALLRNPKVLLLDEATSALDSESEKVVQAALDAAARGRTTIAVA
FT                   HRLSTIQKADIIYVFDQGKIVESGTHTELLRNKGRYFELVNLQSLGRAG"
FT   CDS_pept        join(complement(282940..282987),complement(282785..282870),
FT                   complement(282536..282695))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977582"
FT                   /orf_name="Pc20g01230"
FT                   /product="Pc20g01230 protein"
FT                   /protein_id="CAP85452.1"
FT                   /db_xref="InterPro:IPR010760"
FT                   /db_xref="UniParc:UPI0001831E4C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH47"
FT                   /transl_table=1
FT                   /translation="MDQAKETRSFRDQERVDNLRASIASLEAKYARLEADLASVTAQLK
FT                   DDYNTTCVRYTQLLHEYNDIRDVGQGLMELIADARGVRQVEVVREFGFSEED"
FT   CDS_pept        join(283390..283503,283554..283631,283702..284532,
FT                   284598..285041)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172196" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947738"
FT                   /orf_name="Pc20g01240"
FT                   /product="Pc20g01240 protein"
FT                   /protein_id="CAP85453.1"
FT                   /db_xref="InterPro:IPR018825"
FT                   /db_xref="InterPro:IPR018827"
FT                   /db_xref="UniParc:UPI0001831109"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH48"
FT                   /transl_table=1
FT                   /translation="MAYLRQSLWTLSVLVASALAHGGHEAVPEGESISQDPIDSTLWTH
FT                   MILMGLAFGIIFPTGMVLGIIRSRWHVPVQVVGTVIAVLAYFLGHAHKGRQFDKNVHAS
FT                   VANWLMLLLVAQVVLGFYLKLHLEKAGQARIRWIFVLAHGIVGKVMPVLSWAQMLFGGI
FT                   ASLGFCRDDHLGQCLAHFIMGSAFIGYGICLTILLLVGQYWLRRTGRSQEFFDSLIIAA
FT                   WGCVNTFTEHRWGSPWAHNDLQHTTMGIIWWCAGLLGMWLSRTRSGRPKRNLIPAIVIL
FT                   ITGYAMSAHPQSLMISTMIHSIFGYTLMAAGLTRIIEISFVLKDKPALSEPNSFQYLTP
FT                   FLLYASGFLFMGATEEQMLLLHNAGVTHVSYVLILYSIAFIVFLCKLIPYPPLIFSGTP
FT                   THSSLPVVNILLHIYAVHAWPNSESTNQDGPMYSTLNGNANGRARSNSQQIQDAEAFEL
FT                   HGLISDDEEGPSMGPRKNSDEELGKEETRH"
FT   sig_peptide     283390..283449
FT                   /db_xref="UniProtKB/TrEMBL:B6HH48 "
FT   mat_peptide     join(283450..283503,283554..283631,283702..284532,
FT                   284598..285038)
FT                   /db_xref="UniProtKB/TrEMBL:B6HH48 "
FT   CDS_pept        join(complement(286663..286702),complement(286557..286614),
FT                   complement(286322..286508),complement(285377..286270))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172217" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947739"
FT                   /orf_name="Pc20g01250"
FT                   /product="Pc20g01250 protein"
FT                   /function="binding"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAP85454.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000183110A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH49"
FT                   /transl_table=1
FT                   /translation="MAEQQDNAQSISADEIALYDRQIRLWGVHAQEKIRSANILLITVK
FT                   ALANEVAKNLVLAGIGSLTIIDHQDVTEEDLGAQFFIAEAQSEKDVIGKNRAQVAGPQI
FT                   HKMNPRVKLNIDTSDVKTKQPDFFAQFDITIATELDFLTNTTVNAACRLANRPFYAAGL
FT                   HGLYGYVFADLISHDFVIERNKSNMPPATQETPTRSIIDITTKKEQNEANKEESKIIEL
FT                   VTKREVYSPLILANTSPLPEEYTRLPRRRKQVTPLLSCLRALWEFEKLRGHRPTFTHED
FT                   LELFTKLSRDRHQELKLEPLTLDSVFLRTFLQNLGSELSPVAAFLGGALAQDVINVLSA
FT                   REQPLQNMLLFDGEKSVGPIYSLHPFFPDDGADMAAVPPVRNPVTVPVAGDS"
FT   CDS_pept        join(287846..287848,287904..288694,288756..289361,
FT                   289412..289518,289586..289645,289710..289777,2
FT                   89869..290102)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172218" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947740"
FT                   /orf_name="Pc20g01260"
FT                   /product="Pc20g01260 protein"
FT                   /protein_id="CAP85455.1"
FT                   /db_xref="UniParc:UPI000183110B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH50"
FT                   /transl_table=1
FT                   /translation="MSGNYDYPRASSSSSRRISRTIRPDERPEILRLQHLRNFVSERNR
FT                   SGAHNAYNATLALETLNREVAEHSLDRARDRTNFEQARADIDRQIQQLHSETAGPAERI
FT                   RSIWLDQIRSERARTSLSPESHSLRHRLPWQTLRPPSPDGSLSRSPPLMPPSGQSGRDG
FT                   QGRMKRRKLDTDDNREEFRGFNYGQYGQVVPGMLQMEIASCDGGSYDPDSGCSRPENVL
FT                   DNNTSVYSTKEARCNLVLCHRGEAPFCLKKIVIKAPQCGFDAPIQEGMVFVAMTSDELL
FT                   ARTAQYQIQYSSGRYRRRGRRSGMQPSQEYLTGFRPPLQNLERTVLMSPHSAAVPQTAE
FT                   DPQAQFHITTEYDENNEDSDDDEDWRSALLERTQAEQTEDPLSDTDESPSDEEDPSSRH
FT                   QRRRQIESERLSTLSRVSEQRLRHGPSLVYPNPPAEPAHPAAEVLKPHARFFIEREKSM
FT                   VTIKFDPPPSGRFILIKLWSPRAHGNIDIESIIAHGYAGPRFFPTFHFLFVYSISAATF
FT                   LLASTIDHTNYVVCGIVRYLVTSKAWQVRANNLNDTYNALLHPWMLPPSSTFAIPNLGT
FT                   YIGNLSGMTTAMTYSLYIQHSGDDREREPINPHGLDHIIARRHLAL"
FT   CDS_pept        join(291774..292383,292460..293166)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947741"
FT                   /orf_name="Pc20g01270"
FT                   /product="Pc20g01270 protein"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP85456.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019103"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000183110C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH51"
FT                   /transl_table=1
FT                   /translation="MRITVSVIRPEQADSDIINLEVGGDMSIELLKAIVESETSIPPEA
FT                   QQLVYNNQLLQNPSQTLDQAGITEGDMLGVHVTLRAPQPAPRPAASSSVAPRQNAQPRP
FT                   GMPDPETIRLHILGDPRVREAVRRQNPELSEAADNAQRFREVLLRQQQGEAQREAEKEA
FT                   RIAMLNADPFNHDNQKEIEEIIRQNAVTENLHNAMEHHPESFGRVTMLYIPVEVNGHRL
FT                   NAFVDSGAQVTIMSPECATSCNIMRLVDRRYGGIAKGVGTAPILGRVHSAQIKIGEMFL
FT                   PCSFTVMEGKQIDLLLGLDMLRRHQACIDLQRGALVIQDQAVPFLGESDIPKHFTEEFE
FT                   AEPTVKGADGAEVGARTGAVTHKAENNPNANATPNIASASGSGASGSQPRINIRPAPTS
FT                   RWPQDSIARITELGFSREEAVRALDMAHGDLEGAIGFLI"
FT   CDS_pept        join(complement(294226..294298),complement(293958..294149),
FT                   complement(293524..293676),complement(293362..293432))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181224" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947742"
FT                   /orf_name="Pc20g01280"
FT                   /product="Pc20g01280 protein"
FT                   /protein_id="CAP85457.1"
FT                   /db_xref="InterPro:IPR016964"
FT                   /db_xref="UniParc:UPI000183110D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH52"
FT                   /transl_table=1
FT                   /translation="MSICTRKRDLAYLLFFVTHVPIILLIDTVPLLPSFLQTNLSHQLR
FT                   EFYITTYRDKFFEDPPTWFTVFIWMELLYHLPVSIWAARGLLKDHPLVPVHLLVFGIQA
FT                   FITTLTSLVVVWSWTDRSVAEKQQLTTLYAPYMALGGFMALDMVFRLRDKLMPKTKRE"
FT   CDS_pept        join(295520..296516,296590..296720)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000165073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824354"
FT                   /orf_name="Pc20g01290"
FT                   /product="Pc20g01290 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85458.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI000183110E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD66"
FT                   /transl_table=1
FT                   /translation="MPSSAPRRPKQPKKQEPISYDINIPYVDVDKQSKISTKYPQYLPS
FT                   WDPIWFEPLQPFEYEDPALRVRNKSKPNLLPPTAKVSHIQPSLGTIVENVQLSDLSAAG
FT                   RDELALLISERKVVAFPDQDLIDAGPDAQESFMRHFGKPNYQPVSGSMTDHPAFHIIHR
FT                   DGNRDEIARFLQQRTTTTLWHQDVSYEIQPPGYVMLGLLQGPEVGGDTVFAATDLAYKR
FT                   LSPAVTAFLDGLKVTHSSAKMIAHARMTGGLVRKDPVDTVHPLIRVHPVTGEKCMFLNG
FT                   EFITRIDGLKDSETKWVLDFLMNHLVTGHDFQVRVRWQPRTIVMFDNRSTIHSAIVDYL
FT                   DDDYGAKARHIFRLIALGEKPIPVYEEEEEDEEFE"
FT   CDS_pept        join(complement(301075..301351),complement(298566..301025),
FT                   complement(298412..298500),complement(297722..298351),
FT                   complement(297054..297665))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181213" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947743"
FT                   /orf_name="Pc20g01300"
FT                   /product="Pc20g01300 protein"
FT                   /function="structural constituent of nuclear pore "
FT                   /biological_process="nucleocytoplasmic transport "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="CAP85459.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006913"
FT                   /db_xref="GO:0017056"
FT                   /db_xref="InterPro:IPR004870"
FT                   /db_xref="InterPro:IPR007187"
FT                   /db_xref="InterPro:IPR014908"
FT                   /db_xref="UniParc:UPI000183110F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD67"
FT                   /transl_table=1
FT                   /translation="MSYPTLPTNLPPATPQKPLPGAYFQTPAPATARPLPPKSPLQTQP
FT                   QTPMPKLPPAASKTKNQTVSTEERGARTINSSLQSESRYPDLDSYLSQGSSSEYNIPVS
FT                   QSWAPFQKVKMYDIPDQIFDQYNRAQVSTSMGLFAELNHAWVAIDNALYIWDFTHPNPQ
FT                   LVGFEEQPNSINAVKLTKPRSGVFLPAITHLLVIATTADIILLGMGYENTPSGGRQVSL
FT                   YHTGMSVAVRGLDINVFAASPSTGRIFFGGSSDTDVHEVTYQQEERWFQGRCGRVNHTS
FT                   SRLSAFRPSMSLTNLAQSAAEHVVQMALDDSRNLLYTLSSSSTIRVFHMGPENTLTLAI
FT                   TKRALDIYSNIGHIITSNETLNPGIKIVSISPVPATEASRYHLVATTATGYRIYLSATG
FT                   SNSWAPASTNTSPPTSMQALHVKTPPVDTSPGVSGVAPSISLASPLGAVSPSAGQITTL
FT                   SPTRLAERYSPGYFFCFTTKDAQQKIDTLFISTPDSGRVAQYQESSVSGKAAESAIILD
FT                   LGGKAEDIGLVSAPSPVTNELAVQFDHPAAEIAILTNGGVHIIRRRRLVDIFAALLRSS
FT                   GNPHEGLTGEIQNFLRTYGRSEMLATALAVACGQGMEISPDQRLTRITDPDVLAAARQA
FT                   FITQGGRAHLNENAIADGSTSALDAVQPSPRHTGIALYIARLLRSIWKEKIAKVGNGPN
FT                   GAQSVSASVSSSKLQAVQHDLSSLAEFFKVNKTFIDGLNGPDALARVNSKQEEVALQAE
FT                   HRALHSLVQLVSHTIEGISFILVLFDERVDEIVATLPAESKAKFLSLTFEELFSSSKGH
FT                   DIAKELVKGIVNRNIAKGSNVETVADALRRRCGSFCSTEDVVIFKAQEMLKRATEAGAN
FT                   TELGRNLLNESLHLFQQVAECLPMDYLVSAVDNFIADQFFAGAIQLALNVAARSDKSNL
FT                   AYSWIMDQRPEQDPRREYFYFRKQCYDLIFKVVLAVDKLAASDPGLIDGQLTTIAKRQN
FT                   EAYGVISDSTDEVFLTSLYDWYLEQGWNDRLLQTQSPFVVTYLQRKSNDDLGHADLLWR
FT                   FYAQSQRFFETAQVQFHLANSAFVLPLSRRIEYLGQARANASIFTPDVGRQSRQRLLQE
FT                   ISNLIDVANIQDDLLQRLKDDERILPERKPEILREVDGPVLDISTLFNKYADSASYHDI
FT                   CLQIFYQADHRNAADVKSTWQHLIQGVHDATVQRGSPQPYEAVIDKVRSLGSRLRMSET
FT                   IFPIRELVPMLERYALEFQRNVGPATWVVDLFLDLGVAHESLYAVLETMYYTDEAPFHG
FT                   SNRRVIAHDLLYLLNGWFHETVRLGGIVFGSDIVAERVSEMLLLLQQSGVISGEQLEIA
FT                   HDLRSRIDDILR"
FT   CDS_pept        join(301664..301803,301856..302255)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181202" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824355"
FT                   /orf_name="Pc20g01310"
FT                   /product="Pc20g01310 protein"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /biological_process="translation"
FT                   /protein_id="CAP85460.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="UniParc:UPI0001831110"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD68"
FT                   /transl_table=1
FT                   /translation="MFQSIRFSSRLPARLVRWNSTGPALPPLMATLRTDLKTAMRAKDT
FT                   TRLNVLRALISETNNAAKTASPIQTDIQLLSLIRKRLNASKDAAKEFAAAERPDLKEKE
FT                   DAQVVVLEEYASQVKTLPIAEIKEVVINEIAAMVNANTKPNQGTVLKALFAPGGPLDGK
FT                   PVDRKEVATEVKNALS"
FT   CDS_pept        join(complement(303117..303218),complement(302942..303056),
FT                   complement(302712..302890),complement(302378..302665))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671674"
FT                   /orf_name="Pc20g01320"
FT                   /product="Pc20g01320 protein"
FT                   /protein_id="CAP85461.1"
FT                   /db_xref="InterPro:IPR019623"
FT                   /db_xref="UniParc:UPI0001831111"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD69"
FT                   /transl_table=1
FT                   /translation="MFLIWGLLVTAALANANDLVGTWTTKSRDVLTGPGFYDPLNDKLL
FT                   EPNLTGISYSFDDDGNYESAYYRAISNPVDPSCPGGIMQWQHGSYTVFGNGTLILTPIA
FT                   VDGRQLLSDPCRQQSGQYTRYNTTEEFKEFSVYIDKFNRIKRLDLTKFDGSLVHPMFLA
FT                   YQPPKMLPTTTLNPMPTGHKQKRELSSKESGVYLVAREQLVNPDRWWWLGVLMTSLGGV
FT                   AFFCS"
FT   mat_peptide     join(complement(303117..303170),complement(302942..303056),
FT                   complement(302712..302890),complement(302381..302665))
FT                   /db_xref="UniProtKB/TrEMBL:B6HD69 "
FT   sig_peptide     complement(303171..303218)
FT                   /db_xref="UniProtKB/TrEMBL:B6HD69 "
FT   CDS_pept        join(303541..303628,303678..304103,304155..304270)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000007299" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947744"
FT                   /orf_name="Pc20g01330"
FT                   /product="Pc20g01330 protein"
FT                   /function="5-formyltetrahydrofolate cyclo-ligase activity "
FT                   /function="ATP binding"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="CAP85462.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="GO:0030272"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="UniParc:UPI0001831112"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD70"
FT                   /transl_table=1
FT                   /translation="MAFQAAKRDLRKRMRSTLQGLSATSISQQSSAATTTFLSLPEYQT
FT                   AKSIAVYLSMPSGELSTTGIVKDALQRGKNVYIPYIHTQGKTSIMDMFALGSVSEFESL
FT                   QRDKWGIPSLLSTQIEGRPNGLAQGLDLIVMPGMAFDHGFRRLGHGKGYYDHFLTRYST
FT                   STHKMPFLVALSLQEQLLAEDIPVVEHDWLVDAIVVGDGQFLNRRA"
FT   sig_peptide     join(303541..303628,303678..303685)
FT                   /db_xref="UniProtKB/TrEMBL:B6HD70 "
FT   mat_peptide     join(303686..304103,304155..304267)
FT                   /db_xref="UniProtKB/TrEMBL:B6HD70 "
FT   CDS_pept        join(complement(304818..304863),complement(304556..304671),
FT                   complement(304408..304498),complement(304304..304353))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223543" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947745"
FT                   /orf_name="Pc20g01340"
FT                   /product="Pc20g01340 protein"
FT                   /protein_id="CAP85463.1"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI0001831113"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD71"
FT                   /transl_table=1
FT                   /translation="MYQHLTAETGSKRGSSRKTLLAPIHFIFSLLQKRSTVSIWLYEQL
FT                   AFRIEGKIRGFDEFMNLVIDDAVEVRLATKTEEEKRRPLGQILLKGDNVSLIQAV"
FT   CDS_pept        join(304907..305032,305093..305185,305233..305505,
FT                   305557..305647,305713..307953,308005..308093)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181190" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824356"
FT                   /orf_name="Pc20g01350"
FT                   /product="Pc20g01350 protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAP85464.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001831114"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD72"
FT                   /transl_table=1
FT                   /translation="MASKEAGQAFAPVLAAVATMQGNVSRTEKTQAHEFLEKFQKSIEA
FT                   WTTTHALLQSPDVPVEAKLFAATTLKGKIIFDLDQLPPDSVLALRDSVLNLLVAFAPGP
FT                   RPIQTQLCVCLASLAIQMVTWKDVLATVGAALGGSAGDCVLEFLKILPEEVTEGRKINL
FT                   SEDELVDRTKELLEDNAEQVMQLMIQYAQSSPAAATNPRLLDCITSWLREIPAAKVVES
FT                   PLMDVIFKALDNDASFDAGVDCVCTLYRDTKDVDESLPVIQALYPRLMALRPKIAETAE
FT                   AEDLEAFKGITRMFAEAGEAWVVLVARLPGEFQGLVEALLECCARDWERDAVSLTFIFW
FT                   YELKQYITLDRYTDARVAFQPVFAQLVDIMVKHLEFPTPEEGEGEDLFSGDREQEEKFR
FT                   QFRHAMGDVLKDCCAVVGVNDCLAKIYQLIQEWVAKYASQASNEHVPHWQELEAPLFGL
FT                   RAMGRMVDPEESTILGQLIPLIVQIPDQEKVRFQAIMALARYTEWTALHPETLEAQLNY
FT                   VISGFHHSSQEVVQASALAFKFLGTDCQKLLGGHIAQLHTFFESVLDKLKPTSQEEVTE
FT                   GVAAVVSVQPHEKIYDSYKMFCDPIMARIMNLANNAQTEEDQRAVADHLQLITIFVQVV
FT                   TPILAPGEENPAVKYCGEVLPIMTTIVMNFTSSTPILERVCRCWRYMIISYRTGMIPLL
FT                   PTLAQSIANGFQASREGCFLWATDAVVREFSDGAEYVDQATSDAVFQFYEQQAIAFLRI
FT                   LNDLPPQNLPDVIEDFFRLSSNAVRYYPKKYITSSLAVPIFSAALSALTLQQLDPLIAT
FT                   LHYYRDLFSFAFDKPMVSQFTSPEGQPYVTPPEVREAVKTLIISQGQPLAQRVLTGMMF
FT                   TFPGDCFPDASGVLMTMFELLPQETGAWLQTTLQMLPSGTMKHGEAERLLKNVSDKVQS
FT                   GETRKIRVLLQDFTNSYRRRNVAPRDGLGRLEAARFRFSG"
FT   sig_peptide     304907..304987
FT                   /db_xref="UniProtKB/TrEMBL:B6HD72 "
FT   mat_peptide     join(304988..305032,305093..305185,305233..305505,
FT                   305557..305647,305713..307953,308005..308090)
FT                   /db_xref="UniProtKB/TrEMBL:B6HD72 "
FT   CDS_pept        308776..311103
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181179" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947746"
FT                   /orf_name="Pc20g01360"
FT                   /product="Pc20g01360 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85465.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831115"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD73"
FT                   /transl_table=1
FT                   /translation="MEIDGQPSKRRRRSRKVQSDRKFECTFEGCGKSYSRAEHLSRHAL
FT                   NHTPKQIYRCDFPNCYRSFVRQDLCTRHRERHTTSGSQLQKRDHFTENGTKHSPPSSPA
FT                   ITAPEYFVGSEEPKPPVTTYPLTTGVDSNEIQVDQFSDFPAVLDQPDNLIDLDSMSYPI
FT                   FGGETYNRSPFAMADDFAAWLFSEPVAPLGYGMVPLVQNQFYMNEPAYSNHNFCSVIPQ
FT                   HPMSVTSILDSGAPPAVISEAKRQELLHLMSTRFNESAYAAGAKRKDALMDGDLNDDRH
FT                   ALSLRMMQTYIGSYWYHFHAQLPILHQPTFSADRIPNLLLLAIMAIGAATLDKIHGQSA
FT                   TEAAAELASFIAWHLRWEIFMDADFRPPAKLWVFQSLLLLEVYEKLFSTRALHERAHIH
FT                   HDTTLTLMRRGSSLIGSSSFATPESKEEDESWSTWIKTEATRRVAFAAFVLDSTHATMF
FT                   GHSAKMVAHELRLPLPCDEALWAATSAAEVARVQSSLQSHGVRPIMFLDGLKRTLNGQP
FT                   VRTNAFGRIIIMSGLLSVCWHLNQRDLQISSLGVGQTLGGRDKWRTALLRAFDNWRRDF
FT                   DEALGPSTTSESRNVLHGLAHMGSHVDIADLQIFAGAGRLMGRSITARDYSAAREKTEK
FT                   WATKASARDATFYALKFLSTCFLDSATQPGEYAARDDYLLNRPWVMYFAALVVWTYGFA
FT                   LDGPLRPPPILLTVADRERDMQGFLHRVGEIQEPNELEAMNGRNGCLGLLMILRDSFAK
FT                   PRWELLGEAARLLDSCIAKLQS"
FT   CDS_pept        join(311500..311671,311771..311911,311982..312074,
FT                   312140..312168)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824357"
FT                   /orf_name="Pc20g01370"
FT                   /product="Pc20g01370 protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAP85466.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0001831116"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD74"
FT                   /transl_table=1
FT                   /translation="MANNDQASTNYKEAFSLFDRRGTGRVAGDLLGDLLRACGQNPTLA
FT                   EISDLEKSVGGDFDFDSFLKVLNRPGGFREPGEPEEYCRGFQVFDKDMTGFIGVGQLRY
FT                   ILTNLGEKMSDDEVDELLKAVDTSSGEINYTDLVRTILAN"
FT   CDS_pept        complement(312375..312908)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181168" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947747"
FT                   /orf_name="Pc20g01380"
FT                   /product="Pc20g01380 protein"
FT                   /protein_id="CAP85467.1"
FT                   /db_xref="UniParc:UPI00018311E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD75"
FT                   /transl_table=1
FT                   /translation="MTDQRLPIQTQHCRFCNHLLLATTRNINTLPRRGGESKDKALILP
FT                   LERKSSADGEVEVDLEEEARATETPSRKARHASNHTTLLLATTIPDRRATMIRREDGIE
FT                   KRILLRCGRCKVVVGYYLDRVHWAAGDRGAVRDGEEEDEERPPAVYLLPGAVVETEKLG
FT                   GEGVGEREWREWAV"
FT   CDS_pept        join(complement(313732..315686),complement(313469..313661))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000245985" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947748"
FT                   /orf_name="Pc20g01390"
FT                   /product="Pc20g01390 protein"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP85468.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="UniParc:UPI00018311E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD76"
FT                   /transl_table=1
FT                   /translation="MAPAHLRAPPQAPPIFTATPQSVVADAERLIKNSRAIQDKVVAEI
FT                   KPDDATFANVVRPLAQDDNQMGLESHILGFYQAVSTDSKLRDASSKAEELMDEFFIEAV
FT                   MREDVFGLVDAVLRRNESLDPESRRLLEKEHKDFVRNGLGLPAGPQRLRFKEIKKRLSQ
FT                   LSIEFQKNLNEENGGIWFTPEQLAGVPKDVLDGLKKGEGENAGKLWLSFKYPDLFPTMK
FT                   YASDPETRRQVMIANENKCNQNVPLFRESIILRDEAARLIGYPNHAAFRIEDKMAKTPE
FT                   IVNKFLGDLRDRLTDGGKKEIQKLLELKNATDPKADGRYYLWDHRFYDRLMLEKDYSLD
FT                   QQLIAEWFPLQTTIDGMLKIFEELFGLEFVEIIGEDRAAIAPTGKGNDIVWHDDVQVFS
FT                   VWNDEGEGSGFVGYLYLDLFPREGKYGHAANFNLQPGFVDKDGNRRFPATALVCNFTKP
FT                   QPKKPSLLKHDEVVTLFHELGHGIHDLVSRTIYSRFHGTSTVRDFVEAPSQMLENWCWE
FT                   PSQLRSLSRHYSTLSPEYLATWQEAQEGKTATSQPSERIPDDVIENLIRTKHVNDSLFN
FT                   LRQLHFGIFDMTVHEPKTHADIEALPLSATYNRLRQEITQLDGPEVQGAGSEWGHGEAT
FT                   FGHLIGGYDAGYYGYLSSQVYSTDMFYTVFKDDPMNKAAGRRYRYQVLEKGGSQDEMKT
FT                   LTEFLGREPQTDAFYKDLGLA"
FT   CDS_pept        join(complement(317693..317930),complement(316506..317635))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000270353" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947749"
FT                   /orf_name="Pc20g01400"
FT                   /product="Pc20g01400 protein"
FT                   /EC_number="1.14.19.1"
FT                   /function="heme binding"
FT                   /function="stearoyl-CoA 9-desaturase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85469.1"
FT                   /db_xref="GO:0004768"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001522"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR009160"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI00018311EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD77"
FT                   /transl_table=1
FT                   /translation="MSSKPDATRPRAADTKKVHIADTQMTRQNWYKHVNWLNVTFIIGV
FT                   PISGCIQAFFVPLQLKTAIWAVIYYFFTGLGITAGYHRLWAHCSYSATLPMRIWLALVG
FT                   GGAVEGSIRWWARDHRAHHRYTDTDKDPYSVRKGLLYSHLGWMVMKQNPKRIGRTDITD
FT                   LNEDPVVVWQHRNYIKVVITMGLIVPMLVAGLGWGDWYGGFVYAGILRIFFVQQATFCV
FT                   NSLAHWLGDQPFDDRNSPRDHIITALVTLGEGYHNFHHEFPSDYRNAIEWHQYDPTKWT
FT                   IWTCKQLGLAYDLKQFRSNEIEKGRVQQLQKKIDQKRAKLDWGTPLDQLPVMEWDDYVE
FT                   QAKNGRGLISIAGVVHDVTDFIKDHPGGKAMIKSGLGKDATAMFNGGVYYHSNGAHNLL
FT                   STMRVGVIRGGGEVEIWKRAQKENSEYVRDETGQRIIRAGQQVTKMPEPIPTADAA"
FT   CDS_pept        join(complement(318458..318653),complement(318142..318248))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947750"
FT                   /orf_name="Pc20g01410"
FT                   /product="Putative uncharacterized protein Pc20g01410 "
FT                   /protein_id="CAP85470.1"
FT                   /db_xref="UniParc:UPI00018311EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD78"
FT                   /transl_table=1
FT                   /translation="MRDMTILLQDGKFGQFASAQVLVPHNPLYSVPHTQAMTSFVWRFS
FT                   RPFGEGGRDFQGWMLISGVASTKALGLAGPNIRQKAMRHATPEQRAAQISLSACL"
FT   CDS_pept        join(319847..319938,319990..320156,320206..320385,
FT                   320447..321741)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181157" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947751"
FT                   /orf_name="Pc20g01420"
FT                   /product="Pc20g01420 protein"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85471.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniParc:UPI00018311EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD79"
FT                   /transl_table=1
FT                   /translation="MDGPDQIGPDHTPKRTISDKVRYAVRTFTTREGLLGDYDYGYLFI
FT                   PRLPFAKRARKSAPFFGLDDRVPVVLALILGLQHALAMLAGVISPPILLGGSGGANFGD
FT                   DLYQYLVSTSLIVSGLLSVVQMFRFHIKGTKYYIGTGLLSVVGTSFSTITVAQGAFSQM
FT                   YKSGYCPTLEDGTKLPCPKGYGALLGTSCLCSLLEIGMSFMSSKILARVFPPLVTGPTV
FT                   LLIGASLIKSAMQDWAGGASCGADPSARAMCPSANAPHPLPWGSPEFIGLGFLVFVTII
FT                   VCERWGPPILKSCSVIVGLLVGSIVAAACNYFDSSGIAAAPVASFAWVHTFPLSVYPPL
FT                   ILPLLALYIVIMMESIGDITATCDVSRLQVEGDTFDSRIQGGVLGNGITCLLAGLMTIS
FT                   PMSVFAQNNGVIALTKCANRTAGYCCCFFLVIMGIFSKFAAALVAIPSSVLGGMTAFLF
FT                   SSVAVSGLRIIGSVPPTRRNRFILTASFSIGMGVTLLPEWFSYFFTYKGDNHALEGLIN
FT                   AVDLVMENGFAISAILGIFLNLFIPDEPDDVPAIFESTNSNDAPVQTDIPEQSSTTTKI
FT                   A"
FT   CDS_pept        complement(321911..322465)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234926" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947752"
FT                   /orf_name="Pc20g01430"
FT                   /product="Pc20g01430 protein"
FT                   /protein_id="CAP85472.1"
FT                   /db_xref="UniParc:UPI00018311ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD80"
FT                   /transl_table=1
FT                   /translation="MSEPISRTEARQKSADIKKKQAETLAGLPPGSLHISLYIRSDPPL
FT                   PNDFHWAFYLHNGTSSTPGGTKYHARGVGGGWIAGHEATAGIFTENFLCVVIQIATIPP
FT                   SAHERVDEIMRSYDGSLNSIPGITCRVWILTILRILVDEGFVHCDIGELEKDCFEFGNE
FT                   HSATASANQQPRPVVKSRVSS"
FT   CDS_pept        complement(322753..324036)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181146" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824358"
FT                   /orf_name="Pc20g01440"
FT                   /product="Pc20g01440 protein"
FT                   /function="catalytic activity"
FT                   /function="molybdenum ion binding"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAP85473.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniParc:UPI00018311EE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD81"
FT                   /transl_table=1
FT                   /translation="MSNVDISHGGILPNLIIIFLLSALFLVLKTLTTLKTSNNPKGCRR
FT                   LGLPPGQSNLDDEFDPKYSQGVPSDQDDHGRPSWRVKALFSYPLKSCGAVELQVSNVVP
FT                   TGLEFDRQFVFAEYNNDEWNIRTLRNAGFNRLALIHPEIWVPDPSAPDYDADLPEIKSQ
FT                   GVMLISYPRMLPAGWSSLPIKVGMALKFLKSQQTFQVPLLPPADSKFPLVPVKIWKDKV
FT                   LAHDYGRLLPASLHAYLGSDTSKNTLTLLRASAPHSRQIFRNAPRKEDLGFQPNTAFAD
FT                   AYPIHLLSISSHRDVAARCAYAIPRLSIRRFRANVIVQGPSAFEEDHWKRLAIGGTEIH
FT                   ASCRTVRCRLPNVDPLSGDRHKAEPDRTLKSYRRIDDGDRTNACLGMQLVPAKEKFVLR
FT                   VGDSVEVLETGEHQYIKMLAPGEKVEGV"
FT   CDS_pept        join(324255..324306,324363..324555,324608..324657,
FT                   324708..325261,325315..325638)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181135" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947753"
FT                   /orf_name="Pc20g01450"
FT                   /product="Pc20g01450 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="DNA-dependent ATPase activity"
FT                   /biological_process="DNA metabolic process"
FT                   /protein_id="CAP85474.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006259"
FT                   /db_xref="GO:0008094"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="UniParc:UPI00018311EF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD82"
FT                   /transl_table=1
FT                   /translation="MDLLGLDGLEGFDDGDTPPVVSISASQSLNASAATRHPIATGLAR
FT                   LDEVLNDLPDQPDQGGILRGHVTEIFGPPGAGKTSLALNIACNALRDGKVVWIDTGCPL
FT                   PTPRLEEMSINLDDFIYFRAHTLAHLIALLARPPKGFPPSGTSLLVVDSVSNLFSAYFP
FT                   SAQELKDQLAEGKITDKAHLQWLINRRWNIASELGTHLARVAARNIAVVAINQSHTKVK
FT                   GQSHAVLQPLLSGGAWEASVQTRIAVYRDLPDERLAEVEKRAGKPLPEQAGELLVAFRI
FT                   EPDGLYEMERKDSVPSEPLTPLPKSPDFEYYDPPTPTPSPISSVLSSAPPSPKLESPKP
FT                   PSPKPTSPEKPVQIPNKKRKVEEVADSQDEDSEEEDVPWTNEITLNTNRS"
FT   CDS_pept        326357..327337
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171725" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977583"
FT                   /orf_name="Pc20g01460"
FT                   /product="Pc20g01460 protein"
FT                   /protein_id="CAP85475.1"
FT                   /db_xref="UniParc:UPI00018311F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD83"
FT                   /transl_table=1
FT                   /translation="MSNVPQDLLDGISGALAKEGNTLQMILIAFIGLSCYNVAELVVLV
FT                   PATFRRWRGLYFWSLLISGVLGVVPYSIGFLMKFFTQTDSVLSVTVLTIGWWTMVTGQS
FT                   VVLYSRLHLVLRDERMLRHVLKLIIANVLLLHVPTTILTYGANIVHSGEVAWVNGYNIM
FT                   EKIQLTGFTFQESLLSTLYVIETVKLLRLGADVSSRPDARSIMYQLIGINCAIIAMDLL
FT                   LLSLEYADFYAVQITLKGFVYSLKLKLEFAVLGRLVDLIQGSRHPVSLAIADTLPLCSM
FT                   QRPPETPDRSEDAPYEQAEPKDFLVPPGGGRLVQRRMFMESGRAA"
FT   CDS_pept        join(complement(328726..328769),complement(328650..328669),
FT                   complement(328548..328598),complement(327895..328491),
FT                   complement(327687..327805))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977584"
FT                   /orf_name="Pc20g01470"
FT                   /product="Pc20g01470 protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="CAP85476.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI00018311F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD84"
FT                   /transl_table=1
FT                   /translation="MADRYSFSLTTFSPSGKLVQIEYALNAVNQGVTALGIKATNGIVL
FT                   ATEKKSSSPLIDPPSLSKISLITPDIGMVYAGMGPDYRVLVDKARKVSHTGYKRIYNEY
FT                   PPTRILVQDVARVVQEATQSGGVRPYGVSLLVAGWDEGVEPESEEAKKDDPEEKISSKT
FT                   GGIKKGGPSLYQVDPSGSYYPWKATAIGKHATSAKTFLEKRYTEGLELEDAIHIALLTL
FT                   KETIEGEMNGDTIEIGIVGPPADHLLGYEGVEGAQGPRFRKLTKEQIEDYLTNL"
FT   CDS_pept        join(328803..328985,329059..329673,329724..329864)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181124" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977585"
FT                   /orf_name="Pc20g01480"
FT                   /product="Pc20g01480 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP85477.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00018311F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD85"
FT                   /transl_table=1
FT                   /translation="MERSKEGELCCRQRWVTFGAVELTKGGDQIGISRGVWDTFGFSAF
FT                   LLLVVLFFFNPSKKETHYPPRVCRICLESVLPTFQPSEFLQKPRVVYESSDPECGRLLS
FT                   PCQCKGSSRYVHEGCLQSWRHADPKYGTRNFWQCPTCGFQYRLERLTWARWISSATTQL
FT                   ILTLGILFLTVFLLGFIADPIIDFYLGPVDVYAELVEEDVSWLGHFLKGLASLGLLSFL
FT                   KAIFALSPFPWNLRSVASGRNSGRNRAAQLNWLVVMVGIGTFLWAVYKGVRSWSRRTLE
FT                   KAGERVMDVPLPDDESDTDVPIPDDAGMKEE"
FT   CDS_pept        join(330355..330986,331053..331428)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671675"
FT                   /orf_name="Pc20g01490"
FT                   /product="Pc20g01490 protein"
FT                   /protein_id="CAP85478.1"
FT                   /db_xref="UniParc:UPI00018311F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF6"
FT                   /transl_table=1
FT                   /translation="MDDLPPGSRLAHVRSELAMDSESEESESATPTNADTAKTETEPFP
FT                   EYDESECEMLASSIAADKRREEAWIHALGKATQRENRMLHVDPNIIPYFQSDPSHRSQV
FT                   VLEQLRDLLADPQMRPKIRDQFITMINATLQFNLVIFHQSSEFLAPKEIEDAELHLESV
FT                   LNLVEWMEEDLRDQLETAEQVSYAIEGASLQPTSAYERLCKMASLFANAMKKPRYLERR
FT                   LLSLYMDMYEEWVHTPFLLLRNRQLVNEQDPSPERTKLSRRVIMIWDLMNSCIESYGTL
FT                   TWFTLEIKHQYFAPVMGYLCDSPEIWQYCWDQYQALEKDRAQASEKDLSQCATI"
FT   CDS_pept        join(complement(332390..332691),complement(331607..332321))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000254104" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947754"
FT                   /orf_name="Pc20g01500"
FT                   /product="Pc20g01500 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP85479.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI00018311F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF7"
FT                   /transl_table=1
FT                   /translation="MLGKIALEEAFALPRFREKTKWWAGMFATDTEKHTAEINDVGPIR
FT                   LDFAERHGVGLQILSYTAPGVQDIWDAKDAQALAVEINDYIAEKVKAHPDRFAAFATLS
FT                   MHDPQEAAAELRRCVTQHGFLGALVNDTQRAGADGDDMIFYDNEKWDVFWATCTELDVP
FT                   LYLHPRNPTGTIYDKLWADRKWLIGPPLSFAQGVSLHVLGMVTNGVFDRNPKLQVILGH
FT                   LGEHIPFDMWRINHWFEDRKKMLGLGETCKRTIREYFAENLWITTSGHFSTTTLNFCMA
FT                   EVGADRILFSIDYPFETFADACDWFDSAEMSNTDRLKIGRENAKKLFKLGAYKDSTA"
FT   CDS_pept        join(complement(333212..333559),complement(332980..333138))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234778" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947755"
FT                   /orf_name="Pc20g01510"
FT                   /product="Pc20g01510 protein"
FT                   /protein_id="CAP85480.1"
FT                   /db_xref="UniParc:UPI00018311F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF8"
FT                   /transl_table=1
FT                   /translation="MATRTIYLISARNTSFQRAHFSIFVPSATNPDRGTKIHAVGAPMA
FT                   GYVLEFKRNYNPSLEPHDQTFPIGQVHSSDVVDSPDAAPSIDSTPRGKIELAATQVPTP
FT                   GINQNFMAPVNDTTNKRCQEWTMEYVRHLVAKGLVDKEAIEIVQSKRDPPTHGIGLRSV
FT                   TRPGT"
FT   CDS_pept        join(complement(335222..335599),complement(335084..335168),
FT                   complement(334943..335031),complement(334589..334879),
FT                   complement(334482..334530),complement(333826..334424))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128695"
FT                   /orf_name="Pc20g01520"
FT                   /product="Pc20g01520 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85481.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI00018311F6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF9"
FT                   /transl_table=1
FT                   /translation="MLQSTLTLALASCNDFPTLRDVGSLTSVILLLLALLYKVLYVPVA
FT                   SPPRKDSPPCLRLPSWKVTQLFFEKRFDFIKDGFKATSSSIYQTSLFRHNAIVLSGDEG
FT                   RQLFFKEKGLCLYDTFSIMMGSGAAKFDPHQVGGVVRRMASIQRPDNLQKLIPLILLES
FT                   QQKMNAWGRERILDPCSSLHEVAFQLVMRIASFDIANDPVLSARLKSLVDTVDSITNPY
FT                   STWLPWLPGPALFHKFFASVQIYRIVQAAINARKRSGIKRDDMLQQMIDEGDGTIQIFG
FT                   CMLGLSLAGARATGTIVTWLIMQITSDPVWSSNVQEEVKTFVSTHTLSPSLSGDALIQA
FT                   LSEIPLTAWESQTPNLDLCIRETLRTSQPYTAVRKNIGPDVTIGPYVIPSGSLVVYPFS
FT                   DTALNPNYYPDATRWDPSRGIDKETPFIGWGGGKHACKGQRLATLSMKLMVVYALMRFD
FT                   ITMVDGQGKKINRLPLPDWNDSATCRPKERCGIKFVEK"
FT   CDS_pept        join(complement(338923..339298),complement(338114..338868),
FT                   complement(338003..338053),complement(337282..337944))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000158970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947756"
FT                   /orf_name="Pc20g01530"
FT                   /product="Pc20g01530 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85482.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018311F7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG0"
FT                   /transl_table=1
FT                   /translation="MTKREKIDTLSEKVVPQQPFGTAERARRDLNAKLSNPLAGFSHTE
FT                   LRDQGRTFAELHEMGDESDIRAFELGAVLAQSPERYDNVAGLTNKEKAVLRREVTHRWS
FT                   QPWKMYVVITLCSLSATVQGMDQTVVNGAQIFYKHQFGIGDGSSRSAWLVGLVNSAPYL
FT                   CCAFISSWLTVPFNHWFGRRGTIFIACCLSAITCLWQGFVSTWWAMFVARFMLGFGIGP
FT                   KSATVPIYAAETAPPSIRGALVMQWHVWTAFGIMVGYASDLIFYNVESSAIVGLNWRCM
FT                   MASAMFPALVVCCFVFACPESPHWYIRQKQYYRAYRSICTLRNHKIQAARDLYYMHTLL
FT                   EAENSIKLGRNKLLELIKVPRNRRAMLASQIVMFMQQFCGVNVISYYSSEIFLEANFSP
FT                   PAALAASLGWGLINWLLSIPAIYTIDTFGRRNLLLLTFPLMSMAMLFTGFSFWIPESSH
FT                   HARLACIALGTYLFGVVYSPGEGPVPFTYTAEVYPLYVRSYGMALGTATMWFCNFLLGV
FT                   TWPSLRAAFTTQGAFAWHASWCFVGWWMILLFMPETKGKTLEELDQVFSVPTRLHARYG
FT                   LRQIGYFFKRYLLRRDIRPEALYEREELVKAQDVGFNA"
FT   ncRNA           complement(340079..340159)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR56"
FT                   /db_xref="Rfam:RF01188"
FT   CDS_pept        join(340636..340675,340738..341011,341080..341427,
FT                   341485..341674)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181113" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947757"
FT                   /orf_name="Pc20g01540"
FT                   /product="Pc20g01540 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP85483.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00018311F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG1"
FT                   /transl_table=1
FT                   /translation="MDDAESPRLEEQQTPTKSPFTNVRTDGRAFNSPNWRMKAESPATP
FT                   SRTNASPSANPNTSRAAFSRPGAHVPQAINDGRRLYVGNMPYTAKMEDVEALFIAAEFP
FT                   IERIDIAIDPFTGRNPSYCFVDLQNKEHAERAMTELDGRDMLGRPVKIKPGVAKSQERI
FT                   QNPPEPFRIDCWRQQERPSFAKVNSDSSSRVYVGGLPRLTDHGAVQTNIEMFFKGFKVE
FT                   HVSKLFTPHPAKRFEPGEHYYLFVDVGSPEQALKAMDTLNGREGPWGGPLRVQFARGTK
FT                   DT"
FT   CDS_pept        join(343174..343273,343325..343911,343967..344632)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181112" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824359"
FT                   /orf_name="Pc20g01550"
FT                   /product="Pc20g01550 protein"
FT                   /function="6-phosphofructo-2-kinase activity"
FT                   /function="ATP binding"
FT                   /biological_process="fructose 2,6-bisphosphate metabolic
FT                   process"
FT                   /protein_id="CAP85484.1"
FT                   /db_xref="GO:0003873"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006003"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR016260"
FT                   /db_xref="UniParc:UPI00018312CF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG2"
FT                   /transl_table=1
FT                   /translation="MPIANFGTQSDDSKICVVMVGLPARGKSLIAGKAMRYLGWVGIPA
FT                   RVFNVGSYRRFSTPQPQAGFFDPHNEEGERMRRAAAEAAMSDMLQWFNTGKGVVAILDA
FT                   TNSTKDRRRWIYEKCTEAGIEALFVESICDDEDLIMTNIKEVKTTSPDYKGQDPEVAAL
FT                   DFRNRIRNYEKVYETIDDDEKSYTYVKLINVGSTVIINQIKDYLSSRLVYYIQNIHIKP
FT                   RSIWLSRHGESEFNLTGRIGGDSNISERGEAYARALPELMRKSGIPDNTKIVIWTSTLR
FT                   RTIQSARHLKAETGYETLEWKALDELDSGVCDGLTYEQIAEKYPEDFAARDEDKYNYRY
FT                   RGGESYRDVVIRLEPIIMELERSENVIIVTHQAVLRCIYAYFMNVPQEQSPWMEVPLHT
FT                   LIKLTPRAYGTEEQRFKADIPAVSTWRGKGTSAKHQEFPAEGKKEDTETKN"
FT   CDS_pept        join(345120..346551,346599..347414,347465..347573,
FT                   347625..348059,348118..348175)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181091" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947758"
FT                   /orf_name="Pc20g01560"
FT                   /product="Pc20g01560 protein"
FT                   /function="binding"
FT                   /function="small GTPase regulator activity"
FT                   /protein_id="CAP85485.1"
FT                   /db_xref="GO:0005083"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001180"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019452"
FT                   /db_xref="InterPro:IPR019453"
FT                   /db_xref="UniParc:UPI00018312D0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG3"
FT                   /transl_table=1
FT                   /translation="MLSAFTARPLVELKPRDKSRIDSVLAYGDRLLAGLNNGNLRIYRV
FT                   TDDGKTELLRELEKFSRYKIEQLALIKEANVLVSLSGGYVSLHDAQSYELVEQLAQTKG
FT                   ASVFAITSNVVNDVDTNVPAIVSRLAVAVKRKILMWAWRDMELERDTAELSLVSGVKTL
FT                   TWVAATRLVVGLNSSFVMVNIESGQFTDLAGPGSIEESGRFTGVGAASMSYIGMGGMVP
FT                   RPLVTRLREGEILLAKDVNTNFIDVDGQPLGRKQVPWSHAPVELGYSYPFLLALHDSSK
FT                   GVLEVRNPETLSLLQSVPLPSASILHIPQPNISLAHAGKGFLVASDRTIWRMEALSYDT
FT                   QIDALVEGGYLDEAISLLGVLEDALLRDKPGRLRATRLEKAQSLFALNKYRESLDLFTE
FT                   VSAPPESVIRLYPRLIAGDLSTVPEPEVANGKANGSQSDGSSDDVAAGQASTHAASIIS
FT                   SVRKPDEGSEASSIRGDDKGLRIAVRELQGYLADVRRRFQRFLNPDGSLKAPVPVEATD
FT                   EASDSVLKLLDFPSPDEFATQICAKARLVDTTLFRAHMFATPSLAGSLFRIANFCDPEV
FT                   VMERLEETGRYNDLIDFLYGKKLHRQALELLQRFGQTDNGPLSGPTRTVAYLQNLPPDQ
FT                   IDLVLEFGEWPLRANHELGMEIFQTDTENAETLPRPRVLGFLEGIDTTLAIQYLEHVIH
FT                   EWNDMTPDIHQRLLILYLDQLTSNEQGEWKEKFLTMLKESEQYSPAKMLDRLDREDPNY
FT                   YEARAILFSKMGQHRQALEIYVFKLADHEKAEEYCNQVHLAEKAEEENSIYLTLLSLYL
FT                   SPPHGYEPQNDPAIDLLAKHGSRLPADAALKLIPDKQAVQKLEFYFKGRMRAANSVFNE
FT                   ARIVANLRKARDMQIQAQLALGEGIRGGGTRARHVTVTEERICGVCHKRLGGSVINVFP
FT                   DDTVVHLGCVNRKPSVRAG"
FT   CDS_pept        complement(348362..348637)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181079" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947759"
FT                   /orf_name="Pc20g01570"
FT                   /product="Pc20g01570 protein"
FT                   /protein_id="CAP85486.1"
FT                   /db_xref="InterPro:IPR014849"
FT                   /db_xref="UniParc:UPI00018312D1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG4"
FT                   /transl_table=1
FT                   /translation="MASNTSLSAVYTAPQVTETFEHVISTTTGTLAAKQAHLSALQSLV
FT                   PKLQDQINVFLTERMEEDKKVQGQLSAQEAKEEENYGEEVVEDMIA"
FT   CDS_pept        349265..351778
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181068" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977586"
FT                   /orf_name="Pc20g01580"
FT                   /product="Pc20g01580 protein"
FT                   /protein_id="CAP85487.1"
FT                   /db_xref="InterPro:IPR013745"
FT                   /db_xref="UniParc:UPI00018312D2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG5"
FT                   /transl_table=1
FT                   /translation="MNPTFRSPNSPGRQAPAPRYPRPPSDDEEEDDSDEDELVRPGSSG
FT                   SDASSNVTTVSAAPVTPINTQQPGGYFPPQPRSATSPHHPMPNPSGRRPSGRGPSVELP
FT                   RHRSRHHSQGFFEPSLPTASSDQVPTVSASRIAAQAAMQQTKKQQNVTTPVEDGSRPRR
FT                   SGSSSPPLMPAPLRVNQPSPQPPPPSGNVATTAANVVFPRAGAAPAEQQPEKQKKKKLF
FT                   SKPKHIGISSHKDLGKDRGLPSPSKISGLSRMVSGSTTNLADLSSNNSSMYNLSNASVS
FT                   TVVPADRPPIQEKEKEKDKDKHKHHFLSRQKLKLKDRVEDHFNLPLSSASSNSRPADPN
FT                   APQSLYSFTPASPAPGATFGKSVSGLDLLHGGRALREKKKEEKALAESEQMEWLANNAG
FT                   GPTTPGGFPGPSSVGSSGTLPESMLRETLQGFGLNNMTPEDAWDFLKAKLLVIFDGEDV
FT                   RIAIEDLNKLVLVHLQRCVLKRAPTSIVVDLQELLETGFATLNHSSLIGLPDEKLVPHL
FT                   VQVWLLVFGTILPFIQAVFLPLDLEFKGCGSLMTSREAGEFWGALPVGGTLDVRSLVLI
FT                   AFRDCMILNRYDALKATFSRLSLDSINSGFPTLSVTAKSTGTGGRPGTAASLDAGFGSY
FT                   TSQSSTLLSTVTDSYSSDGISALANHPRPTSSDSRSRATSNTSSNADPLFFQSITSPPT
FT                   SNKRPTVIHRGNTSADSSHVITETVGRMLQCISVLASVQTDDASQERIEILSKALKHNW
FT                   LGRGRTGRDRRGFVGAKIRPVMVGGPPVIDDGDSLTTAGISIGASTSTGGSRGRGDSSS
FT                   SEWSSNVPGPGMSMRSGGRRELSVL"
FT   CDS_pept        join(complement(354726..354911),complement(354275..354620),
FT                   complement(352500..354208),complement(352207..352395))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947760"
FT                   /orf_name="Pc20g01590"
FT                   /product="Pc20g01590 protein"
FT                   /protein_id="CAP85488.1"
FT                   /db_xref="UniParc:UPI00018312D3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG6"
FT                   /transl_table=1
FT                   /translation="MASDRTIRDLFPALVVGLERETSATPSVHDSDASFHPSQSPTPVN
FT                   KQTLPAQDSIEVKAPTPTADLLLLDPHEFSLLQLKRILRTTYLQLVTLCLTIPVGAFIP
FT                   ALDPQTTNTNSNTEGRPKDASHILTPRIRVVMRKGPREPTPDSDTVSESSKKQHPKDVT
FT                   PITPRRRIVITKKSRAEGRPNEATPTSTPRVRIVVRKRSREITEDSDTVSDPTSAKGTK
FT                   DVTPIPSHSSQDSIHSTAPSDPRNPSSYLESNLLNSAEEPPVDSNMDSPKPTAVSTSHE
FT                   SSSDYDETSISVNPTSELPATSMSPNSRSSSEEAPSRDAGHLSPTLDFVPSTPPHPSSD
FT                   SSMGPPTDPSMDPNMVSHRQPLDSAVIPGNPSFEDPDVLPSTFMYPEETFDQSNRAIDP
FT                   MGVYTPEEYARILASEQEVLREMADPHTDIATHLYSQTEDPYYTTINDLNRHTDTSTHL
FT                   YSQTEEPHHTAIDDLDRHTDISTHPYSQTEEPHYTTIDDMDRIFAEMEAATAGMDFLQP
FT                   EFWAAIGRDLSSPSQPGALESDQHAQAPTTSGTLQSVEGTDLGSVPKRARHSSPKTKSP
FT                   SPDLSSTLSVKTSVSMPSRSASSKAKSTTPPAMSASNRRRSKDQSVTPAPTASSSRRRS
FT                   KASTKTETATPEPRATVTVSPRRLRSSDVMPRPSTNTKKNPQGNATPDSWDTAPTADKM
FT                   MSQMKETESMSWFDITAAWNQNRSDLDDEMTWRALSKRWGRIKDRIGPWPGFDEALLDA
FT                   FSQFNSKPDDESFAQIAEDISIQLGWDVSGAACQGRYDVLEEAGKIDLKGKGRARK"
FT   CDS_pept        join(356424..357081,357152..359073,359137..359295)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181046" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947761"
FT                   /orf_name="Pc20g01600"
FT                   /product="Pc20g01600 protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAP85489.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI00018312D4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG7"
FT                   /transl_table=1
FT                   /translation="MDHTSTPTEAKDEVVPSENLNGSAQPAEVKDVREVKDAATAPAPE
FT                   TTPASAPKLCKKHKKKNKKKDESDSSSDSSSSSSSSDSDADSEDASDSTESDSDTEKRK
FT                   RHRLRKARARRALRDKKRRKKRKQRSRKAETSDSESDSEEESDSVSSTDSDDDIDDKAL
FT                   RKLVTKLKLSKKRAKKLRELAADDLAASDSLGETRREKRSKKKKPASKVAYKRVDQLWD
FT                   TTIHKYKLTETVDDPDADEWDQYIFNIRRKFNWENKYLETVVDIKSKPLRDALSKIMDG
FT                   VKGVSLVQEPAVVDPNMLFLYLEETRQYMKDLKKQSRSEKKRKVRKAAAVKAAHLKVLI
FT                   KYLDTDYADIKKTLYPLLEANTITFDLLWALYKPNTIAYTPTYGSTDEPRAFKIEYAIK
FT                   ESSFMKGQWYSVDGRYLEYDGKDYGFGTMSAEVDSFKGARKITSLACYPLKYHRDAEAL
FT                   RARLVERGKRFVALRGMNYRFHKGMAFYKKKRSLIIKVNINGRVMIDPAIHRRINPNYP
FT                   ISTVRPKDPDLIDPEDLGISGDEGEDSDGCCCGGSDSDSEHGGASDTPRTMYKVVEDTE
FT                   GCPRVVEVEVDENGTEIHKEKMDRIEGAASGSKDREFTEEELLIASPVVLGFAFSEKLW
FT                   LEFTISGISDIEWDKEAFGSLVLPSNQKSIVKALVESHTFHAAQNIDDVIQGKGKGLVA
FT                   VLHGPPGTGKTLTAEGIAELLRRPLYMVSAGELGTDSRTLEAELNKILDIAHSWGAVLL
FT                   LDEADVFLEKRTIHDIHRNALVSIFLRLLEYFQGILFLTTNRVETFDDAFQSRIHVALR
FT                   YGDLTSKAKRSIWKMFLERVRAIEGVNIASFSEEDYDMLSRHTLNGRQIKNSVRTAQAL
FT                   AVNEKAPLSMDHIKRVLEVAETFDQDLRGGTGYLDAMRSYT"
FT   CDS_pept        join(complement(360795..360860),complement(360624..360741),
FT                   complement(360323..360567),complement(359670..360263))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213792" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947762"
FT                   /orf_name="Pc20g01610"
FT                   /product="Pc20g01610 protein"
FT                   /function="L-malate dehydrogenase activity"
FT                   /function="binding"
FT                   /biological_process="glycolysis"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85490.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0030060"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniParc:UPI00018312D5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG8"
FT                   /transl_table=1
FT                   /translation="MFAARRTVNLFQKRAFSASAINASKVSVLGAAGGIGQPLSLLLKL
FT                   NPRVSELALYDIRGGPGVAADLSHINTNSTVTGYNPDASGLRDCLEGSEIILIPAGVPR
FT                   KPGMTRDDLFNTNASIVRDLAKAAAEAAPKAHVLVIANPVNSTVPIVAEVYKARNVYDP
FT                   KRLFGVTTLDVVRASRFISQVQNTNPAGEAVPVVGGHSGVTIVPLLSQSNHSSIAGQAR
FT                   DALVNRIQFGGDEVVKAKDGAGSATLSMAMAGARFAESLLRAAQGEKGVIEPTFVDSPL
FT                   YKDQGIDFFASRVELGPNGVEKINSVGEVNEYEQGLLDACLTDLKKNIQKGVDFVKANP
FT                   "
FT   CDS_pept        join(complement(362604..362606),complement(362457..362556),
FT                   complement(362219..362400),complement(361720..362163))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217458" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947763"
FT                   /orf_name="Pc20g01620"
FT                   /product="Pc20g01620 protein"
FT                   /protein_id="CAP85491.1"
FT                   /db_xref="UniParc:UPI00018312D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG9"
FT                   /transl_table=1
FT                   /translation="MNSLFNSALKQSSSIRRDLDTFSQSPTTSSPALQGQLAASLASLS
FT                   RTVDDYSALSKKELIPEKQQKAFDRVKNFRNELMDYRTQFDRLRKEREDAQSVTNHNEL
FT                   LGRRPHHTATPENPYAQSSLPQSTSAFTPSSSDLGFGASPADYNRETNALREQSFFSNT
FT                   HNQLDDFLDRGRAVLADLGQQREVLKGTQRRLYSVANTLGVSGDTIRMVERRARQDKWI
FT                   FWGGVVIFFLFCWAVLHFLR"
FT   CDS_pept        join(complement(365916..366025),complement(365808..365857),
FT                   complement(365524..365747),complement(364396..365462),
FT                   complement(363737..363859),complement(363252..363663))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000281566" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947764"
FT                   /orf_name="Pc20g01630"
FT                   /product="Pc20g01630 protein"
FT                   /function="dihydrolipoyllysine-residue acetyltransferase
FT                   activity"
FT                   /biological_process="pyruvate metabolic process "
FT                   /cellular_component="pyruvate dehydrogenase complex "
FT                   /protein_id="CAP85492.1"
FT                   /db_xref="GO:0004742"
FT                   /db_xref="GO:0006090"
FT                   /db_xref="GO:0045254"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI00018312D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH0"
FT                   /transl_table=1
FT                   /translation="MVASAIRMRTPSAMFMSRGAAAMRRPQVSSKLQEVIQTQVPALSA
FT                   LSRFYASKSFPPHTLISMPALSPTMTAGNIGVWQKKAGDALQPGDVLVEIETDKAQMDF
FT                   EFQDEGVLAKVLKESGEKDVSVGSPIAVLVEEGSDVSAFESFTLADAGGDKPAPTEQKE
FT                   EPKSAEPSTPAPAEEAPAAQEPETSGEKLQPSLDREPSISPAAKVLALEKGVSIKGLKG
FT                   TGRGGVITKEDVEKAKPATTAVSGEATFEEIPVSSMRKTIANRLKQSMTENPHYFVSTT
FT                   LSVTKLLKLRQALNASADGQYKLSVNDFLVKACAVALLKVPQVNSSWREENGQAVIRQH
FT                   KTADISVAVSTPTGLITPVVKNVQGLGLSSISKQVKDLGKRARENKLKPEEYQGGTFTI
FT                   SNMGMNAAVERFTAVINPPQAGILAVGTTRKVAIPVETEEGTVTEWDDQIIVTGSFDHK
FT                   VVDGAVGGEWIKELKKVVENPLELLLISPDYVLIPSRTNMSYADAAAKGPKQSPEDVRI
FT                   QTRIFTLRRAPPVGGIYRDESESTASLIDVDGPHVQTVESDFLKHDVQTTTQAERIDRE
FT                   AEEKEKREDEEKKKARSQKAKSSGICGNTSNPVFIANAAIATVVGAGLGFGVYKQHARG
FT                   NLSWELVGLSAGAVGIFGAVDYFVSK"
FT   CDS_pept        join(366479..366631,366747..368536,368588..370863,
FT                   370914..372300,372364..372700)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181045" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947765"
FT                   /orf_name="Pc20g01640"
FT                   /product="Pc20g01640 protein"
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /function="binding"
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85493.1"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR015403"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018313A7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDP9"
FT                   /transl_table=1
FT                   /translation="MDMYITLNVHALLYVCLQNQTMSILPGKRGAVRTLESPTPAGTRG
FT                   SIILAEITPPGVSLTMADTELGSEPTQSIEMPKKPVETPDISPTVPNSDEPALPEQTEP
FT                   QEPVQKGDEEVPKGQDDEEKPEVPPKDEPEQTEQEPQTDGPPTIQEPPQDDNDATESRL
FT                   RSDSRSTTATFMTQRSSPVSSTVFIVTALDNIAASRDARRDKKLEDATQVALANIRQPD
FT                   GQAIDPELIFRPLHLASKALSIPLQVTALDCIGKLITYSYFAFPSAETENNATREQPPL
FT                   IERAIDAICDCFENEATAVEIQQQIIKSLLAAVLNDKIVVHGAGLLKAVRQIYNIFIYS
FT                   KSSQNQQIAQGSLTQMVSTVFDRVRTRMDLKELRVRELEKPSSTLDASASDVGQTSETA
FT                   SMPVADQPVTKEPTTEKLTLQSFESPKEVTGVNDNAPTTVTRAKRSATRSMSGIPEEKD
FT                   DDSSAEDDVDEIYVKDAFLVFRALCKLSHKVLTHEQQQDVKSQNMRSKLLSLHLIHYLI
FT                   NNHTATFISPLAAIKNSSSSADGMNLLLAVRPHLCLSLSRNGSSAVPHIFKVCCEIFWL
FT                   MLKDMRVMMKKELEVFLKEIYLAILEKRGAPAFQKQYFMEILERLGGDPRALVEIYLNY
FT                   DCDRTALENIFQNIIEQLSRYSSVPVVTTPSQQHQYQEQHTKMSAIGSEWHHRGTLPPS
FT                   LTSAHIVPTPPPSMPHIPSEYGLKQQALECLVEILRSLDNWATHRIDEQPEAAMPSKSM
FT                   DNSRESLDTSVLVSPHPETLEGGTGRSTPMPEDDPNQIEKVKQRKIALTNAIQQFNFKP
FT                   KRGIKALLKEGFIQSESPEDIASFMLRTDRIDKAVLGEYLGEGDPENIAIMHAFVDLME
FT                   FTKRRFVESLRSFLQHFRLPGEAQKIDRFMLKFAERYTTQNPNAFANADTAYVLAYSVI
FT                   LLNTDQHSSKMKGRRMTKEDFIKNNRGINDNQDLPTDYLGAIYEDIGSNEIVLYTEQEH
FT                   AANLNPQPAAPTGLATRAGQVFATVGRDIQGEKYAQASEEMANKTEQLYRSLIRAQRKT
FT                   AVKDALSHFIPATSERHVGSMFNVTWMSFLSGLSAPMQDTSNLETIRLCMEGLKLSIRI
FT                   SCAFDLETPRVAFVTALAKFTNLGNVREMMAKNVEALKALLDVAFTEGNHLQGSWRDVL
FT                   TCVSQLDRLQLLSDGVDEGSLPDVSRAPSSADTSRRSMQSTRRARPRSVNGPTAFRPEI
FT                   AMESRSADMIRGVDRIFTNTANLSHEAIIDFVRALSEVSWQEIQSSGHTDSPRTYSLQK
FT                   LVEISYYNMTRVRIEWSKIWDVLGQHFNQVGCHSNTMVVFFALDSLRQLSMRFMEIEEL
FT                   PGFKFQKDFLKPFEHVMANSTTAAVKDMILRCLIQMIQARGDNIRSGWKTMFGVFTVAA
FT                   REPYEGIVNMAFDHVTQVYNTRFGVVITQGAFADLIVCLTEFSKNSKFQKKSLQAIETL
FT                   RSTVTKMLRTPECPLSHRGASAATFQDNGTNLAKQLTRQSQEEQFWYPILIAFQDVLMT
FT                   GDDLEVRSRALTYLFDTLIRHGGDFPRDFWDVLWRQLLYPIFVVLQSKSEMSKVPNHED
FT                   LSVWLSTTMIQALRNMITLFTHYFDALEYMLSRFLELLTLCICQENDTIARIGSNCLQQ
FT                   LILQNVAKFKQEHWSQIVGAFVELFSKTTAYELFTAAVSMSKPAEAVNGDLTQSPDAAV
FT                   ATSDLPDALQPNGSQSTSSIHDGGDPPVQSEARAELEDYRPQSDQQQPAAVTAARRRYF
FT                   NRIITNCVLQLLMIETVHELFSNENVYAQIPSGELLRLMGLLKKSYQFAKKFNEDKDLR
FT                   MQLWRQGFMKQPPNLLKQESGSASTYVRILFRMYHDEREERQSSRAETEAALIPLCADI
FT                   IRSFVRLEEDTQHRNIVAWRPVVVDVIDGYTNFPQDDFNNHIETFYPLGVELLSRDLNP
FT                   EIRVALQSLLRRIGEVRLGIAPPNPLDVPISPRSSVSQKVPRRDSQV"
FT   CDS_pept        join(complement(373601..373693),complement(373047..373528),
FT                   complement(372863..372992))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128696"
FT                   /orf_name="Pc20g01650"
FT                   /product="Pc20g01650 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /protein_id="CAP85494.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018313A8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ0"
FT                   /transl_table=1
FT                   /translation="MSKFPEVQGGGSLIIAWQIRDKHVLVVGGGEVAAGRILHALNADA
FT                   RVTVVCPAAGLNEEVNFRVTEKQVTHIDRNFEPSDLDNVDMVLCAIDDPEASTQVWKLC
FT                   KERRIIANIADVPPECDFYFGSVHRDGPLQVMVSTNGNGPKLASIVRKKISETLPTNMG
FT                   AAIENVGKLRKKLREVAPNPDQGPKRMKWMSGVCETWSLDELVQMTEEDMDSVLSFYES
FT                   GKIPALEEVRNK"
FT   CDS_pept        join(373867..374132,374249..374369,374424..375506)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210451" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128697"
FT                   /orf_name="Pc20g01660"
FT                   /product="Pc20g01660 protein"
FT                   /function="magnesium ion binding"
FT                   /function="ribose phosphate diphosphokinase activity "
FT                   /biological_process="ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="CAP85495.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004749"
FT                   /db_xref="GO:0009156"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="UniParc:UPI00018313A9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ1"
FT                   /transl_table=1
FT                   /translation="MRGVQIFSGNSHPGLADTICERLGTVPAKANLGKFANGETSVNIG
FT                   TSVRNQDVYIIQSGSEKINDSVMELLIMISACKGGSAKSITGMLYFPYSRQSKKKSHRG
FT                   AITARMLANLLTIAGVDHVITMDLHASQMQGFFGKPVDNLFAEPFIARWIRMNVPGWKD
FT                   AVVVSKNAGGTKRVTSLADTLKLNFGIVTTDRRRPKVPVATMTDSTVFFDAVDEDPIPT
FT                   EDAQPFELRMQGYNRTTATPPIPEEQEPITPPPARYLLRPETPPAARRPSELEAAYEYT
FT                   DVRVRDVITGRLVQGQLVDDDYRANEDSQSGGTTPGAGSSSHDNTETIPDAMVNSIVSN
FT                   ASSQPDHALGGSFDAVESDDEASVCAGQVDERTITLVGEVRDRSVFLVDDMIDKSGSWI
FT                   AAAETVVKRGGASKVYCIATHGLFGENSLDQMEACPSIDHIVVTNTFPISPSMLRRSKK
FT                   LIVIDVSSLLAESMRRHHYGERFVFTDPGVV"
FT   CDS_pept        join(378412..378544,378687..378976)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947766"
FT                   /orf_name="Pc20g01670"
FT                   /product="Pc20g01670 protein"
FT                   /protein_id="CAP85496.1"
FT                   /db_xref="UniParc:UPI00018313AA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ2"
FT                   /transl_table=1
FT                   /translation="MANQCSGHVFAIVQATNGNILTWRCSDCNSGPFVAIWRCKICGHY
FT                   ICICFLSISSTDLLLCMNPVQGYFPLGAGLPAHFVAFVWRVFVHLMCSKSPQKFLMHLH
FT                   LASGGVIDRFPPPLSHSSYSLFYYGYVFYILDLDFP"
FT   CDS_pept        join(complement(382509..382569),complement(382046..382446),
FT                   complement(381837..381989),complement(381156..381777),
FT                   complement(380849..381109),complement(380328..380788),
FT                   complement(379701..380249),complement(379634..379648))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167917" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977587"
FT                   /orf_name="Pc20g01680"
FT                   /product="Pc20g01680 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP85497.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="UniParc:UPI00018313AB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ3"
FT                   /transl_table=1
FT                   /translation="MHKFREKFEQGIDHLEESFKDAHIHDVKAEATHLKAKVGKFFNII
FT                   NPNHRHDEEHEQETDRKRSEIADSHRFKSFAPVHDGNRVKWYVDGKDYMWAVSEALEKA
FT                   TETIYIADWWLSPELFLRRPPVENQQWRLDQVLKRRAEAGVKIYIIVYKEVNQALTCNS
FT                   AHTKHALRNLCPEGTPGYGNIRVMRHPDHNIFENAADMTLYWAHHEKFIVIDYNVGFIG
FT                   GIDLCFGRWDANQHPLADVHPRGLRDDIFPGQDFNNNRIMDFQSVEDWQSNEVSKIDFG
FT                   RMPWHDVAMGLQGDCVYDIAEHFVLRWNFIKRDKYKRSHDVDWLLMEGRTGEEEDIIAV
FT                   QRPKYPCGDYVQHPLTPLSSKPRGNVGTVRAQIVRSSDDWSSGILNEHSIQNAYCETIR
FT                   NAQHYVYIENQFFITATGDQQRPIFNTIGRAIVDACVRAGKEGRKFRVIIVIPAIPGFA
FT                   GDLRDNAALGTRAIMDYQYKSICRGEHSIFGQIEKEGIDPREHVFVFALRAYDRINKTP
FT                   VLEDLEKQADVTYQDIQRGIAETIMSESVHPAVGKDGDDNEKDYAADQSAKEETLRKLQ
FT                   KFQEKVDQRKAGDGFNSKDSVAHCTMLNGGKVSEESWEGDAEAEKANFVQEELYVHGKV
FT                   CIVDDRTIICGSANINDRSQLGSHDSELAIVMEDQDLIDSKMNGQPYRASRLAATLRRQ
FT                   LWREHLGLLRAQDYDASGDPNAQPPDVSLNKIDEGPENEFVMDPLSDGVWNTWTSQATG
FT                   NTETYRMLFRADPDDHIKTFEDYDNFRPRGTRKEGHLFDPYMPAKDVREKLDLIKGHLV
FT                   WLPLDFLRDAEMAEPGLAVNQITESIYT"
FT   CDS_pept        join(383870..383885,383933..383961,384011..384669,
FT                   384724..385041,385094..386651)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172229" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947767"
FT                   /gene_name="RFX"
FT                   /orf_name="Pc20g01690"
FT                   /product="Transcription factor like protein RFX-Penicillium
FT                   chrysogenum"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAP85498.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR003150"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00018313AC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ4"
FT                   /transl_table=1
FT                   /translation="MPPELGYLVPGANVLIAPQSRPGTADPVRARSEALSRASRRPRSR
FT                   GSTASIHSSTTQQTQDQHLDGFPQFMPSQVGTGQHMFNNPEDMLMRFGHQLSHHNGAPL
FT                   DQSMQDTHAGMSRTEDFPNHPMQGHPLSHHPIQPEIASGLSGVSVPQYQPMYDSGVENH
FT                   LPDHIVEDQEVSEPGTKKKRGASSTVANDNELRKLLRQYEGWSLKQMAAEVMKNEGGGG
FT                   KAEKVKQVFAMIWLRENCRKSSGSVRRDRVYCCYAENCGTERVSVLNPASFGKLVRIIF
FT                   PNVQTRRLGVRGESKYHYVDLSVIEEKQQKLAPLNPQIAHHSTGPASMPSRAASAMRSR
FT                   SASVQQPTADTAVFPSPTTSFPPRFPNNASPADCNCQSHTPSGPEATITRENVAQQAGK
FT                   MIHQMLQFPTDENPLVDNDTLQLPDIRAYLPSNTDLKVAAALAALYRSHCISVIDSFRY
FT                   CKERNLMKYFSAFHGTLTVPVQKLLTHPNLAPWIKECDWMMYQKMIAFVAPLTTQVVPK
FT                   PVLDAFNSISQRLCGHIAETFKTQPTHVSIARLIPAHIFCNLLKHMLDVNQAANAAAAW
FT                   LCHPDNRNQMWTDFKTMVNPRDMMTKANIPTCAELATEQILKHDIRALLTPLSDADPSA
FT                   SLLFFTQPDTPDSVEAHKFPVESAPGDEYNFPDKWVQFILNIPAAFANHRTQCVIEKVD
FT                   ALWDSVLHRLTLAGAPSFSAWWMTKVFFHEMMVWQAEKGGFMRNTPGSLQSATFGPESL
FT                   GHFQMKQASVPETSPFEASNDSQAKSNPSPPVAHNGHQSHPPSQHPEFKHPPTEKRLSL
FT                   QDPGFQGHNNDDSAIDLEDDTMLLAVGKYGDMMVSDPADAEGDVVVI"
FT   CDS_pept        join(complement(388460..388559),complement(388295..388416),
FT                   complement(387469..387705))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824360"
FT                   /orf_name="Pc20g01700"
FT                   /product="Putative uncharacterized protein Pc20g01700 "
FT                   /protein_id="CAP85499.1"
FT                   /db_xref="UniParc:UPI00018313AD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ5"
FT                   /transl_table=1
FT                   /translation="MPHLPSLCLGWALWVGDNAAMTGSASIGGPEHGALCGSFGPMSIS
FT                   RTRHRVSQDVNPRPDMSGMSSGVEAILLHDLLQLYILRWSAAMKLKLTWLEPSKCLGIA
FT                   PEEEREKEWKLASTALLPSELMTYCEAAKFCLPDLRCLYFPALALLSA"
FT   mat_peptide     join(complement(388460..388502),complement(388295..388416),
FT                   complement(387472..387705))
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ5 "
FT   sig_peptide     complement(388503..388559)
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ5 "
FT   CDS_pept        join(complement(391090..391409),complement(388623..390954))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168785" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128698"
FT                   /orf_name="Pc20g01710"
FT                   /product="Pc20g01710 protein"
FT                   /function="sulfuric ester hydrolase activity"
FT                   /protein_id="CAP85500.1"
FT                   /db_xref="GO:0008484"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI00018313AE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ6"
FT                   /transl_table=1
FT                   /translation="MKVVHAVHAYLSHGIRRVRLSPGETLDAIWDFSRRYFFTLAFLSL
FT                   FSAKILHLYAHIYSLPLPRLFLWGLTFFFQDVMILLLFRILAQKVAWRPGAALLAILVI
FT                   PSSLLVSFMAAANTSFYVFTGAEIHWRQAKSFNGDAAAIHTLLTGLTGFLIVEGILLTL
FT                   SLFAAHSIHAITGGILHVWAWPVRWLFARVRPHVEPLVRRFWPSKSPDLPDPRIYEQID
FT                   MEDNDSDNEEGDHLLNTGAQLPNRLPESKRVTDGVPQRALILGLFSLFLFLRFMRPWDQ
FT                   VYMYMSTTLPLTTVIEGAERHSPVVTTGTPGLFEYLDGVTALGPAPRWSWMSKEPIAGF
FT                   DDWDQSDPLALHYNPHEDPLHISNLNKPVLEEIHNALASGDVKIKHVVFLKLESARADI
FT                   FPLQKDSFMYKRIAETWKDKTIPPEVVDRLANLTRTAEYLTNFPNGFEHDDARFNGRKA
FT                   YGGISAKNAITSATYTLKSLTGSFCGVTPLVADFNREFDHHIYQPCLPHVFDMLSQQSD
FT                   ITNDTDDFTKWPWHSTFMMSVTEMYDNQDKLTPQLGFRDKQTKETIIKPEAKHYPVTSP
FT                   EVNYYGYPESELREYIRDAIDDAERDHQRLFLSHLTSTTHHPWGVPNDAYEDLMGSKSG
FT                   ANNDMNRYLNSVGYVDDWLSDLIDILEEKGVANETLFVMAGDHGLSLPNDGGITPYDNP
FT                   HIGSFKVPIVIAHPQLPPVQIDTPVINTQIVPTIIDLLIESASLSKDSTTAARDIRSLY
FT                   EGQSLIRPQVVQQDGRESWHFTVMNTGGSWLSVRSAARPEFRLVIPLVNDVEWRFSDVS
FT                   KDPNELNPIERFSLADLAAAVNKEYDDEEILNWLYNAAYVTNWWVTENWDRWRFSPKAT
FT                   EEAKEEVKEDKT"
FT   CDS_pept        391965..393164
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076722" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947768"
FT                   /orf_name="Pc20g01720"
FT                   /product="Pc20g01720 protein"
FT                   /protein_id="CAP85501.1"
FT                   /db_xref="UniParc:UPI00018313AF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ7"
FT                   /transl_table=1
FT                   /translation="MLGSLFGWVSLLFEPLAFQVPLIEPQPRLKSENGIAIPVQGPWQD
FT                   IITGHYAVPPVLKIHDRNSVVKWSWQREDVTQPLPPLIRSGLYSGYNDATDMKWMRGGR
FT                   SVAAVYSALVVVINHTPDQPSTDKKITFAINRANDVLHNAHTIEPLPGDRLAVGTTGQR
FT                   PWDGILVYNMSEALPLMDEPPVLQRIEGLRAIHALIWDEQGQMLWATGTDAAADGSDPV
FT                   PAYGVIQGYPFDAETGLLSIDEAYRFKFPEYFDIDAEWGHGYSWWAGPHDLVPVPNERV
FT                   LLVSNDIGLHAFDINEMNFTAEYDEVVEKYMPGFEVTTNDRHGINRQGEYVELPQSDLK
FT                   GFSLAPDGSFLYTQSLWRLFRGNYTSLVVDGVRHQIMKGNEIYRSRWFGDIDGWPKPKT
FT                   "
FT   sig_peptide     391965..392021
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ7 "
FT   mat_peptide     392022..393161
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ7 "
FT   CDS_pept        join(394968..395480,395537..395915,395972..396160,
FT                   396333..396394,396460..396651)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947769"
FT                   /orf_name="Pc20g01730"
FT                   /product="Pc20g01730 protein"
FT                   /protein_id="CAP85502.1"
FT                   /db_xref="UniParc:UPI00018313B0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ8"
FT                   /transl_table=1
FT                   /translation="MASSSAPSLANLAFDEICRQLEVFVAGKKASASFVCGGLVPIDAH
FT                   TAASSIPSKTTVSPPVRICWRTDADNILRELTLPLDSQADSKAESGLRQLVVDCEPASF
FT                   GKGQQDVLDPKYRKAGKLEPRSFLTSFHPSDLGILQNVEQILLPNFNTDLENRLPFRKM
FT                   HAELYKLNVYSGPSGLFRKHVDTPRSETQIGSLVVCLPSHFKGGNLVVQHEGKRVEFDW
FT                   SHQSASAIQWAAFYSDCEHEIKTITEGERITLTYNLYVTEPVGGSIPPSLIVDPKSMSL
FT                   YSFLEELLVEPGFMTDGGALGFFCSHAYPHASDEAPMLLPRALKGSDLVLYSVFKSLGI
FT                   QIDVLPVAFDDHYDQCKEKHVLVGDQLHPYFATDEIEEDESMTELCFPGEYRPEITWIG
FT                   SPTHRQEAVSYIAYGNQPSLGAVYSYAALIANIPPFLERQGLVLA"
FT   CDS_pept        join(complement(397968..398002),complement(397195..397798))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947770"
FT                   /orf_name="Pc20g01740"
FT                   /product="Pc20g01740 protein"
FT                   /protein_id="CAP85503.1"
FT                   /db_xref="UniParc:UPI00018313B1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ9"
FT                   /transl_table=1
FT                   /translation="MPDWEVEDSHRCAPCKMNRTAFFSSSIINNGSSNRQSCISFSLRP
FT                   APWDSAKILVHPSGYPIEAPPMYSIISKDSPPNVVLLRGWGEGPWVIVGDARLPTLSSK
FT                   IHLTFYGQPIIMRLNQLSGNYALESPAVGQLKWRPDMFTGRDMQLQDATGRKLAKLRPG
FT                   KSGEKLLEILVSHDSSFSEIVLLSGWTARAMTKSVTEATGEILSSVVGA"
FT   CDS_pept        join(398358..398414,398469..398987,399067..399201,
FT                   399283..400032)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947771"
FT                   /orf_name="Pc20g01750"
FT                   /product="Pc20g01750 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85504.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831488"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR0"
FT                   /transl_table=1
FT                   /translation="MPGVPSSRGCDACRKVKKKCDQLKPTCSRCARLKMTCVGGGQQRY
FT                   MFKNQSVKAMQTQSGAESQSQLQQSFPSTGNRAVWIGKPTRVPSTDTSKMAAAFVAAFQ
FT                   VTDIRYAMAYYGPFLRDIPRRLGNSTVLDSAVRALSTAYSLLHAGSYPPKALVLYGQSL
FT                   RALRECLNDPVEARTPNTLCAVYLITICQSWLGKHDDSLTSHSEAIAHLLRAAALHEWK
FT                   STFEMELVITLCVPIILEGIINPRIKMDSEFWQLASSFRRRLSASRDNNQPQSATELQH
FT                   LAMFPKFVQNPESHLAEIAKTYMQLRLDAQRVKQHLDQCAETVLVSFSSSEVARHCRIQ
FT                   AAYAMLSTLAVLLNSLLRVFDPWNASLVSEAVFLCDEIATQAELASCYRPVGAGYIPLC
FT                   LVVAWAASDNLVQLARIEAILSEYQSDFAEVPWMSRAIWLASTLDSHRIRVMSGKQSPE
FT                   SSLEADSGDSHGAGTKKASVRPESCCIL"
FT   CDS_pept        join(complement(402758..402821),complement(402519..402691),
FT                   complement(402077..402456),complement(401601..402027),
FT                   complement(400892..401551))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000239129" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947772"
FT                   /orf_name="Pc20g01760"
FT                   /product="Pc20g01760 protein"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85505.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831489"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR1"
FT                   /transl_table=1
FT                   /translation="MWFLPSCFKHPSHFSTDGPTKGCSSMRDFEDQAYTNRDDIPLKET
FT                   GESDDDEEKQVYPPSSKLAPILIGLCFQSFCIALDNTILSTAVPKITEEFNSLSDISWY
FT                   ASAYLLTTCAVTLPFGKIYTYYSTKWTYMIALGLFELGSLICAVTPTSKGLIFGRAIAG
FT                   VGSGGLSPGALLILANSVPLHRRALYFGIIGSTSGIATITGPLLGGLLTDHATWRWCFW
FT                   INLPFGVLTGLVILLFFKDSTSPKPKISRLGQLKRMDPLGILAFIPAIVSLLLCLQWGG
FT                   TKYSWNNARIIALFVLFGVFGFAWCLIQVWKQDDATVPPRLLKDRNVLGAVIHATFLGG
FT                   SFFVFGYYLPIWFQAVKEDSASESGINNLPMVVAMIVFSALGGLMVNIVGYYTPLMFVG
FT                   SAFLTIGSGLCTTFKVDSGRPQWIGYQVILGIGAGLGFQQCINALQTVLPLHDIPVGIA
FT                   IITFAQSLSGAMFISIAQTVFQNRLVASITTYAPNISPNALTKAGAANLSHLVPKNMLP
FT                   SVLHAYNIAVVQTFYVSVAAALLSFIGAGLVQWKSMKRRQKYDGASRSSQ"
FT   CDS_pept        join(403481..403584,403671..403734,403964..404036,
FT                   404134..404312)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977588"
FT                   /orf_name="Pc20g01770"
FT                   /product="Putative uncharacterized protein Pc20g01770 "
FT                   /protein_id="CAP85506.1"
FT                   /db_xref="UniParc:UPI000183148A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR2"
FT                   /transl_table=1
FT                   /translation="MATGPPHNYPCQSTLVYLGSRTGGLISSSRLERYWDREKGASEQH
FT                   PADLLGILIHHAFICDDKDRRRSNELYDGGSRSVCVSWLIVAEDCRLEGINLHRDLTVY
FT                   HEEPQAVGDLRLGARYFVGGYLAMIEQLGNEFWGS"
FT   CDS_pept        join(405825..406236,406289..406330,406462..407124,
FT                   407155..407383,407440..407737)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824361"
FT                   /orf_name="Pc20g01780"
FT                   /product="Pc20g01780 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85507.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183148B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR3"
FT                   /transl_table=1
FT                   /translation="MQTRRFLGLSGTKVQIAIGFLAGMDFLLFGYDQGVTGGLLTLDSF
FT                   VKYFPEINTLDSYTEHWSPSAKSNQSTRQGITVAAYNLGCFAGSIPTIWIGNILGRRKA
FT                   IFLGSFIMCVGAILQCTSYGLAQLVIGRLITGFGNGINTSTVPTWQSECCKSHRRGQMV
FT                   MIEGAMITCGITISYWINFGLMFADPNEVAWRFPLAFQIFFAAIILAFVMFLPESPRWL
FT                   ILKGREEEAKEVLACLMGDETDELFIDTEFTAIKATVLEMATGSFRDMFTMGEDRHFHR
FT                   TMLAYVNQMFQQISGINLITYYIPTLLEQQVGLDATISRLISACNGTEYFIASWIAVFT
FT                   VERFGRRTLMLFGAVGMSISMVVLAISDSISSTGVAQTVFLFVFNTFFAIGWLGMTWLY
FT                   PAEIVPLKIRAPANALSTSSNWIWNFMVVMITPVAFENIGYKTYIIFAVINAAIVPVVY
FT                   FFFPETTMRSLEEMDRIFRKTTSVFNVVSLANTEPHMYGPNGELLRTLDDVEDDAVRRA
FT                   SFLNKESKAQQQSHTQHAEKCSDEPTSEER"
FT   CDS_pept        join(complement(409960..409984),complement(409858..409909),
FT                   complement(409732..409807),complement(408965..409678),
FT                   complement(408598..408888),complement(408172..408549))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202869" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824362"
FT                   /orf_name="Pc20g01790"
FT                   /product="Pc20g01790 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85508.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183148C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE12"
FT                   /transl_table=1
FT                   /translation="MYTITNIYVLAAFGTIGGALFGFDVSSMSAWIGVDTYTDYFDSPD
FT                   SNLQGGITASMSAGSFAGSIAAGWLADILGRRYALMIASLVWIVGAVVQCSAQNVTHLV
FT                   AGRVVSGLAVGVTSSQTCVYLSELAPARIRGRIVGIQQWAIEWGILIMYLIAYGCVVGV
FT                   SGPAAFRICWGVQAVPGLILFIALFFFPESPRWLASQERWEEALDTLAIIHANGDRHDP
FT                   VVQVEFEEVQEAVRVAHESRDVSFMALFGPRVWKRTMCGMSVQMWQQLLGGNVAMYYVV
FT                   YIFEMAGMTGNTTLWSSAIQYVIFLVTTGCMLPFIDRVGRRNLLLIGSVTCMVVHYIIA
FT                   AVMASKGKPVPDVNGNANLTWEIKGSAGMTVIAFSYIFTGIYGLTWAPTAWIYAAEVFP
FT                   LKFRAKGVGLSAATNWIFNFALAYFVAPAFHNIQWKTYIIFGVFCTVMTFHVFFMYPET
FT                   VGRSLEEIDLVFETDVKPWRTHKIGDIFGEEIERRKELGAKTETGGATHEEVV"
FT   mat_peptide     join(complement(409858..409868),complement(409732..409807),
FT                   complement(408965..409678),complement(408598..408888),
FT                   complement(408175..408549))
FT                   /db_xref="UniProtKB/TrEMBL:B6HE12 "
FT   sig_peptide     join(complement(409960..409984),complement(409869..409909))
FT                   /db_xref="UniProtKB/TrEMBL:B6HE12 "
FT   CDS_pept        join(complement(413918..414283),complement(413484..413857),
FT                   complement(412766..413432),complement(412030..412710))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181256" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947773"
FT                   /orf_name="Pc20g01800"
FT                   /product="Pc20g01800 protein"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="acyl-CoA oxidase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="fatty acid beta-oxidation "
FT                   /cellular_component="peroxisome"
FT                   /protein_id="CAP85509.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0003997"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0006635"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI000183148D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE13"
FT                   /transl_table=1
FT                   /translation="MPSPPPDWVKALKPSGPQGSELLHQERAQSNVDVERLSELLHTKE
FT                   TLERRASLLALLQPEKVFDKSQNHSLGRVERLQRSLAKAKRLQQLAEEHKWSMQELHAA
FT                   NDLIGEPTPYGLHASMFLVTLREQGTPEQHKLFLERAEKYEIIGCYAQTELGHGSNVRG
FT                   LETTATWNSNDKTFTINSPTLTASKWWIGSLGRTANHAVVMAQLFIDGKNYGPHPFVVQ
FT                   VRDLETHQPLDNVYVGDIGPKFGYNTMDNGFLLFNNVKIPHVNMLARFCQVDKETNQYA
FT                   KPAMPSLVFGTMTWVRANIVLDAGGVLARGVTIATRYCAVRRQFQDRDADPHAGETQVL
FT                   NYKMVQVRLLPLLASMYALHFTGRGMMRLYEENQSRMKAASSPDQESRGAGPEQLRAGA
FT                   NLLADLHATSCGLKALASTTAGEGLEICRRACGGHGYSSYSGIGPAYADYLPTLTWEGD
FT                   NYMLTQQVARYLLKSARAVLAGKPARNDTSQILQAYLDRRDKGASFDVLDEDKDIVAAF
FT                   GWRTAHLTFEALKHRDAEQRSWNSLLVDFWRLSTAHSQYLMVKNFYEAVSSPELSGALD
FT                   PETKGLMHQLFRLFSLHTLEREAAEFFSSGAVTVRQITLTRTTAVLKLLDDIRPHAVRL
FT                   VDAWAIPDWQLDSSLGRYDGKVYEDLFRRASEENPVNELVFDPYPWNSALLKNEPAKSK
FT                   L"
FT   CDS_pept        join(complement(416353..416565),complement(416266..416280),
FT                   complement(415812..416213),complement(415405..415761),
FT                   complement(415010..415357))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171144" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947774"
FT                   /orf_name="Pc20g01810"
FT                   /product="Pc20g01810 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP85510.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183148E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE14"
FT                   /transl_table=1
FT                   /translation="MATTCEIQSSRDTSFIALETLPHGQSDTDSRLGPESFPLLEKWNQ
FT                   PRINIHRTFATFWSFLVMGANDAAYGALIPYLESYYHLSYTIVSLVFLSPLVGYTVAAF
FT                   LNHRIHYTLGQRGVAIIGPACHLIAYVINCIHPPYPVLVVAFIFAGLGNGLEDAAWNAW
FT                   LGNMANANELLGVLHGIYGAGAVISPLVATSMIAKGGLPWYYFYYVMTGCAAIELVVSG
FT                   ACFWKSTAADFRASNVSSADNKKGGLRNALFKRPAARVTWLCALFLLGYVGVEVALGGW
FT                   IVTFMIRVRQGGAFASGMTATGFWLGITVGRVILGFVTPRVGEKVAISVYIVCSMAFAL
FT                   VLWLVPQFYVSAVAVSLQGFFLGPLFPGVVVMVTKLLPRHLHVTSIGFVAAFGGSGAAI
FT                   LPFAVGVLAQAKGVQVLQPFIVALSGAILLTWLGLPRVSKVRHNE"
FT   CDS_pept        join(417257..417658,417723..418179,418228..418401,
FT                   418451..418983)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977589"
FT                   /orf_name="Pc20g01820"
FT                   /product="Pc20g01820 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85511.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI000183148F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE15"
FT                   /transl_table=1
FT                   /translation="MSYVNPIIPGFNPDPSIVRVDRDFFLVTSSFEYFPGVPIYHSQDL
FT                   IQWKLIGHALTRPSQLQIHTPEPGGGVWATTIRYHGGAYYVIAASFQRYRPQQDDRVWP
FT                   QGFYVKTTDIWNEKTWSDPVYFDQVGFDQDLFWDDDGTVYLSSTYRKIQPTTGAKLKDF
FT                   AIHICTVDLATGHSTSVPKLIRESSSGVAEGSHIFKRGRYWYLFTAEGGTESGHCEWVN
FT                   RSEVSPLGPWELGPNNPLWRNGVDDEVQNTGHADLVEDTKGQWWAVVLGVRPSRRGDTW
FT                   EDSVLGRETFLVPLEWKDDWPVINGGQKISLNSHGPGLYEFHTPVSWRDEFLDSQMQVG
FT                   WYRKNTPFVTDYSLTERPNYLRLHGGPYNLSVPASPTMFLRKQTHHFCRWETRLSFEPT
FT                   AAETEAGTVVWLNYFTYSSIGIRKDGKGRFIRFRPSKGDTVERRLDTKTAVTLTVDCGT
FT                   EYRFGYREDTHSDVHWIGSVSNNAATAAPPVGANFTGMMLGLYAFGERQRCLAPADFAY
FT                   AEFR"
FT   CDS_pept        join(419250..419385,419436..420148)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217470" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824363"
FT                   /orf_name="Pc20g01830"
FT                   /product="Pc20g01830 protein"
FT                   /protein_id="CAP85512.1"
FT                   /db_xref="InterPro:IPR021833"
FT                   /db_xref="UniParc:UPI0001831490"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE16"
FT                   /transl_table=1
FT                   /translation="MTENLKIDHLTPISDDAEQVTDDWSGLSDPTERRRRQNRINQRAY
FT                   RKRKRMSSNKDVHPKSLVPRPRSTSTVQSQDRSSQDNPEVSFCRNPELLQDILVRFAES
FT                   AYESYARGDPTADHLMTLTKVNVFRAFAQNLRLIGWLEFWMDDDAISLFNTVLPQRPPR
FT                   QDDNSLIPANLQPTRIQKSIRHHPWLDFFPFPKMRDNLIEAGDDWDDEQLCHDIMGFWG
FT                   ESTMDTGMLVWGEPWNAQNWEVTEPFLKKWQWVVRGCPELMDATNSWRARRGERLIFRY
FT                   I"
FT   CDS_pept        join(complement(421396..421734),complement(420974..421326),
FT                   complement(420597..420915))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181609" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824364"
FT                   /orf_name="Pc20g01840"
FT                   /product="Pc20g01840 protein"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="CAP85513.1"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniParc:UPI0001831491"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE17"
FT                   /transl_table=1
FT                   /translation="MSLFGSVFGFFLRGASPILGMVAVSSFLYLIVDHIHIPRWWDKKT
FT                   HLIGRKSPERITRHECPYDYLREIYGKHHWKAFVHKLSPALHNDDPAKYSMVLEIMDAI
FT                   HLCLMLVDDISDGSDYRKGRPAAHSIYGPSETGNRAYYRVTQILNKTTKDFPNLAPWLM
FT                   QDLQDILEGQDISLIWRRDGLSAFPIATAERLAAYRRMASLKTGSLFRLLGHIVLENDS
FT                   MDETLTTVAWHSQLQNDCKNVYSSEYAKLKGSVAEDLHNREMTYPIVLALDAPDGHLVT
FT                   GALEYPSPRNIRNAMRVIRGDYVRSICTNELRKSGASVKEWLELWGRKEKLDLKA"
FT   mat_peptide     join(complement(421396..421674),complement(420974..421326),
FT                   complement(420600..420915))
FT                   /db_xref="UniProtKB/TrEMBL:B6HE17 "
FT   sig_peptide     complement(421675..421734)
FT                   /db_xref="UniProtKB/TrEMBL:B6HE17 "
FT   CDS_pept        join(422801..423102,423169..423370,423453..424328)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947775"
FT                   /orf_name="Pc20g01850"
FT                   /product="Pc20g01850 protein"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85514.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI0001831492"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE18"
FT                   /transl_table=1
FT                   /translation="MTKMSKSEFQVIIVGGSIGGLTLAHCLQRAGIDHIVLEKASNPAP
FT                   QIGASVGIAPNGARVLDQLRLYDLVEEQIEPLNTATIHYPDGYSFETKFTKVIHERFGY
FT                   PIAFLDRQKLLEILYQGYPDHRKISLGERVIKVEKSGDVAIVSTAKGSVYRGHLVVGAD
FT                   GVHSKHSLVRMGTEHYAGLKAEFRCLFGISSAIKALIIGDQVNAFFDGFTIITIHGKGG
FT                   RVYWFVIQKLDKEYTYPHCPRYTAGDIETAAEELRTIVFYKDINFGQLWENRETVSMTV
FT                   LEEHTFDIWHHDRLVLLGDSAHKMTPNIGQGANMAIEDAASLANLLQRLRKGLDIWPPT
FT                   NGQVKILLEQYRSIRYGRVNSVYKSSRILARLHARDGLLKTLIGRYYVPYAGDLPAYVG
FT                   SKSIADGVMCDFLPPPKRSGDGWERYRTEDSNSGWVLQAIFCVLVFAMLFTYIDWEWVG
FT                   L"
FT   sig_peptide     422801..422872
FT                   /db_xref="UniProtKB/TrEMBL:B6HE18 "
FT   mat_peptide     join(422873..423102,423169..423370,423453..424325)
FT                   /db_xref="UniProtKB/TrEMBL:B6HE18 "
FT   CDS_pept        join(426313..426540,426597..426751,426801..427127,
FT                   427188..427596)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169461" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947776"
FT                   /orf_name="Pc20g01860"
FT                   /product="Pc20g01860 protein"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="CAP85515.1"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniParc:UPI0001831493"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE19"
FT                   /transl_table=1
FT                   /translation="MLGLTAAKVFAFISQYIPRITIFTNNKPAASTYYHRRKDLKGFQI
FT                   LQAHTNHTQQNLTLSDGTDSGDCQITEPYEKIVSAPLEYLLCIPGKDIRGKLISAFNEW
FT                   LHLPDDKLAIVKEVIDRLHTASLLIDDIQDASRLRRGHPVAHDVFGVAQTINAANYAYF
FT                   LQQKRLNEINDPRAFHIFTQALLDLHIGQGMDLYWRDALVCPTEAEYTRMVMYKTGGLF
FT                   RLAVELMQIQSTTTTDLSRLVGLLGIIFQIRDDYMNLQSGIYAEKKGLMEDLTEGKFSY
FT                   PVIHSIRADPDNTQLINILKQRSEDRAVKVRAVQYMESTGSFQYCREVLSGLMEQARGH
FT                   VDELETLLGPNQEIHRILDLLQVDPPNVNPRP"
FT   CDS_pept        complement(428385..428834)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128699"
FT                   /orf_name="Pc20g01870"
FT                   /product="Pc20g01870 protein"
FT                   /protein_id="CAP85516.1"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI0001831494"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE20"
FT                   /transl_table=1
FT                   /translation="MGSGPAKTCFATSSPYEEKIGYYRAVRHGNQIFVSGTTSVDPYSP
FT                   TNAPHVLHPEDARQQTRVALEESIRAIQGLGGKGAEDIVRVKMFVSRHEDCEAVGRGFS
FT                   EILGKHNRGGSGMIGAAATMIVVNGGFINKEMLVEIEVDAVVEYI"
FT   CDS_pept        complement(429477..431018)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234798" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947777"
FT                   /orf_name="Pc20g01880"
FT                   /product="Pc20g01880 protein"
FT                   /protein_id="CAP85517.1"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniParc:UPI0001831495"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE21"
FT                   /transl_table=1
FT                   /translation="MSQRPVIAIAGLACETSTFSPARTLGRAFHPRRGPEIIEKYAFLH
FT                   NSTPLADVADWKGALIGHALPGGIVVRADFEQLSREILERLAAIVASNPIDGLWYDIHG
FT                   AMCVDGMEDVEAELLRRIRSVIGPNVLVSASMDLHGNVSRELAHQTDLITCYRMAPHED
FT                   ALETKERACRNLIDVLTSRTDTGCRRPLKAWVPIPILLPGEQTSTRDEPAKSLYSLVPE
FT                   IEAMENVLDAAIWVGYAWADEPRNHAVVMVTGWDKSAVTTGAKRLASLFWRVHKDFHFA
FT                   APTGSFSECIDNALASSNRPFFISDSGDNPTAGGSGDVTFGLNELLKRAEFAKETTRSV
FT                   IYASIPGPQAIDVITKAGVGTTVTVTAGAQVDNLHAGPVTMTGRIHSIRYGDPDAEIEA
FT                   VLQVGSVFTILTKFRKPYHHESDFVGLDLSPRVTNIVIVKIGYLEPELFNMAADWMIAL
FT                   TPGSVDQYLQRLGHHRILRPMWPFDKTFYRAPDLTPRLIPFSNEDLGAPQGLSLE"
FT   mat_peptide     complement(429480..430940)
FT                   /db_xref="UniProtKB/TrEMBL:B6HE21 "
FT   sig_peptide     complement(430941..431018)
FT                   /db_xref="UniProtKB/TrEMBL:B6HE21 "
FT   CDS_pept        join(431397..431497,431619..432312)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000100908" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947778"
FT                   /orf_name="Pc20g01890"
FT                   /product="Pc20g01890 protein"
FT                   /function="copper ion binding"
FT                   /biological_process="copper ion homeostasis"
FT                   /protein_id="CAP85518.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0055070"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="UniParc:UPI0001831496"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE22"
FT                   /transl_table=1
FT                   /translation="MSQTAITQIPILEIACFNQESAVVAARAGADRIELCKDYHLGGLS
FT                   ADIEILQELKSQLTTPIYTMVRPHAEGFCYGESDFESMKRTLNSLKSCGADGFVFGILN
FT                   RSPQMSCDPNLPWVDVSRNKQLVQLAGGRPCTFHRAFDLIPESHWENALADIMECGFAS
FT                   ILTNGGPSGTKATESMDKLQTLVRYKTQLQREQKIRGNRVPEIIVGGGVRASNIGLLQS
FT                   ITGASAFHSAALVASKAVTSAKEVSDMKGGIAQAWEADKKAQ"
FT   CDS_pept        join(433686..433794,433902..433972,434066..434302,
FT                   434357..434369,434425..435149,435198..435641)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128700"
FT                   /orf_name="Pc20g01900"
FT                   /product="Pc20g01900 protein"
FT                   /function="nucleobase transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85519.1"
FT                   /db_xref="GO:0015205"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="UniParc:UPI0001831576"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE23"
FT                   /transl_table=1
FT                   /translation="MTLGGKLKFWLKKIQVPSEPGLSTAQLMLTNDDLRPVEPERRQWG
FT                   WLNFVAFWIADSLNVNTWMISSSMIVDGLSWWQSWLCVWIGYTVAAIFVYVLGRIATIY
FT                   RIPFAVANRASFGIWGSFWPIINRAAMAVIWYGVQSYLGGECVTLMIAAIWPSYNNLPN
FT                   TIPSSSGVTTKQFVSFFIFWLLSLPALWFPIYKVRHVFTAKAYFSPACAIAFFGWAIAR
FT                   AHGLGPIIDQPNKAQGSALAWAFVKSIMNCIANFAALVINNPDFTRYARDPKDALWPQL
FT                   ITIPVGFAVTSFIGIIVSSSSSVIFGEAVWNPLTLLGMFLKDASSAERFGIFVIGAGFA
FT                   LAQLGTNIAANSVSAGTNLTALLPRFCTIRRGGYLCAAIGLAMCPWTLVASSSKFTLYL
FT                   SAYSVFLSAIAGVMVSDYYLVRKGFLDIQALYSAERDGIYYGTFGVSWHGYAAYISGIL
FT                   VNIVGFAGAIGVNVPIGAMYIYNVNYFSGFIVSGAVYWALAWLVPIPGTSDTWNEIPYE
FT                   PHHMSDSDEKKVGDV"
FT   CDS_pept        complement(436899..437900)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947779"
FT                   /orf_name="Pc20g01910"
FT                   /product="Putative uncharacterized protein Pc20g01910 "
FT                   /protein_id="CAP85520.1"
FT                   /db_xref="UniParc:UPI0001831577"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE24"
FT                   /transl_table=1
FT                   /translation="MAESRGGPSNPKFSDLVPLLKGESNWEIWKQYMEIALNGIDPSYW
FT                   PLLIGQDKRPTNLPGMEDSEVDFEDAVTEIDDDTPAHPTAAFATQPTQPTTTKAAIAKR
FT                   KKAQQAWDQKNAIVLSYVASSLDATMLLYFRGGHTAALVYEELRSLYEGKIFFSIRNKV
FT                   TKWATWKYKAGTKPEEFVTEWRHLFTEMQVALPIEQRVSSLYAIYVFLHAVSNNTACQH
FT                   WLNTVSIHDDWSYDEILHNIFGVFIASEGRRIRNDGQLQKQQASANIASADNNKKKKKK
FT                   DNPKGEKEEDKQTKKQYCPFHKRETIHKPKDCFLNPKKKDKSESASMENLWC"
FT   CDS_pept        join(complement(441158..441277),complement(440924..441106),
FT                   complement(440511..440870),complement(439917..440457),
FT                   complement(439542..439861),complement(439304..439481),
FT                   complement(438866..439215))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159172" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947780"
FT                   /orf_name="Pc20g01920"
FT                   /product="Pc20g01920 protein"
FT                   /biological_process="metabolic process"
FT                   /protein_id="CAP85521.1"
FT                   /db_xref="GO:0008152"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015936"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="UniParc:UPI0001831578"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE25"
FT                   /transl_table=1
FT                   /translation="MTISEKIFAMHDLNHKGFVAPGDIIRVHVDWILASEVSWAGMETT
FT                   YNHLGKPGIFRNDRFWLCGDHVVDPRVNELPQVQALISGSERAKKTFKMTEYQGMNYTI
FT                   LHTEFYRERAQPGMLVVGSDSHTCSSGAVGCLAIGLGAADVALPLVTGETWFQVPETIN
FT                   IRLVGAPKPGIGGKDVILYILQVLKRNTIASDRIVEFTGPALRHLSPDTRFAVSNMTTE
FT                   LGGITGIFMPDDTTHNFINRRKLARHKCHTTYFRPDADAEYAAVHQIDLTHVGSFIARY
FT                   PNPDDVVPVTEEEGMELNGCFIGACTTTEEDLILGALVMEQAMKRGSKPTAKGKRKVVP
FT                   GSMPILYRLRKLRLCDIYEDAGFEIGIPGCSYCVGMSADQAAPGEVWISSQNRNFENRM
FT                   GKGSIGHLASAATVAASSFEMKLVDPSDLLAAIDLSRWRQLTTASTHSDATSPKSDLIY
FT                   VEPCGCDYHRAGAQTQKQIEKPRLDIHGRGQTKSLQGKVQRLGDFVNTDALAPAEFLIG
FT                   MKNNMDAGLRCLVHTHPKFRERAQQGFNIVVGGKGFGCGSSREQAVMALLGCGVQCVIA
FT                   KSFSFIFQRNMPSLGLLGITMEDESFFQVADDGVSISIDLNSRIIDVAGKTFGFKLSQM
FT                   ETEIFQFGGIASAFGVFGNKLLEAITPAKSPSGYKQEESEQPDKLLQW"
FT   CDS_pept        join(complement(442139..442151),complement(442017..442061),
FT                   complement(441622..441896))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671676"
FT                   /orf_name="Pc20g01930"
FT                   /product="Putative uncharacterized protein Pc20g01930 "
FT                   /protein_id="CAP85522.1"
FT                   /db_xref="UniParc:UPI0001831579"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE26"
FT                   /transl_table=1
FT                   /translation="MSTPASTYIVIPEASGAQIGHVPSVLRYPLPRGGADRVSSASQQF
FT                   TVQPLYNLPGFIFKTCWPSSLLEQILEKYRPGTMAEGNPSTLNQLVQILAQTRGIHMDV
FT                   PNGKYV"
FT   CDS_pept        join(complement(443824..443920),complement(443557..443768),
FT                   complement(443444..443508),complement(443288..443385),
FT                   complement(442505..443241))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111120" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947781"
FT                   /orf_name="Pc20g01940"
FT                   /product="Pc20g01940 protein"
FT                   /function="cation binding"
FT                   /function="cellulose binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAP85523.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030248"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000183157A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE68"
FT                   /transl_table=1
FT                   /translation="MRFISLLSIAGVTGLVLAAPGPSLSKRAGSFVWFGANEAGAEFGS
FT                   GNIPGELGTDYIWPSTSTIQTLRDAGMNLFRIPFAMERLVPGTLTSSMDATYLASLKST
FT                   VNYVTSSGGYAVIDPHNFGRYYGNIITSTSDFAAFWTALASEFASNDKVIFDTNNEFHS
FT                   QDQTLVLNLNQAAINAIRAAGAKSQYIFVEGNSWSGAWTWTTVNDNMKALTDPQDLIIY
FT                   EMHQYLDSDGSGTSETCVSSTIGRERVVAATQWLKDNGKRAFLGEFAGGANPVCQSAVT
FT                   GMLDYLQANSDVWVGASWWSAGPWWGNYMYSLELPSGVGYTYYMSLLRNYFPGSTGSGG
FT                   TTTAAPTSTPTVATATKTTTTGSSTTGAAHYAQCGGKSWTGATTCASPYACQKQSDYYS
FT                   QCL"
FT   mat_peptide     join(complement(443824..443866),complement(443557..443768),
FT                   complement(443444..443508),complement(443288..443385),
FT                   complement(442508..443241))
FT                   /db_xref="UniProtKB/TrEMBL:B6HE68 "
FT   sig_peptide     complement(443867..443920)
FT                   /db_xref="UniProtKB/TrEMBL:B6HE68 "
FT   CDS_pept        join(complement(445024..445634),complement(444801..444927),
FT                   complement(444481..444726))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824365"
FT                   /orf_name="Pc20g01950"
FT                   /product="Pc20g01950 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP85524.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI000183157B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE69"
FT                   /transl_table=1
FT                   /translation="MTFTVAPHLNYFTIPLKDFVAARPEFEGFGVCAYIFSHADPAPRI
FT                   LLLQRALTDSMPGCWEGPGGACELDTDKTLFDSLVRETLEESGLHVSHILDLVAVDCWE
FT                   HHRRSGGKIRIAKYSFVVEVQEALGSSAGKQQAVPTLQIPVHLEPLEHQKFDWAVKEDV
FT                   LLSIRSPNGPYRFPLPLVGHQAPNILRAFELVEQRESRKECISHILRPSWCMWRYLVRY
FT                   LVYLEEAMQKPEHAPTSQATLISLCISGDFVGNLHLRRLQGSTVIPRQGNRYTVYIETY
FT                   RFPVNQAFRPPGMLCELLLMLLIMAGLVSVSIRAQFVHELVANSSR"
FT   CDS_pept        complement(446073..446936)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000033576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947782"
FT                   /orf_name="Pc20g01960"
FT                   /product="Pc20g01960 protein"
FT                   /function="amino acid binding"
FT                   /function="formyltetrahydrofolate deformylase activity "
FT                   /function="hydroxymethyl-, formyl- and related transferase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /protein_id="CAP85525.1"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="GO:0008864"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="GO:0016742"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="UniParc:UPI000183157C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE70"
FT                   /transl_table=1
FT                   /translation="MAASFILTLSGPDRPGIVHAVTAFLVQNNLNIIDSSQFGDPTSQR
FT                   FFMRTQFATANGEDETPELEKLRTAFEPTAQSFSLNFEINPSVKKPRVLIMVSKIGHCL
FT                   NDLLFRQSTGQLSIEVPLIVSNHPDFATLAATYNIPFHHLPVTADTKAQQEAQILELVS
FT                   QHNIDLIVLARYMQVLSPTLCSAMSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGAT
FT                   AHFVTSDLDEGPIIEQNVVRVNHGMSPKELTHAGSNVESNVLATAVKYVTERRVILNGH
FT                   KTVVFN"
FT   mat_peptide     complement(446076..446876)
FT                   /db_xref="UniProtKB/TrEMBL:B6HE70 "
FT   sig_peptide     complement(446877..446936)
FT                   /db_xref="UniProtKB/TrEMBL:B6HE70 "
FT   CDS_pept        448041..449630
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000182210" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947783"
FT                   /orf_name="Pc20g01970"
FT                   /product="Pc20g01970 protein"
FT                   /function="cellulose binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAP85526.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030248"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR001722"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="UniParc:UPI000183157D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE71"
FT                   /transl_table=1
FT                   /translation="MASALSFKIYKNALLLAAFLGAAQAQQVGTSTAEVHPSLTWQKCT
FT                   AGGSCTSQSGKVVIDSNWRWVHNTGGYTNCYTGNDWDRTLCPDDVTCATNCALDGADYK
FT                   GTYGVTASGSSLRLNFVTQASQKNIGSRLYLMADDSKYEMFQLLNQEFTFDVDVSNLPC
FT                   GLNGALYFVAMDEDGGMARYPTNKAGAKYGTGYCDAQCPRDLKFINGQANVEGWEPSSS
FT                   DVNGGTGSYGSCCAEMDIWEANSISTAFTPHPCDDPAQTRCTGDSCGGTYSSDRYGGTC
FT                   DPDGCDFNPYRMGNQSFYGPSKIVDTESPFTVVTQFITNDGTSTGTLSEIKRFYVQNGK
FT                   VIPQSVSTISAVTGNSITDSFCSAQKTAFKDTDVFAKHGGMAGMGAGLAEGMVLVMSLW
FT                   DDHAANMLWLDSTYPTSASSTTPGAARGSCDISSGEPSDVEANHPNAYVVYSNIKVGPL
FT                   GSTFGSTDSGSGTTTTKVTTTTATKTTTTTGPSTTGAAHYAQCGGQNWTGPTTCASPYT
FT                   CQKQGDYYSQCL"
FT   sig_peptide     448041..448115
FT                   /db_xref="UniProtKB/TrEMBL:B6HE71 "
FT   mat_peptide     448116..449627
FT                   /db_xref="UniProtKB/TrEMBL:B6HE71 "
FT   CDS_pept        join(complement(451604..452113),complement(450669..451553),
FT                   complement(450442..450616),complement(450271..450387),
FT                   complement(450140..450215),complement(450033..450084))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000251017" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977590"
FT                   /orf_name="Pc20g01980"
FT                   /product="Pc20g01980 protein"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85527.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012941"
FT                   /db_xref="UniParc:UPI000183157E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE72"
FT                   /transl_table=1
FT                   /translation="MEQVDVLICGSGSAGLCAATWLAKYGVRCKVLERRGGPMKMGQAD
FT                   GVQCRTVEIFESFGIGEELLREAYHVLEVNFWADNGTGAIKRTGRTADTQPGLSHQPHV
FT                   ILNQARINGLLIELMQKYNDQQIDYGYNVTDVKVDSTSAEDHDTYPVKVTAEKDGKTER
FT                   FAAKYALACDGAHSIVRKALGYKMIGDSSDAVWGVMDMVPRTNFPDIRKKSTIRSKSGN
FT                   ILIIPREGDSDNLTRFYIELAPGTNPKEVTLENLQAQAQSIFRPYRVDFVETVWWSAYA
FT                   IGQRHADFFHKDYRVFLAGDACHTHSPKAGQGMNVSLQDGYNIGWKLGEVLTGLATPSL
FT                   LETYVLERQKVAIDLITFDRYFSKLFSSGATTSPAEFQEGFIKSGKYTAGLTAKYEASP
FT                   ITSALASTNLASNVAVGMRLPSAQVVRFCDSKPLHLMKSLKSDGRWRIMAFIGDLTVLE
FT                   NRSKLNKLGDYLSAADGPIQTFTPKDQDIDSLIETIIIGHGKRHDVELEQIPECFYPVS
FT                   GKNQTRDLHKIYYDDESYNDGHGHAYEYLGIDPAQGALIIVRPDQYVSAVMGLGDHSEI
FT                   GKFFAGFLKRQTENDSSWQTSSPVGSRL"
FT   CDS_pept        join(complement(453715..453868),complement(453274..453661),
FT                   complement(452887..453218),complement(452537..452826))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977591"
FT                   /orf_name="Pc20g01990"
FT                   /product="Pc20g01990 protein"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAP85528.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniParc:UPI000183157F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE73"
FT                   /transl_table=1
FT                   /translation="GKYEXLTIPFRLYNTLATFXILINKTLXLFLGRIVVIYLDDILVF
FT                   LDTEDKYYKHLEEVLKCLRKXKLYAKPKKCILITIELEFYSYIISNREVRLLPEKLEAI
FT                   IGXLRLININEVRRFIRLVLYYRRFIYSFSEIAAPLYNLTKEANKELYKKRFRPINXIE
FT                   XCEVTFRRLKEVLISAPILIXLDXAKPFIIETDTLEXAISFVLGXEAKDRKVYLIAFDS
FT                   RKLRAAELNYLVYKKELLVIKEALRIXDRYLENGTTTTIIIDYKGLXYLTTI"
FT   CDS_pept        complement(454443..456104)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216585" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128701"
FT                   /orf_name="Pc20g02000"
FT                   /product="Pc20g02000 protein"
FT                   /protein_id="CAP85529.1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniParc:UPI0001831580"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE74"
FT                   /transl_table=1
FT                   /translation="MPTPGLLYVTMQPKGSLPDTQFHDWYNTEHGPLRLRLPFVTNGFR
FT                   FRATDGEQPEYVALYDITDMDELTRKTYLDLRTDLIKTEREKKTMAQIDVGRLLYDLVD
FT                   ERTSQNFRPLEDQADTDAETRGSVLIAVRVATHPDPAKQAELDKWYREEHFEMLSRVPG
FT                   WRRSRRFVTAAIDPAAPRESLALHEYAPVNGLGGDAHKAAMNTPWGARLMSEVVTSKKR
FT                   RVYEWYYTFGPAPRELTALAAPDVVGPWNSNDGRTRTFPSTTRPAVESFVTTSDGVEIP
FT                   YRLEGSTDPYAPVVVLSNSILVNWNIWDRFVDAFFAHQQNQRYRVVRYLTRGRHSQSGE
FT                   QPVNIDLLASDLATLLEALRVPPKAARLIGVSLGGVTVLNTALLHPERIGAFIACDTNS
FT                   SAPESNRKAWGDRVAICEKEGSTDPDTNEPIVGEELAELTTRRWFVPESYQTQPEVLAP
FT                   VKEAVRTNSLKGFAHSVQALCAYDIRERMAAATVPGLFVAGANDGVLPQTMQKMAADLR
FT                   GGADLKIIDRAGHLPMVEQPVAFAEVVTEFLSKIDG"
FT   CDS_pept        join(complement(457333..457585),complement(456800..457273),
FT                   complement(456392..456747))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947784"
FT                   /orf_name="Pc20g02010"
FT                   /product="Pc20g02010 protein"
FT                   /protein_id="CAP85530.1"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniParc:UPI0001831581"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE75"
FT                   /transl_table=1
FT                   /translation="MKHHLMVGTWTAPGRIYTVQFDDDALTLELVKKTEIPEAEPISWM
FT                   TFSHDKKAIYGAAMKKWNSFAVNSPTEIVHQVSHPVAGHPLAPSSETNTRAIFVLAAHK
FT                   PPYNVYGNPFYNHAGYGNVFSVKPDGGLDRNIQNYEYLPNTGIHGMVFDPTETYLYSAD
FT                   LTANKIWTHIKDPKTGELALVDCLDAPDAGDHPRWVEMHPSGKYLYALMEAGNRLAVYV
FT                   IDERTHKPVFTHITYPLLPSGLPPRNKYRGDVTFCTKGGEYLFATTRSNHFDVTGYITA
FT                   FKLGPHGEIERQLFINPTSTSGGHSNAVSPCDFSDEWLALCDDQLGFVEMYRWRDEKLA
FT                   RVARVDIPEQGFGMNAIWYD"
FT   CDS_pept        458144..458902
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000071411" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824366"
FT                   /orf_name="Pc20g02020"
FT                   /product="Pc20g02020 protein"
FT                   /protein_id="CAP85531.1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="UniParc:UPI0001831582"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE76"
FT                   /transl_table=1
FT                   /translation="MSPTVKVPLRRTWLGNTYIRNWTLMYVIQRRLTIKNTFKSLGINH
FT                   TRTMRLPYAPSTPPVDAPPDTADIYARIAERRNPRPLIPLDLSLLHSPPVADGWNSFIG
FT                   AIRSRTLVDSGVMELAVCRVAVLNNAVYEWNAHAPLALKGGIKPDQLQAALTLPCTAEG
FT                   DIAGLESSALTPQQRAVLRYTDQMTRTIRVDDTVFAELKTVGYDDREIVELTTGIAGYN
FT                   CVSRFLVALDVGENNAREMKSVDEVVATLQ"
FT   CDS_pept        join(complement(461045..461084),complement(460552..460993),
FT                   complement(460231..460492),complement(460007..460179),
FT                   complement(459645..459954),complement(459153..459593))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216587" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671677"
FT                   /orf_name="Pc20g02030"
FT                   /product="Pc20g02030 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85532.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="UniParc:UPI0001831583"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE77"
FT                   /transl_table=1
FT                   /translation="MQGFGRNGPRSKSGCSTCRRRKVKCGEEKPVCARCSSLRLNCEWG
FT                   VPVKRGRSTQIRHLEPAPETSEQPSWPTPKAEDLVGFQPDALFASPSPVSWASDALPFD
FT                   TFNPVPIPTPICPSLNVNVACANSLTLTSLDRQYFQYFPSSSLVFYYMKRWKWSSLCHL
FT                   YEGPAASNRIIMRMILALSACDMHRNGLIVRSQDHGRYHYSQAVKEFRQLLETPRQVSL
FT                   DDVGTVFATVFLMIAWEWQFGNSVRHLQLHLQGVRSLLETHPQLFRIKDVNDMFCSPGV
FT                   NTLASDSGTMAKVSFIPEQLLLWILYIDASCRPIGLTDSLNDYVAQTGNPALQPDHLYR
FT                   CARLWGRCFWGEQYPDEEVLDDIENYRALELLHVGFCLRHRTWQVLVESAAGTAESAEA
FT                   LFREILATRETFSDLFITARFAGSVSARRTLNTIYMAVSTFYGQVLLHRRLLCVDSLPL
FT                   GIHQQATAGIIDICQKQFLSDPRLLRRLHWPLLMAAIETNDITHQSWLRQRLWELRDFH
FT                   SEFIWAHDVAEQVLALQDVGQGRYINLADFLLKRFHAR"
FT   CDS_pept        join(complement(462827..462922),complement(462385..462767),
FT                   complement(462240..462328),complement(461873..462176),
FT                   complement(461685..461812),complement(461387..461622))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000251261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671678"
FT                   /orf_name="Pc20g02040"
FT                   /product="Pc20g02040 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP85533.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010168"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="UniParc:UPI0001831584"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE78"
FT                   /transl_table=1
FT                   /translation="MTLTTINIEEVKTSVDAALEALQQDLRELNHRIWSNPELAYEEHR
FT                   AHDTICDFLEGQGFTVTRHAYGLETSFEVLSGTGGRLVNFNAEYDALPGIGHACGHNLI
FT                   ATSSIAAFLALSFAISKFNIPGRAQLLGTPAEENGGGKAKLIDAGAYKNVDISLMAHPG
FT                   PKKIYPDQEPSDGIAGTPMNARKNIHCEFTGRNAHAGGNPWEGINALDALVSSYNNVAV
FT                   LRQQLLPDQRVHCAFLDTPKVANVIPDYTKAFWQVRSPTLKGLNALVGKLRNCIEAGAL
FT                   ATGCQVKIEENELYTDVRLNDTLCERYQVHMGRYSRNVLKRHDKVLTGSSDIGNVSYET
FT                   PTLHTMFAIPAPATSFPHHPTFAAAAGTDEAHAEALIVGKSLALIGWDMIVENDMYDLA
FT                   RRQWKDEIVREE"
FT   CDS_pept        join(464643..465029,465165..466592)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947785"
FT                   /orf_name="Pc20g02050"
FT                   /product="Pc20g02050 protein"
FT                   /function="exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85534.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000183166D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE79"
FT                   /transl_table=1
FT                   /translation="MDRKSEYHRGDLQALEHVEYPCPVCKDRMYETEQGFTDHLRNDHQ
FT                   IFSCSKCEKIFAAADELLRHKVEAGHTVPPKTKRKAKSRSPVKSCERARQLPKSPMHLS
FT                   TQETTASKGNDTDRRAQETPATPSTEVTIAPHQAVSLRVRMRSTLPTERDFIFNTSIDH
FT                   VDIACQLVDAGFTTLHAYNTSNATQTILRRAKIGYLEEADYTTAYEAEPNASALCFPPR
FT                   RYDTSHPRPVVIPDIPEHAPKQTKLPNGVTVYGDPDTVAKLAQVVNEFDIWARPGRKPG
FT                   LVNIPKERWMRLRLKPGVTLPRTQVYKLAPRAQNLLDTTFDKLHDEGKMSWATTGCHSL
FT                   ARLHCQGYTTPKTIRTAACTKRGEPHQAHTFTGGSAHRKAIVIACEMIETTVSTSVLAF
FT                   ITAIDFLTGEVLINSYVAPTAPVTNWLTPVTGITPEAMEAAIADGKAFLSNDAVRRALD
FT                   KFLDKDTVVIGHAIQHDLRALNLLHGRIVDISVVTAEAVFSNFSSKTTLPRIWELKTLA
FT                   KELRGIDIQPGLAHNPLEDAVATREVLIWCLRGPECLKAWAEKARSSYERVRLQRGENK
FT                   KGTKNVEKKAGGETVPSAKAQGKKRFSK"
FT   CDS_pept        join(complement(469816..469891),complement(467201..469659))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824367"
FT                   /orf_name="Pc20g02060"
FT                   /product="Pc20g02060 protein"
FT                   /protein_id="CAP85535.1"
FT                   /db_xref="UniParc:UPI000183166E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE80"
FT                   /transl_table=1
FT                   /translation="MGCSSSCGKPQPSQLTSHLALRPVSPESVTQTLTLSSNPRFHQPF
FT                   LEVPRHTPKVFDEAHDSYDPSTLTTFARQRSPTVERPSTSADHQLRPPSASGSQRPLRR
FT                   IPRQTEVRQSLRRESLRAPVPHPNRPQPPRTTPVSVQVQHAPASGIAELRPALSEAATD
FT                   DNGSTIDDPYQLLNTSYWPQRTTRVSTRTASAILFALEEAIRGPLQLSTDWDEVNASMS
FT                   DMVGVAGPAGPVGNSRVQNGGARVPQNPISGTSQPPSGMRTPTDIMRQRRDREARRKAE
FT                   HEAREREQEELERQQLEQEQLAQAEAQAQTQAQAQAQQYAGVAADNTSQPRTRVPRPSR
FT                   GPEGQAPTVPVTSSGYRPAADAAPSTRPSEHQTAPLTATTGPMPNQSRLAQATGQQPQH
FT                   GRSQSAAENGGQPKPSAFSKSAQALPAGQPGAPQALQQPKRVGFPHAFERWETLSSHWE
FT                   GLTGYWMRKLEQNNEDLERDPLSQQLARQITDLSAAGANLFHAVVELQRLRASSERKFQ
FT                   RWFFDTRAEQERSKEVQADLNRQLKEERQGRADAFSAAQEAEKDKVKAEGLLKEMRREL
FT                   QISKEEARRAWEELGRREQEERDRTNSLRNGEPTLVGGVQVVPMVSGLPSRQNTTRPQT
FT                   RDGAYPGGQAATSMGTDAYGKSAGSTGGQYYEDGTPMSPTGSDPFIEPKKVDPPTSKAP
FT                   YPGPLYEHENPTVPYPGPATSEPDARSYVGSSEAGDEEYAHYSQDPHGNTFSYPPGPPS
FT                   EGSEEYDQSLQEGHYMPDGAYTSAASTIPPPAPASAADYTGAGWGPGTGWESVTPRHRH
FT                   PTRLSDVLEEDEPSRTNPSRATSRSQASRSIL"
FT   CDS_pept        join(470882..471043,471178..471343,471473..471534,
FT                   471623..471669,471716..471735,471765..472065,4
FT                   72164..472230)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128702"
FT                   /orf_name="Pc20g02070"
FT                   /product="Putative uncharacterized protein Pc20g02070 "
FT                   /protein_id="CAP85536.1"
FT                   /db_xref="UniParc:UPI000183166F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE81"
FT                   /transl_table=1
FT                   /translation="MAKMLYNIHIHATVAPFPRNDIASRMFRGPRSKANLESKFRFFKF
FT                   NKNLRSNKKAVAEALEETRTTAAIPGFEVREATIQSREEIRGRYGVDLCSSLHIPNLGF
FT                   ISANNMSVQAKVLTEFRRDELKRRARVKPYSRAEGSVLMPKCYVGSNTSTPNSNTSSQE
FT                   ALNTTPHRDRNETPKQTEASTTEYGGRNTTSKVICTPCSKAWTSGAKGQQGPRNRKIRY
FT                   LNRAGEGLPAARTHEQKPAMSPERSGNPVLRVLELGAIGQRKYVLQDNSGDS"
FT   CDS_pept        474298..475998
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194782" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947786"
FT                   /orf_name="Pc20g02080"
FT                   /product="Pc20g02080 protein"
FT                   /protein_id="CAP85537.1"
FT                   /db_xref="UniParc:UPI0001831670"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE82"
FT                   /transl_table=1
FT                   /translation="MDQRGLYCPGELDVLHQDRNRSETTICLPSPSPAKRASSYYPAGP
FT                   KVLEESNLDPFYLEESLAATPSWNPYTSDMRNDSFEDEDQYYTLSLTHKDIHHPSQYGP
FT                   DRSTLAQVELENSLRFHRYTSSTEEHSPLHSSQVSFSSVHTDSTTPDLTPSSSFSSSYD
FT                   SPSCPDAVLEATQQLYKHANQVQIEPRRRFYLPASTPPTYSLPPPPPPPVAPLNPADTR
FT                   PTTPCFQHSNDSTTTITMGYEDTTASCSSRSRRRKQPPSGLTLSRTASSPSTSRRKQSS
FT                   PGTRPPLDPSMISPPSLINPVTMEPHMTHFDHPLFIPANDCPSPVPSPVASSAPISRQW
FT                   TATSMERPSISTIDAFCEQSVWESDSDSESAGRKSMSRRPIDTLRKVRSRAKLRAAKSQ
FT                   PKLHQAMLDGQTCEQFPCMPEDILGEPIPEAFRPSMDRPSTSKEAVRAHSGLQTLRLVA
FT                   PSSASLTRSRSRKNSSLNSSDVDRSAAAAFQAQFRRRQRSDSPEYSNSSSDKGDKEKLT
FT                   SFCYDQYSHTPTNGAREQRPLFERFMNSLRSLNCQKPQKSHKKTNVTTI"
FT   CDS_pept        complement(478705..479391)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048414" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947787"
FT                   /orf_name="Pc20g02090"
FT                   /product="Pc20g02090 protein"
FT                   /protein_id="CAP85538.1"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="UniParc:UPI0001831671"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE83"
FT                   /transl_table=1
FT                   /translation="MSTQDNPAVDNDNSLDDIFGSSPPQNTLNAPLPPTTATSQSTEPS
FT                   DLPGLRRQHVTAGYRDGTSASKGAHVQEGFDGGFPVGAQLGMRAGTVLGIMEGLLRGFE
FT                   ERNGPGVVKKPVRGQSAVSTGTDGATEIAELRRQKREQLRVLYEAALKELDVQAVFAEA
FT                   GGAPEIAPRAEDGEEERAEVQLGRKGDVVIAKWEGRVGVPGWEENMEALEMKEEGKGGG
FT                   QAVEHS"
FT   CDS_pept        join(480371..481107,481142..481337)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217203" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947788"
FT                   /orf_name="Pc20g02100"
FT                   /product="Pc20g02100 protein"
FT                   /protein_id="CAP85539.1"
FT                   /db_xref="UniParc:UPI0001831672"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE84"
FT                   /transl_table=1
FT                   /translation="MSRLSLRLLGFTTAATGLAGYSIHRGLCHLEEKYPALPPAAGSEA
FT                   LRKAHSPNTQHCAYTDIYAAQIPLQVIEARVPNAKTPTQTELEYAWARSVTGSKILRVE
FT                   GSLLGLLTNFRFTPCDTGNSAEGFSPDKTTGAPRILLNGLLQVQRLPATDADSNGLLVS
FT                   MELPDAPRLFFEKIARWGYPWRLMSGVRHEMSVSEPFQRNGGIFVEVRFASAHDYEVVY
FT                   AEGELEKQKIIPAWVLRLHRGYASGKLRNNAANAGYMGYLHIPDLKLPGPSVCGGISQV
FT                   MEALAYSTLTLPSRYQAYIYLTILSIESN"
FT   sig_peptide     480371..480430
FT                   /db_xref="UniProtKB/TrEMBL:B6HE84 "
FT   mat_peptide     join(480431..481107,481142..481334)
FT                   /db_xref="UniProtKB/TrEMBL:B6HE84 "
FT   CDS_pept        join(complement(481899..482000),complement(481481..481846))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194771" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824368"
FT                   /orf_name="Pc20g02110"
FT                   /product="Putative uncharacterized protein Pc20g02110 "
FT                   /protein_id="CAP85540.1"
FT                   /db_xref="UniParc:UPI0001831673"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA0"
FT                   /transl_table=1
FT                   /translation="MKFLAVCLMAIGLSRWTVNALPSPEDLAVLAYRAWDFRFLSEAPP
FT                   VCNSSVNNIEYSILHYSGAKRRDCQVLNLAKFNSTNVKSISWKSPSETNRYDLCMFSSP
FT                   DCSGGEDSLLGSINNGWDVCYLYNGFESWSIIPNGDACVPDGGDEEEGQGE"
FT   mat_peptide     join(complement(481899..481940),complement(481484..481846))
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA0 "
FT   sig_peptide     complement(481941..482000)
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA0 "
FT   CDS_pept        join(482296..482526,482590..482667)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128703"
FT                   /orf_name="Pc20g02120"
FT                   /product="Putative uncharacterized protein Pc20g02120 "
FT                   /protein_id="CAP85541.1"
FT                   /db_xref="UniParc:UPI0001831674"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA1"
FT                   /transl_table=1
FT                   /translation="MAPHGVEGSRIRFSWHRGESEVIWLPLDATSSTPLFVKVLVGYAA
FT                   VRLVRAWSRGKKRRAIPMVVVSSTQHLRNTAQGLVEDERQISRRLGVESDVAVSLGE"
FT   CDS_pept        join(complement(483640..485030),complement(483216..483561))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194770" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824369"
FT                   /orf_name="Pc20g02130"
FT                   /product="Pc20g02130 protein"
FT                   /protein_id="CAP85542.1"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0001831675"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA2"
FT                   /transl_table=1
FT                   /translation="MTRKNATLSKRRSKANLTVATGSNGRANGKMNNNIEMRRRDTPSS
FT                   ETSAERTAQLMSRTSFSLDNEPIVPQTPVQTNTTFHNLPRSDRRNFLLLVLLYFLQGIP
FT                   MGLATGSVPFLLKPYLSYGQIGIFSLASYPYSLKLFWSPIVDAVWSTRFGRRKSWITPV
FT                   QVIAGLAMIYMGGHIEEMMVQAGADGGAGVWKFTYWWFMLVLFCATQDIAVDGWAITLM
FT                   SPPNISYASTAQTVGLTAGHFLSYTVFLAFNSKDFANRWFRTIPGDGGLLSLGTYLNFW
FT                   GWAYLIVTCGLAFLKKEERTKERDSIMDVYKSMWSVLKLKNIQTIIVIHLIAKIGFQAN
FT                   DGVTSLKLLDKGFGQDNMALVVLIDFPFEIMLGYYAGQWSTNYGAMRLWGWAFVGRLAA
FT                   AVLAQLTVMIYPTASEVPMWYMLTVIGEHVLSTFMNTVMFVSISAFHARIADPAIGGTY
FT                   MTLLATVSNLGGTFPRIFVLKLVDMFTQATCLPPTIPPPADSLKDTLIMTPFSCALEPE
FT                   KNRCINGGGTCHIDRDGYYMTNILCVLIGALTFIMFIKPAAQKLQDLPLRAWRLASNPQ
FT                   RG"
FT   CDS_pept        join(485838..485916,485973..486910)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947789"
FT                   /orf_name="Pc20g02140"
FT                   /product="Pc20g02140 protein"
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /cellular_component="chromosome, centromeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85543.1"
FT                   /db_xref="GO:0000775"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="InterPro:IPR018464"
FT                   /db_xref="UniParc:UPI0001831676"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA3"
FT                   /transl_table=1
FT                   /translation="MASHAPASPDPEEEELDSEIASIRAEIRKLQKHKRILTSSLLTTD
FT                   PVQKLLRKPQPPTTNPTDPLTRIFPLVHAAGAHTSSNHHRIAFGATAFPFKDPSPAANG
FT                   VTLLGVRIDVCTRNGRFAKPYYVILQKERSRAGPGAGGADSKVLKVYRHTVPAFISIAK
FT                   LESVYLPRPGVTRDNGDGAGGGSSGEDEDTEPAKPWKKGGNSARKQDLRGFVRELRREL
FT                   VAWHMRVDAVEFLREKLGLVGEGGGPLPFDVSPDRDTGIVSLAAVAIEARYVRIEWVDG
FT                   RVGRFKLSNTGIVERAVVIGDQGRDKKVEDAITGGGGRVETVLDRLRAEVLSGSPGR"
FT   CDS_pept        join(complement(487938..488898),complement(487218..487912))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194738" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824370"
FT                   /orf_name="Pc20g02150"
FT                   /product="Pc20g02150 protein"
FT                   /protein_id="CAP85544.1"
FT                   /db_xref="UniParc:UPI0001831677"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA4"
FT                   /transl_table=1
FT                   /translation="MESSAGPIFDEAQYRTDVLHLPSPESEAAQAQQLAEEAEQLGLKV
FT                   PEIEVSAPLAASIASGMVDLSSPVLSSGSSTDRNSMCGSLTPSHEPSSPVPSVLDQIVS
FT                   SLSDVTLSSDHIKAGSTRSLASLSTRPTSFCSSEGKPGLIGHGYNDAFEARSHRHSILS
FT                   IASADKKEKRRSSLKSAIGRIHFRKKRTSSAIVLPSDGRIAVSTSDKGVEHVFFEPTQG
FT                   PDNAAHEDVPLHASDEVSLPRLEIPRFSKEELQRSLDDPELSELHERHQMERNRHLAFH
FT                   DAALSTLRRRHQTAVSEHQSDNQRQEDERREKVRVTRFYSLVQNIQAIVQIEERQLAVE
FT                   IEQQREFDRAKMNSRTRIKHMEGYLRNASPPPSPAGTPTKAERSGRSSESFSESGSTPP
FT                   ARVLTRQHMEQLEQQYHSHKSMDQLHDARIKVLRDRQELKLQEATARMEKELDEMRNRH
FT                   IQDVAALKAEHQREESSLVQALETKKTTLQRRWYLEEAILRRHLEVRHGQSYGPLPLVT
FT                   FNTSTTPVGMAEHSPLETSSTPDTIHPSQDCVPL"
FT   CDS_pept        complement(489640..490515)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947790"
FT                   /orf_name="Pc20g02160"
FT                   /product="Pc20g02160 protein"
FT                   /protein_id="CAP85545.1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI0001831678"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA5"
FT                   /transl_table=1
FT                   /translation="MDILTYYYNRCFAFIIRTFVYFASNVTASPDEIRHIKSRDAGRTI
FT                   KVHLYQPSGSGPSPVLLNFHGSGFVLPLHGSDDEFCRRVSHETKHTVLDIPYRLAPEHP
FT                   FPAALNDVEDAVRYVLTRPDEFDLTRISISGFSAGGNLALAAASTLFPRDTFRSLLAIY
FT                   PVTNLSPDPASKIAPARGESVIPLPVMRLFDRCYIPSSFDKRDPRISPHYAQADRFPQR
FT                   VLMITADGDTLALEGEELAQKIKKLQGWHVVSERMQGCSHGWDKNARAGTPQYQAKERA
FT                   YQLAFDMLND"
FT   CDS_pept        join(491640..491729,491778..491850,491930..491939,
FT                   491999..492195,492249..492302,492384..493279,4
FT                   93131..493249)
FT                   /pseudo
FT                   /gene_family="HOG000194727" [ FAMILY / ALN / TREE ]
FT   CDS_pept        493817..495016
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947791"
FT                   /orf_name="Pc20g02180"
FT                   /product="Pc20g02180 protein"
FT                   /protein_id="CAP85547.1"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="UniParc:UPI0001831679"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA6"
FT                   /transl_table=1
FT                   /translation="MSTPLLGEMSPAEAESVYFNEYPPPKALPRHEALARAFIDLHVEA
FT                   HRRVVLVTSGGTTVPLEAQTVRFIDNFSAGTRGATSAEYFLEQGYAVIFLHRQYSLLPY
FT                   SRHYSHSTNCFLDFMDEAPASADSSNPGHGPIMVRDEYQDQMRSVLRKYRYAKQNNRLL
FT                   LLPFTTVSEYMFELRSIAKLMRPLGPDALFYLAAAVSDFFIPRSRMAEHKIQSSELPPH
FT                   MRGSAISSDEIYTGENEEKASSNSRKLVINLDPVPKFLHQLVDGWAPEGSMVVSFKLET
FT                   DPSLLVYKARTALQRYSHHLVIGNLLSTRKWEVVFITPDEPHERWLRVPKSRRSKSISG
FT                   VEDQVGLAEAKKGNPSTSEEAKAEQVNETSRDGIEIESLIIPELVKLHTKMIEKTQAAQ
FT                   "
FT   CDS_pept        join(495698..496702,496778..497107)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977592"
FT                   /orf_name="Pc20g02190"
FT                   /product="Pc20g02190 protein"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85548.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR003378"
FT                   /db_xref="UniParc:UPI000183167A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA7"
FT                   /transl_table=1
FT                   /translation="MVPRRLSRRLIAVAAAIALFFLYHVSSLSSHNRQWRPHFTTTEVT
FT                   PAVGDNGEPAPFCPPLPGIEDVLVVMKTGVTESRDKVPIHFQTTLRCIPHFVIYSDFAE
FT                   EIEGVKIHDVLRNMDSAAKKNPDFDFYHRIVKYGRKGLEQQDFSDEANSAIGKPNNPGW
FT                   KLDKWKFLPMAQEALRHKPDAKWFIFVEADTYVSWPTVLTWLARFDHTKPHYLGTETQI
FT                   ADVIFAHGGSGFMLSNPALQRASDEYAAREVELNAFTDQHWAGDCVLGKVLSDAGVNLH
FT                   FTWPILQNSNLGELDEFTTDFYRKPWCFIAVALHHLSPIDIENLWKFEQKRWRDKNKRI
FT                   LLHGDLFREYISPEINSQPTRPNWNNMANEDQPFAHTFEDCRLICQTQNACVQFAFREG
FT                   KCFTSANPRLGHAVPSGDATSGWITSRIRDMTGKKGLCRKPDFGD"
FT   sig_peptide     495698..495787
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA7 "
FT   mat_peptide     join(495788..496702,496778..497104)
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA7 "
FT   CDS_pept        join(complement(498803..499273),complement(498234..498640),
FT                   complement(498096..498181),complement(497721..498040))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194692" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947792"
FT                   /orf_name="Pc20g02200"
FT                   /product="Pc20g02200 protein"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85549.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniParc:UPI000183167B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA8"
FT                   /transl_table=1
FT                   /translation="MHWLFIGSAALFLFLPASALSRGIVDHGHWNELRDLTHNASHNGS
FT                   QAKSSPPLVIDTFKNPTRNDLGFWHGSGENLTVQHGPGFVRLFPTDPDQNFHTQFDSNA
FT                   CYGLIPWYNEYLHVIFEGTDQYSVSFNQHNDECNPQRRPFPGIADSVQAERYVLYIPLA
FT                   HFDIDFNRVVSVSFHGFYTNESITLHRVEIVPDVPLPSPENGHYLVPGKMPNGKLVLRC
FT                   SRPNSFAFGIDDGQPQYSQQVMRILDEEGVRVTFFVVGAGLRDPTSNFTEFYKEMLRKG
FT                   HQVAFHSNTHPKMESLPTLAEIDDEIMQSMRIFREQLGIESSYFRPPFGTVASRLRQEL
FT                   ARHIPNPSIVNWSVDVEDWLWADTSTPEKQLEAFFRSVEKGGNLAVMHYLHPTTIGYLP
FT                   EFIRHVKRAGYQIMRIDQCLGDASAPPL"
FT   mat_peptide     join(complement(498803..499210),complement(498234..498640),
FT                   complement(498096..498181),complement(497724..498040))
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA8 "
FT   sig_peptide     complement(499211..499273)
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA8 "
FT   CDS_pept        join(complement(502189..502559),complement(502069..502126),
FT                   complement(501882..502017),complement(501468..501828),
FT                   complement(501326..501405),complement(501078..501229),
FT                   complement(500812..501005),complement(500612..500760),
FT                   complement(499950..500527))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268804" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947793"
FT                   /orf_name="Pc20g02210"
FT                   /product="Pc20g02210 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP85550.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001831751"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA9"
FT                   /transl_table=1
FT                   /translation="MESYDDPEVASAADAPEVGDSAAAEAASAVGSDVGEPPVAGVLSG
FT                   VGPNAEAAHQIARDKGWTDPVPFEYAELANSKDHLEWAGVAARYEWKGEYGDIGPRVPE
FT                   LEEQLFSGDLIARAGAKLDALNGYKVKVESASEIESVTEWVNLGLHPVMLENVRLCGYE
FT                   HPTAVQSYAIPAVLANLDVIAVAQTGSGKTGAFLIPILSKLMGKARKLAAPRPNTAERF
FT                   NPREDAVRAEPLVLIVCPTRELATQIFDEARRLCYRSMLRPCVAYGGAPSRQQREELQK
FT                   GCDILIATPGRLLDFMAQTHVLSLRRVRYTVIDEADEMLESDWEEEFKKIMSGGDVNED
FT                   ADHRYMMFSATFNKEFRKLAKQYLNENHVRLRVGRAGSSHHNVVQDIIWADQPKKMRAL
FT                   YDLLISMPPVRTLIFVNSKEQVDFVDDYLFNSGMPTTSIHGGRTQREREDAMRAFRTAK
FT                   CPIMVATGVSARGLDVVNVLHVINYDLPSAIHGGITEYVHRIGRTARIGNEGIATSFYN
FT                   DRDEGIAEDLVKILIECDQAIPEFLQQYRPEGDVLEFDDDSDKEFFDNQSNAGAEAEAD
FT                   HESSNADAESAAAEAEADHESSNADAESAAAQAEAEESDKVVADDAEDDKPAVPRPTIT
FT                   SEEEEEASTWWGPTTIVTERKKPREEAKPKDTKAGLAGSHWAPKPKPAPKDDDAFWQ"
FT   CDS_pept        join(503454..503672,503810..504092,504148..504676,
FT                   504726..505053)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194691" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947794"
FT                   /orf_name="Pc20g02220"
FT                   /product="Pc20g02220 protein"
FT                   /function="ATP binding"
FT                   /function="pantothenate kinase activity"
FT                   /biological_process="coenzyme A biosynthetic process "
FT                   /protein_id="CAP85551.1"
FT                   /db_xref="GO:0004594"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0015937"
FT                   /db_xref="InterPro:IPR004567"
FT                   /db_xref="InterPro:IPR011602"
FT                   /db_xref="UniParc:UPI0001831752"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB0"
FT                   /transl_table=1
FT                   /translation="MAERVEVDTRKRPNRLEAAITNPGAVKINVTGAFIVDDEPRSKSP
FT                   VDAEGVHYENKDIRLPHHTGVVSHVAVDIGGTLAKLVYFTRELDTADNGGRLNFLNFET
FT                   HRIDLCINFIRQLKEEHEKRNGSTREGLCVVATGGGAYKYYDRLKEELNVNILREEEME
FT                   CLIIGLDFFITEIPNEVFTYSDADPEPMQYAEARADVYPYLLVNIGSGVSMIKVSGPRQ
FT                   FERVGGTHLGGGTFWGIMSLLTGSRTFDDMLAMADRGDNSAVDMLVGDIYGMDYTKIGL
FT                   KSTAIASTFGKVLRLKNDAEQGAEDGEGLIRDDPSEASESSKSSHGAKPNPEDMSRSLL
FT                   YAISNNIGQIAYLQSEKHSVKHIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAYFLRH
FT                   EGYLGAVGAFIRRQPQNWGRRNSVDDVVAPQAVRNLVQNNSVLQQHGRSSSDL"
FT   CDS_pept        505713..507248
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671679"
FT                   /orf_name="Pc20g02230"
FT                   /product="Pc20g02230 protein"
FT                   /protein_id="CAP85552.1"
FT                   /db_xref="UniParc:UPI0001831753"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB1"
FT                   /transl_table=1
FT                   /translation="MAESPLHVISDQLKRLAAQSPAARNASPVSAARVDATEPIIQGSV
FT                   LNAPEGTDSQVPTSTESDLTDIDESLLQDPSDPAPRPQSTPSETHFINPTAPRVSYQVS
FT                   ASGEVMIIEETQTPRPIARAPAPRPSPPAYLSFDRLAQGLSPKLASSPTTSTIQPPSLA
FT                   VERIIGPKQPIPARILELLEEWHEDSPYTEHPSALSGRAPTTWKHFKAFSDDGDECELS
FT                   IFQISLKGQTRRSVTYRIMILHSQNGPEELVVYGQPRPKFRGPLTKGTRGLYLLDWLEI
FT                   EQKGEVQACGLKLWRTDEQNITFSAHMFDYGRKCTRLSGPNDIFNMRASSSTPKKQSGA
FT                   NENIEDAGSNSSEPPYSPSRSSRQASTSNHPKPENEEDKTSVTPRPSPAKTGSPEFRPL
FT                   ASPWKPQKRRRGTWSSNDETSVLRYKLMSDESDQVRVFKTNDAKVLFEKAQQFYKGMEK
FT                   RTGLLCTVYGVEGVRYVGEGCVDEFDILQEDIRKTSGPGDEDRVVVVKPAMGF"
FT   CDS_pept        join(507964..508291,508369..508634,508968..509546)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947795"
FT                   /orf_name="Pc20g02240"
FT                   /product="Pc20g02240 protein"
FT                   /function="phosphatidylinositol N-
FT                   acetylglucosaminyltransferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85553.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017176"
FT                   /db_xref="InterPro:IPR009450"
FT                   /db_xref="UniParc:UPI0001831754"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB2"
FT                   /transl_table=1
FT                   /translation="MASPPSLDPFPPPIPVDTHPNRATGSKPPELERSLPDPNRLAPED
FT                   AYFAPSLSRARSAPSNYEENLRSLNGDGSAHIGSTAALRKKLGGPGRRRKRKGAWKKLL
FT                   WVKQSYPDNYTDTETFLDHLQRNPRVRPYDFWPLVADSTVIVQHVCSVVIFVCCFVGIV
FT                   QDRVSPVSIVCWGSVGTAVGWILWDNWIWKEHGESRLTTVKSAFLIYFSLLGLSPILKS
FT                   LTKSTASDSIWAMSCWLLIMNIFSFDYGSGEGAGATTKFPASLSTNAAVMASTVLASRL
FT                   PSTTHVFSLMLFSMEVFGLFPIFRRQLRQKSWTGHVLLTLALVIVAGGAVGVTLSGGWA
FT                   AAIIGSVLGSILTAFVMGGCSWWLISLQKYKNVVIGPWDPARPIIRRHWN"
FT   CDS_pept        join(510419..510483,510558..510850,510918..511521,
FT                   511575..511938)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194647" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947796"
FT                   /orf_name="Pc20g02250"
FT                   /product="Pc20g02250 protein"
FT                   /function="cation binding"
FT                   /function="chitin binding"
FT                   /function="chitinase activity"
FT                   /biological_process="chitin catabolic process"
FT                   /protein_id="CAP85554.1"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0006032"
FT                   /db_xref="GO:0008061"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR001002"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018371"
FT                   /db_xref="UniParc:UPI0001831755"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB3"
FT                   /transl_table=1
FT                   /translation="MFKRLALGLLAAQSVAAMRFAMYHTTALPGQEKTEGIDYAIMSFA
FT                   ASKLFNSDSPAEYKPFESPETMRKRFSPDTKLMVAIGGWGDTAGFSEGAKDEASRTRYA
FT                   KNVASMLDAHGFDGVDIDWEYPGGNGQDYRQVPNEEKVDEIETYPLFLEALRKELGDKI
FT                   ISIAVPGRKQDLIAYTKEQGPKIWKSVDMVNVMSYDLTNRRDNVTNHASGVQGSLDTIN
FT                   EYLAIGADPEKLNLGFAYYAKWFTTNADSDCEENPLGCELAKLENDDGSDNGKSGALTF
FT                   EASTVAAPPKDLKDSTDGLCGFGAKTKCPSGQCCSSSGYCGTTDEFCQAGCLSDYGTCK
FT                   GISITDSWRKAQKDGKTDEKGGGQYYFDSENNLFWTWDTPEMIARKFKEIVAEKKLGGV
FT                   MAWSLGEDTYKFEHLEAMQKGIKSQSNSPKVEEPPVAERGCA"
FT   sig_peptide     510419..510469
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB3 "
FT   mat_peptide     join(510470..510483,510558..510850,510918..511521,
FT                   511575..511935)
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB3 "
FT   CDS_pept        join(complement(515148..515444),complement(512152..515097))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216236" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977593"
FT                   /orf_name="Pc20g02260"
FT                   /product="Pc20g02260 protein"
FT                   /function="acyl carrier activity"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP85555.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0001831756"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB4"
FT                   /transl_table=1
FT                   /translation="MATVTITTTEGGVKPLQTQDIATRLLNGTLHSQWPPFEQFATIDG
FT                   LLKSHAAQPDEAKRPLICYPIRGAADFEEHTAGAIDRYTDLAVRFYMQQGLVPADPNLE
FT                   QAPVVAMLAGSSFEVVVTFFALNRLGYAVLFLSTRLTAPAYIRLMEMANCSQLIKANQF
FT                   QQVVTEICAERPGCSTFSLLQREDWFNRPVSTPLFERPGADPSGEGKKIAWILHSSGST
FT                   GFPKPIFLTNLQTLANFCKSFGLRLFTISPLFHSHALMEFGRAFYTRAPAYLGNHSLPV
FT                   TYQNLFDALQVAKPQQISAVPYVIKLLAEKQEGIQALARPQLVLYGGSSCPDDLGDRLV
FT                   AQGVNLVGNYGATETGQIMTSFRAPEDKEWQYMRLHRPVADLTLMDEISPGVFECVALD
FT                   GLPSKGPSNSKPPYSAKNPENSFRTADLFTRHPDPEKDNYYKYLSRLDDRITLVNGEKV
FT                   LPIPIEGRVREEPIVSDCVVFGFQRTVPGALIFRAPGKVPHLSDAEFLEAIWPAVEAAN
FT                   SRAETFSRIPKELVVIEGSDVVYARTDKGTCIRAQVYQQFEEDIKQAYAKFEGSGQKRG
FT                   SLALSIPQLEDWLLSRFSEDLGVLIPGAEADIFSAGVDSLQTTQIWRCIMRDIDIGEGG
FT                   DQLSQNIVFEKGTVSALARHLYQLRTGQEFEREDELHSMREMIEKYSHFTHHFPTIARS
FT                   PETEVVMVTGATGNLGAFIVSELLKRPTVSEVWAIVRAPGQAAAGARLYKALADRSIVL
FT                   TEPEAAKLHAVPGDMSQPNLGLKDHDLQHLVSCLTCIIHSAWAVNFNLGVRSFEQQHIR
FT                   GTYNLINLCLRSHLPSPARFFFCSSVSAAGNTPKPASIPETIIEDLEHAQRTGYGRSKL
FT                   VTEHITRNAMRQTGMQARVLRIGQLGGDTVGAQWNDTEAVALMFRSALTTGALPELNER
FT                   PSWLPVDQCGRAISDIAMNVSGSADLNMVYHLVNPRTFSWKDDLLPALRQGSALAEFEV
FT                   VPPQEWLSRLATSEQDPEKNPSVKLIDFWRSKYASHGLSETGPGRNEEAGLTFETERTV
FT                   QDCPSLGLVEDPVASGLIQRYIESWMSRWAGE"
FT   CDS_pept        join(complement(517676..518094),complement(517216..517612),
FT                   complement(516980..517160),complement(516004..516908))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000159116" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824371"
FT                   /orf_name="Pc20g02270"
FT                   /product="Pc20g02270 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP85556.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0001831757"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB5"
FT                   /transl_table=1
FT                   /translation="MSPCSFMTGIFIVALLLVTHGDARAGQVSSASVAGAPLFDSEKFQ
FT                   LTDNDIAKLSQQQSALVKFGCDGTSKPTQPTRKCKVFPGDRQWPSQSVWSAFDDLLGGA
FT                   LIKTVPLAASCYSSWPQYDSDECERISSQWTDSHLHAADPASAMWPLFEGRTCLPTTNA
FT                   SASCTLGGYSSYSVNVSNVAQIQLAVNFARNADIRLVVKNTGHDFNGKSTGAGALGIWT
FT                   HNLKDIEYYENYRGSGYQGPAVKMGAGVQAFEVYAKGQELGFTAVGGEGKTVGVTGGYV
FT                   LGGGHSPMSSLYGLAADQVLALEVVLANGRFVTVTEESDPDHFWALRGGGGGTYGVVTS
FT                   LISRVYPKVGVTVSTFNFSTGKDVSVETFWAGVRSYLERFPTHADAGTYAYFWIMPTGP
FT                   NAFTFLMNPFFAVNHTVDEFNALVKPWYDDLHELGISFQPNTTYYDNFYDGWMAGFALE
FT                   TVASSTMMTGSRLFPRANWDTPTSLNATLNALRATITDGFALLAFNMKAELHEGFTSNS
FT                   ANPAWRQTLMHAITSTSWTNTTSDADIKVKMDDLTKAVGKWRAVCPDSGAYMSESDIQE
FT                   PHFQQAFYGTNYDRLYKLKQRYDPTGLFYAPTGVGSEDWVVKSLDGLPDQNGRLCRV"
FT   mat_peptide     join(complement(517676..518019),complement(517216..517612),
FT                   complement(516980..517160),complement(516007..516908))
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB5 "
FT   sig_peptide     complement(518020..518094)
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB5 "
FT   CDS_pept        join(519649..519772,519836..519861,519919..519955,
FT                   520009..520082,520149..520528,520601..521126)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824372"
FT                   /orf_name="Pc20g02280"
FT                   /product="Pc20g02280 protein"
FT                   /protein_id="CAP85557.1"
FT                   /db_xref="UniParc:UPI0001831758"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB6"
FT                   /transl_table=1
FT                   /translation="MIDDHHQKTALGIVVAFTILGGIAVLLRLWSRWLSRSTLTVDDYL
FT                   IVVGYILAISQSVASWYYIKTNYVGIHVWDIPKSYNPRPGLNWNFANQLLYNPALTVVK
FT                   LSILVFLRRLDSRSRVVKYLILSSYVVVISLFIAVLFVDIFQCHPVQYVYDTTIPGGKC
FT                   INQGAFFVSTAALNLFTDIMVLAIPIIITARLQMPLRRKVAVCVILCLGGVATAIGVWR
FT                   VIILAKGFLSHTPNPDATYGIGFCSSAIEVNVAVVTACGPSLKAISSRFLPRLLDSSRG
FT                   KSTYGAGTGSRTLRSNRFKSASHAQPSVHSTRGADYEMADPLGGPRVDIIGDFEMRKYK
FT                   RGESSSLSSGDDKGIMKTTDISVGYSMEPRVGDGRSQEGRPASVDSMI"
FT   CDS_pept        complement(<521455..>521964)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(<522388..>525876)
FT                   /pseudo
FT                   /gene_family="HOG000184689" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(<526297..>527178)
FT                   /pseudo
FT                   /gene_family="HOG000213035" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(529059..>529183),
FT                   complement(528857..529004),complement(528692..528799),
FT                   complement(<527918..528640))
FT                   /pseudo
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(529691..529880,529948..530165,530227..531501)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000135353" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671680"
FT                   /orf_name="Pc20g02330"
FT                   /product="Pc20g02330 protein"
FT                   /function="sulfuric ester hydrolase activity"
FT                   /protein_id="CAP85562.1"
FT                   /db_xref="GO:0008484"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI0001831759"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED5"
FT                   /transl_table=1
FT                   /translation="MTRPNFLVIVADDLGFSDTGAFGGEIKTPNIDNLANGRLRFTDFH
FT                   AASACSPTRAMLLSGTDNHIAGIGTMSETWTGDQKGKPGYEGYLNDRVAPFPELLQAAG
FT                   YHTLMSGKWHLGLTPERWPCRRGFDRSFSLLPGAANHYAWEPQLEESNNAPGLLGETNV
FT                   FYVENDKHIQPQELGDDFYSSDAFATKLIRYLDERDAAEKEKPFFAYLAFSAPHWPLQA
FT                   PDSDIQDYRGVYDEGPEALRQRRLKRLKELGLIPEHTVPHDVVAVGGHDLSRDWGELDA
FT                   EKQAFSARTMECYSGMVQNMDRHIGRVVEYLREQGELENTFILFMSDNGAEGLLLEAIP
FT                   IIKGDVHDHIAQYYDNSLQNMGRKNSYVWYGPHWASAATAPGRLYKSFTTEGGIRVPFI
FT                   LNYPPLTARSYPGGIDHSFATVMDIAPTILELAGVDHPGTTYRGRTVAPIRGKSWVPYL
FT                   TGQTGSIHSDNAVMAWELFGRQAIRKGRYKAVYIPKPYGPERWQLYDLVQDPGERDDLT
FT                   DHLPDTFADLIKEWDRYVYDVGLVQGSAQPSYVVEEKGYCYED"
FT   CDS_pept        complement(531801..532268)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977594"
FT                   /orf_name="Pc20g02340"
FT                   /product="Pc20g02340 protein"
FT                   /protein_id="CAP85563.1"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI000183175A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED6"
FT                   /transl_table=1
FT                   /translation="MSSTIPYFRPSNHAQGLANYPHARTVPSSNGQGSYIYVSGTSSRR
FT                   GDGTFVGATRTEDSAGKVTLDLDIRQQTASVLSNIHADIQAASKGKAGIHDVVDATVFL
FT                   TSINGDYSGMNEEWNRVWPDRTTAPARTTVEVRALPREEILVEIKCVAYYQ"
FT   CDS_pept        join(complement(534379..534788),complement(534057..534295),
FT                   complement(533127..534001))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947797"
FT                   /orf_name="Pc20g02350"
FT                   /product="Pc20g02350 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85564.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000183175B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED7"
FT                   /transl_table=1
FT                   /translation="MDAVSTLWELDTLESANDYLASHGSNAPRLQHFIDGSFGRHSEPV
FT                   EWIESLNPRSGRLLAQIPSGTVTDVDRAVDAASIAFLTWSKTSRQERSQVLMRISDILG
FT                   EKKELFAVWESIDQGKTLARARVEVERAISNFRLFSLRYFATYILHEEGAVRYVDGQPF
FT                   TLTYEHRSPVGVFGLISPWNMPLYLLTWKIAPCLAFGCTGVAKPSEVTSITAFLLGEVF
FT                   RQAKLPAGVMNLVFGDGPGTGSALVKSSRVRGVSFTGGTNTGIRIRQDTVADIGKHLSL
FT                   ELGGKNPVLVFDDVDLTKAVPLAARAAFENSGQVCLCGSRIYVQRAVYAKFLSALVEYV
FT                   ESNYKLGETMGPVVSREHYLKIRGYLVQAQEENAVFHTGDVPDEEPQQGFWITPTVLTN
FT                   LPTGSRVMREEIFGPVVTVCPFGTEEEAIALANDNPNGLAGIVMTNNLARMRRVGERID
FT                   AGLIWVNCWLVRELGTGFGGMKASGTGREGGAHSRDVFTNLRTLHVSHF"
FT   CDS_pept        join(complement(535674..536296),complement(535150..535612))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000254105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947798"
FT                   /orf_name="Pc20g02360"
FT                   /product="Pc20g02360 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP85565.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI000183175C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED8"
FT                   /transl_table=1
FT                   /translation="MPPYLPDFSTSHCMSQSNSQEWITLRPHDTPGGISDGQNSPTASK
FT                   VDMFVGDRFFRTVEPNCFDPYVRIAEMDASGVDVQVISTVPVLFSYDKPVEPAAAMARY
FT                   LNDHIASVCRDHPRRFVGLATVPLQDVAVSIKELRRAKDILGLKGVEIGTEVSGKTLNS
FT                   ADFEPFWTACEELDFPIFVHPLGYELEQENKERWGKYWSAWLIGMPSETALAMHSILSS
FT                   GVLVRHPNLRFCFAHAGGAYLPLLGRIQHGYDCRPDLVAHSSQGVLPQDYIQSQQHNIW
FT                   LDSLVHDPDLLQFICKKIGAERIIMGSDYPFPLGEMPVPGEMLASDAQVGSFLSQEKRA
FT                   QMLSGNAIEFLGLEGMFPGCK"
FT   CDS_pept        join(536814..536988,537065..537078,537150..537255,
FT                   537305..537567)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000218448" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947799"
FT                   /orf_name="Pc20g02370"
FT                   /product="Pc20g02370 protein"
FT                   /function="3-hydroxyanthranilate 3,4-dioxygenase activity "
FT                   /function="iron ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85566.1"
FT                   /db_xref="GO:0000334"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR010329"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000183175D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED9"
FT                   /transl_table=1
FT                   /translation="MEHASSAQTSIPGPVTLHSWLSANAQKLQPPVNNQCLYSGKDFIL
FT                   MAVGGPNTRNDYHINQTEEWFYQIKGDMLLKIVENGTCFRDIEIREGEMFLLPGDIPHC
FT                   PIRYEETIGLVMERTRPPHVVDRIRWYCPNADAHRTVPSIIREESFHCADIETQLKDLI
FT                   NHWMTDESTRKCGGCGEIAPPH"
FT   CDS_pept        join(complement(539884..540038),complement(537709..539818))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824373"
FT                   /orf_name="Pc20g02380"
FT                   /product="Pc20g02380 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85567.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831834"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE0"
FT                   /transl_table=1
FT                   /translation="MNERQRVWRACQICRRKKVKCDGEHPCESCTRNQAECVYIDPSVN
FT                   MRMVDPQYLMKLERQIQLMEKRLHQQSQAQPSTGHDDQLSENVQAGEEDLDSGGAMLRS
FT                   VPRPIAANVSHSDDANHGPCLLPDQPADGLHEGPEAQQQEDVVTAPQPPEPAAIDVTRL
FT                   PEPLLRLMIDLFYRSIYPIFPIISQRDFQPQFDRWLSAHQGCLGSEDDDFLLLLYALLA
FT                   VASFLLPEEHAIFDQPHLKAYKRVDLGGLLCSHATSKFPGRPTAHNATSATNLVVAQGL
FT                   LTFYLTECGKVNDAWITVGHAIRLYQALDLENGVDAAAEVEARCGVHGNIWWCLYILDR
FT                   SLSTALLKPLAIDNSESNMDHYDGESQLTLIPEDKIDPWFAVIAEFHIIMGRIYKSVRW
FT                   IRRRHQPQNAAHGDNSMLQSYMKKYDTELQTYYTKRVLPKMEGPHSAARPLALQNVAES
FT                   SYYIGIVLLYRTFIERLKIEDPEVFLRCAEAASNCIRVTPQVMATVPASHFVIQQCRAV
FT                   YTSTKVLLHCIRMAKNTGYTNKAWPDVQRGCDMLRKTKIQWPEVKRYQQVTEEDMYLTQ
FT                   VHLSKHELFHRVFGRYGMESQIRPSGNGETNHGSPCRTRTSHTDRPQGSPGVADNDAIS
FT                   SHRDPLNNAPEVDLTRTPQSLLSHNYGQESRLPERQPKRRRLSQNFNVHPAPSPYYALN
FT                   TPPILSEADRLPMLNAAIGSSDFLLPGIPPLPSVPRDCTPDLLDDSMLMSSFDLFFSHS
FT                   E"
FT   CDS_pept        540948..542402
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947800"
FT                   /orf_name="Pc20g02390"
FT                   /product="Pc20g02390 protein"
FT                   /protein_id="CAP85568.1"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniParc:UPI0001831835"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE1"
FT                   /transl_table=1
FT                   /translation="MKSETTSRHHAAPAKIRDAFSRAMSAMYASEVPLYGRLLSLVSRV
FT                   NKTTLEQDGLLRQRLEATDDLDRIDMERHGAIRVGTPAELHSVRRVLHVMNMLPTGFYD
FT                   LSAAGVPVYATCFRPHSASELSKNPFRLFVSLLQLHLITDEKLRTIATETLARRQIFSD
FT                   RMYELLDICERYGGLTDAEAEEFVQEARDSFRWHASAAVPYDDYMRLLRDNSVLADIVA
FT                   FRSPHINHLTPRTLDIDEVQSDMLNQGIPLKEYVEGPPKRKCPILLRQTSFKAIEEAIE
FT                   FPNGNKCDPRVLPSAVSGYHTARFGEVEQRGVALTIKGRQMYDSMLQSALQDGITAAHG
FT                   DAYSLKFARFPDSWEELRAEGLAWFQYRVDWDQLQSSETPKSDDLEYLIRSGYVVYEPI
FT                   VYEDFLPISAAGIFQSNLAKPGTTNGGSPKMVPCSNRREFELALGAATMDEMILYKNIQ
FT                   EESLLKCRQCVQDLKLGAATRQENSM"
FT   CDS_pept        complement(542632..543633)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947801"
FT                   /orf_name="Pc20g02400"
FT                   /product="Pc20g02400 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85569.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831836"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE2"
FT                   /transl_table=1
FT                   /translation="MDTLPQSMKAVVIDKHGDSSVLRLETQHPLPVMNETDVLVKVHYA
FT                   GINFVDTYQRSGLYPVKLPLQVGREGAGTIVDIGSNVPPSYGLQVGNRVAVFTQGTTAE
FT                   YVSAPAESVMVLPRSVSTEQGAAIMLQGLTAWTIVQDAHKVEQGQTILIQAAAGGTGGM
FT                   LVQMCKHLGATVIGTVSTPKKAETARKHGCDHVILYKDNDVQEEVMRITSTKGCHAVLS
FT                   GVGEATFAEDLACTRRKGTLVSYGNSSGAVSSFRVLDLSKKNVKLVRPTLANYIMERDE
FT                   FVLRSQQLLDLVGSGVVRPELGGEYRLGEVAQAQDDLTTQKTTGKLLINIQT"
FT   CDS_pept        join(544742..544771,544857..544944,545000..546244,
FT                   546295..546431)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128704"
FT                   /orf_name="Pc20g02410"
FT                   /product="Pc20g02410 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85570.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0001831837"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE3"
FT                   /transl_table=1
FT                   /translation="MATQYQLPFKLSDPSLLKFDSVIGDKWVGAKSGKRFEVLDPGTDK
FT                   PWASCPANAAEDVSAAVENAHTAFEQFRKVNPRQRAKWLLEWHNLTVAARDDLAQIVTH
FT                   ETGKPLSEAYGEIDYSLGFLWWFAGEAERIQGSVSTAAAPNRRIFTIKQPIGVAAALVP
FT                   WNFPVAMVLRKVGAALAAGCTMVVKPSPETPISALVLAELAHRAGIPAGVLNVLTTDLE
FT                   NTPALSEALCKHPLVKKVTFTGSTRVGKLVASHCAHGLKKLTLELGGNCPFLVFDDANL
FT                   DQAVEQLMSLKWRHAGQACITANRIYVQAGIYDRFAALLKERTAAIVVGHGAVAGTTMG
FT                   PLTTPRSLDKASAQVEDALRLGADVILGGKAVTSQPGYFFEPTILSGMTEEMLISQEES
FT                   FAPIAALYRFETEEQTVKLANDTSMGLASYAFTKNIDRMWRLLENLEAGMIGMNTGNSS
FT                   AAESPFGGLKESGYGKESGKDVAVNEYLVTKTGTLTIEGQY"
FT   CDS_pept        join(546638..547738,547804..547938)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824374"
FT                   /orf_name="Pc20g02420"
FT                   /product="Pc20g02420 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP85571.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI0001831838"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE4"
FT                   /transl_table=1
FT                   /translation="MDDLSLLRHLIQNHPLIDHHAHNLLNPEPATDYDNYPLEAIATSA
FT                   GGRALENARTTLPSLRAASQLSELYGRPCADWNDVQSAHDESMRGDYSNLIQKSLSGTH
FT                   ALLLDDYLSDDEDIESSSWHDSFTASPTKRIVQIEAMAESTILQVSNSRKNGESVWNNF
FT                   RQRFQDALATAMEDANIVGFVSEICCRTGLDVDAYSSDDTTLGGSLIRILDSGTTKSGF
FT                   AVDDKEICDWIVQQTLKAISFKKRAGIVKPLLFHTGLGDNRINLLRANPACLQPLIAQY
FT                   PVADIVLLNAGYPYTREAGYLAATYPNVYLDLGKVFPMVSREAQMKVLRESLELAPTDR
FT                   LLWSTGGRFHPETFWLANRQFRQALETVLVDYVQNGDFMASQAMKIAADVLFYNANRLY
FT                   SLNLTPSYTAAE"
FT   CDS_pept        join(complement(552323..552784),complement(550833..552217),
FT                   complement(548826..550761))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824375"
FT                   /orf_name="Pc20g02430"
FT                   /product="Pc20g02430 protein"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85572.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI0001831839"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE5"
FT                   /transl_table=1
FT                   /translation="MDLPRARQDGLHNADRRARELYRYYKPASQAEVVPTWLPANDGFP
FT                   FTANSGNIITPPISEGSVPSHSPPSRPASAGSEALVLGTSNSTMTSFAQLAALRLNAER
FT                   VFVSVLDRDQQHIIAEATKSVNLNDPSIHDDNDNIWLGTSDTRKAWSVCKDIVSLPPND
FT                   RKNADYQFLIVNDMTENERYKHLSFVEKDPNFRFFAGTPLTTERNINLGCFFVLDKKPR
FT                   DGLTPLEKDTLGSISMLVMDYLRVCRQASEGRRAARLSRGLSYFVEGSSSFVDNVDPSR
FT                   TDSVGHLSATPASSYNRISASSRSHGDGSENASQAPSNSPPNDRSLSNDARSFSSVPSD
FT                   LKLDYDWKLGSGSKLDNGSNVESGTVESSLPEWLTSSSRNRLPPDDSQGTSWSFRRAAN
FT                   LLRESLDLSGDGGVIFLEANNSPLMDADMGGDCSDTGGPASVLSASTNEEPFAPQAGSM
FT                   TTCPAANLDRSFLQLLLRRYPKGKLWSFHRDGLISTSDDDDQEAQDKGPLGTSATSRSP
FT                   PNAQPSKPTRKRRKAAENSVLNQYFPHAAQIMFVPLWDAVSSQWFGGCFCWSTIETQVF
FT                   TTSVELSSVLGFSSSIMAEYSRVESLIADRQKGDFIGSISHELRSPLHGILAAAEFLNS
FT                   THLNEFQDSLLETINSCGRTLLDTMNQVLDFSKVVSLERTWRSMKRKKESQLDYKGSDK
FT                   LPHHLDTLVATDVAILAEEVVEGICLGNVYGQSSTASADLPVLMPHQTKSQHQRSNVEV
FT                   VIDVPFRDWVYRTQPGALRRIIMNIFGNAMKYTEFGRVTLSLAASSQSEGRSRRQGLED
FT                   LVTLTVTDTGKGISEEFLRGKLYTPFAQEDALAVGTGLGLSIVRSLVKALNGSIRIRSR
FT                   PGEGTVVRVSLPLERPVGKESPEIEPSGQLMQQRETLTQTLLLREGYLGRRASIWGIDP
FT                   SEVTANSNWSEIARYLSEWYDIEIVAWTPDAHIDLVLMDENDLPNFRTIAPSATLPALL
FT                   VLCHKSVDYTGSKSEWLSLANSVNIIRRPCGPHKLARSVMRCLTHGQPRSTTPASALQP
FT                   LNLPIRTSSLPSELASPHMSTGDDIGAPEQDCPGGRPMTVSPLRQPSPMTALKEEISEA
FT                   PLPDPLVEGAKPSRRLARVLVVDDNRINLNLMMTFLKKRQLTDLDPAENGKLAVEAVER
FT                   MQSGYDIIFMDMSMPVMNGFEATRAIRSLERDTDGRKPAIIIALTGLSSSRDESDAIAS
FT                   GVDLFLTKPVSFREVARLLNEWERGELVTERKMTC"
FT   CDS_pept        join(complement(555544..555774),complement(555376..555487),
FT                   complement(555055..555317),complement(554662..555004),
FT                   complement(554541..554603),complement(554286..554490),
FT                   complement(553864..554215))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200355" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947802"
FT                   /orf_name="Pc20g02440"
FT                   /product="Pc20g02440 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP85573.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183183A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE6"
FT                   /transl_table=1
FT                   /translation="MADDTSDSKSVDVVSAPVREDIKTPSEEPSDNSDDSDGRKPPPLA
FT                   AKLCAVALISCISFGSHWSSGVTGAMKSTMKKEMHIDNVQFSLLEASEDFMATVLLLIS
FT                   GVITDRVGGAQMIVYGNIVYTIGSILVAAAATVRSFDFMIGGRIILALGDIATQIAQYK
FT                   MFSSWFPPSNGFASTLGFELAIGKIGGFIGKSTSNIIASKTGNFAWVFWTAVFMNLFTN
FT                   AASAAFWFFNIYCNRHYKGRRDEATKEQLTEKNKKFEFKKMFELPWMFWAVMGFSIFQT
FT                   SAASVFSQNATELAEKRFNVDSIKAGWYSSLSQYAGFFLVPCLGVFIDVLGNRASVLFI
FT                   CGLGMLLSMVLINFATSHAGTGAAFGIYGIAVSFGPTSVIDSIRTTLWHQSVFGSAYAL
FT                   KVTMNNAMSIIIRIITGALQDADDNSYRRVVQVYLVLGAGATVVGAAILIGSFVTDNLA
FT                   PLQWTRHKRLTSGAAVIERIRERSLVTQRERTRKISILCFAALLLLTVGSWVAYIWGAV
FT                   TGHNS"
FT   CDS_pept        join(complement(558518..558706),complement(558369..558453),
FT                   complement(557993..558306),complement(557679..557897),
FT                   complement(557428..557624),complement(556632..557376))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824376"
FT                   /orf_name="Pc20g02450"
FT                   /product="Pc20g02450 protein"
FT                   /protein_id="CAP85574.1"
FT                   /db_xref="InterPro:IPR010573"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000183183B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE7"
FT                   /transl_table=1
FT                   /translation="MGSLSTTGNEDGKGLQVDHLETANMAHQEQHVETDRAPEAMGREQ
FT                   AELPKGYFYSPYFIGSYCAIGVAFACGTGGYALVAPILTDINNDLGGSGSSDINWVGIV
FT                   YSLTQAIVLMLAGRLSDLFGRRWFFVIGSVIGLVGSIVGARAGTIGQLIAGETLIGIAA
FT                   GFQCSFFWIVSEIVPMKRRFIANSGLFLWTLPTNNTAVQWRGCFYYLTGLNALSVALWF
FT                   FFYHPPSFHMLHRDKTVKQMVLEFDFIGLVLFSAGMILFLIGLNWGGSIYPWKSGQVLG
FT                   TLLSGVAILAVCIAYELKSSLKEPYLPLQLFKNVKYTSCVVWCAIEAMNFYAFGIIWPR
FT                   AVAILYPSLSPASSATMSGLVTMSFALGQMAGPFFANWLPAKPLVIVGTFIGTGLLAAC
FT                   AANPLNLDLTVGVLVTGNLVIGMADGIGLPMTTFPIKNQEALGTAGGLSGCIRLAGTSV
FT                   AVAMYNTILNNRLLQTIPAAVTPVALSAGVPESFIPQLIANLTRTNRVGGGIPGLTAGD
FT                   VPLIQSAFQLGNSQAYSTVFLSTLGFGGVALILCFLIGGVDESNGEYVAALIQHGDGSD
FT                   QQTEKV"
FT   CDS_pept        join(complement(560424..560496),complement(560196..560343),
FT                   complement(560049..560126),complement(559865..559946),
FT                   complement(559352..559801))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15947803"
FT                   /orf_name="Pc20g02460"
FT                   /product="Pc20g02460 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85575.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000183183C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE8"
FT                   /transl_table=1
FT                   /translation="MASQSAIQESLQSYKTTSTVDDFHSGGDGIGLALVKAVVEFGGHV
FT                   AVIDYREVPHLDLCEIQDLHKESRVKYFSVDITNEMLVTKAFDGILAEFGRIDGVIACA
FT                   GVCVEKPFVDHTWEEVVRLQMVNSVGLFFAVQLAVKAMLKNQPTSGDFTPKGSVILIGS
FT                   IATESGVESQGLTAYSASKGAANGLLRGLAVELAPMGIRVNMISPGHTVTDMSISQFTN
FT                   RPELAMIMRNAVPMGRMGDRRDLKGAAVYFLSDASLYTTGSNLVISGGLHAGRL"
FT   CDS_pept        560857..561303
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128705"
FT                   /orf_name="Pc20g02470"
FT                   /product="Pc20g02470 protein"
FT                   /protein_id="CAP85576.1"
FT                   /db_xref="UniParc:UPI000183183D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE9"
FT                   /transl_table=1
FT                   /translation="MGTKKFTAREVLDAFYKAEREYMQATPEQRDYASIAATLAPNVRM
FT                   EQTSALPYAGVYIGPDGMQDWTRRMADYFEVVDVQNPEIFERAGSEKIVVLSNVHFKVR
FT                   KTGKEMDFPFCQAITVDLERGVIVELRPFYWDVAEVNKSLGYAP"
FT   CDS_pept        561986..563425
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824377"
FT                   /orf_name="Pc20g02480"
FT                   /product="Pc20g02480 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85577.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000183183E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG4"
FT                   /transl_table=1
FT                   /translation="MSLAFNTDSVVPLWLNGAQRVTKTTFDVVSPVSHQALWKASAADE
FT                   GDVEDAIASAATAFETWRWTKPQERREIFLRAYELLKERRDQSMAYSTAETGVPPVMFG
FT                   VEYNGAIDICLQLAGLSAHYGTVVDPDANDTSAVVISQPYGVVLGIGPWNAPHTLGMRA
FT                   CLFPLAAGNTVILKGPEMAPATYWHFVSILHEAGLPAGCLNTIYHRPSDAAAITKQLIS
FT                   HPAIRKVNFTGSTAVGSVIAGLCGQYIKPCLLELGGKASVIVCEDANLELAAEQCALGA
FT                   FSHAGQVCMSTERIIVHDTVADRFRPILKAAIDRIFGEGQPASILINETAAAKVRGLVQ
FT                   DAVTKGANLLYGSLSDGSEGVNRLLPVVVEDVQPGMDIYYNESFGPSVSLYTFTDDEQA
FT                   LKLANDTAYGLTGAVFTEDLRRGLSLAKRLETGAVHINNMTAHDEASLPHGGVKDSGFG
FT                   RFNGPDGLREWVKTKSITWRD"
FT   CDS_pept        join(complement(565044..565180),complement(564912..564997),
FT                   complement(564673..564764),complement(564603..564624),
FT                   complement(563880..564538))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947804"
FT                   /orf_name="Pc20g02490"
FT                   /product="Pc20g02490 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85578.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000183183F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG5"
FT                   /transl_table=1
FT                   /translation="MSLPQKQLCAWVESPGPEAKIEFRDIEVPNPTAGQVLVKLEVSGV
FT                   CHSDHHSIYGNTPMTTHIAGHEGVGIVVADYLRWLHRACRKCATCEMDYTHCPHQDNSG
FT                   RNVPGTFQADADYISRIPAEVPAALAAPLLCGGITMYGALSRAELRAGDFVVIPGAGGG
FT                   LGHLGVQIATSMGFQVIAIDSGDKEDICRDSGARHFFDFRQSGASLVDDVRAAAGGIGA
FT                   HAVICITGAPSAYDSALAMLRNLGRLVCVGIPPAEYRLQLNPFEVLVRGLRVIGSTVGN
FT                   SAQMPLLMDLVLQGKVRPHVQVYTFQELRDVMDKLEHGTVAGRAVLRISD"
FT   CDS_pept        join(complement(568164..568259),complement(568007..568110),
FT                   complement(567701..567942),complement(566849..567638),
FT                   complement(566113..566630),complement(565859..566065),
FT                   complement(565592..565788))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048696" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977595"
FT                   /orf_name="Pc20g02500"
FT                   /product="Pc20g02500 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85579.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831915"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG6"
FT                   /transl_table=1
FT                   /translation="MLANPAVPATEQQPKRRRVTLACISCRARKSRCSGQRPKCSTCTE
FT                   LGLTCQYVSSGQTDQTVVVGKEHFQTIEERLHHLESLLDQGRASSKRSWSDVDTPDIDN
FT                   QPALTPNLVSTSDGPLTGSIGSDDPTDGMGHFVIAHEEHRAYFGPSSNIAFASELSRTL
FT                   KRLSRSRGEFSPGSKQTTLRDFHIARVSRPSSPMSQSATWAPNNHQQDAATSSIFYLPP
FT                   DQETSVLIDQYFGNTGLLFPYIHEDTFRESYAQLRQNSAGTRRTWLGVLNMVLAMATHT
FT                   TTLPMGKVDKRQAQSEAFYARADGLCSQHVMNGASLEIGQLLVFLSICPGHELFDAIVR
FT                   DIDRKTVQYLLLVSQYMQGTRSSIQTWATHGLAVKVALQLGLHSVEASRRFSPVEREVR
FT                   KRTWFGCIVLDRYPVKETRIGRSDCQGNSQDCSRLYSIMGNAIDLLYDGNLGSEDKILN
FT                   YELITRVLRMRHSLEEWIEQLPAHMRLIRAENCAAELGKDPTNDRFRTILTLRYHNLQV
FT                   LIHRAVLLRLCDYQDQNILALQDIAWSTEQITIESATEIINIVRFVVEAGLVQQGLLGA
FT                   WWFTLYYMFDAALILFTILLVKRFSSIKLYPPTTLDSIKEVFLSCIEPLRRLDEGNRTV
FT                   DKCCRCLQALSEVWNSIEINNEESLAQDIPLLTQPRDYNYHHDNSVVGQEFADQSLSFL
FT                   DFDLMANELFDVTDGLVPGWGVQ"
FT   CDS_pept        join(complement(569891..570179),complement(569404..569838),
FT                   complement(569035..569339))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173721" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824378"
FT                   /orf_name="Pc20g02510"
FT                   /product="Pc20g02510 protein"
FT                   /protein_id="CAP85580.1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI0001831916"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG7"
FT                   /transl_table=1
FT                   /translation="MATETETVSKVEASKNVEASDQEIDTSDGLALALEKLETKPLWTQ
FT                   MTKLNPPLLNPSCVPHVWRYDQIRPSLLKAGELVNESQAERRVLMLVNPARDAPYTTDT
FT                   LYAGLQLVMPNETAQAHRHTAFAMRFIIEGQGGFTAVHGQRISMQRGDVILTPRWNWHD
FT                   HGKDGTGPMIWLDGLDLPNFRHFPVHFVEHYQHARYPADDVDSNTSPIVFPWVKMKQAL
FT                   DDTPGDWASKDYLKSDGRPVSKVLGGSAERLRAGQSSPEIRETASSVYHVVSGRGYSTI
FT                   GDSRITWGPGDTFCIPSWHRYEHFADTEEDVYLYRFHDKPMLDALGFYRVEGVDVESLV
FT                   SD"
FT   CDS_pept        join(570487..570734,570769..570952,571026..571395,
FT                   571456..571565)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671681"
FT                   /orf_name="Pc20g02520"
FT                   /product="Pc20g02520 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP85581.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI0001831917"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG8"
FT                   /transl_table=1
FT                   /translation="MRVAWQRFIRFQAADGRILQGEPILSKPDLDLGYVTEKDRLQARV
FT                   IVGDDILDETGVTRVSDEIVTVRRILSPLAPSDVPTIRGKSTNLQELSELITAVQQAKR
FT                   TPPPFPFIFFKPQTTILDHGDNVVIPKIAQDDQADYEGELTIVIGKDAKDVSQENALDY
FT                   VAAYTVGNDISSRKLQRDPEYAGRIPQWGFSKGFDTYAPIGPCLLASSLVDDPKNLHLT
FT                   TIVDGDVRQDESVDDLLFDCRYLISYLSQGTTLQKGSIIMTGTPGGVGGDMKPPRWLQP
FT                   GTQMEVRISKIGTLRNGVVFAE"
FT   CDS_pept        join(complement(574130..574301),complement(572221..574056),
FT                   complement(571971..572158))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194625" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947805"
FT                   /orf_name="Pc20g02530"
FT                   /product="Pc20g02530 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP85582.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831918"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG9"
FT                   /transl_table=1
FT                   /translation="MEERTGSDPVQSQPTASRWRRVFGGKAKEDPESGEGQTYRSKSTL
FT                   GILSDKETDEVPGTVLLLSSNRNEPLGMRHQPHRTSTSSITSSYRPSRSNSRTRSAVPT
FT                   QKKTADGQFVLDPQPDDSVNDPLNWPVWQRDAALVSLGFYCLMGGGMTPILAAGFNDVA
FT                   AAYDVSTQQVAFTTGFYMLGLGLGSVVMSPTAILYGKRPVYLLGATLFVVSAVWCAASP
FT                   NYPSLVVARIFQGLAVSPVECLPSATIAEIYFLHERAYRVGIYTLLLLGGKNLIPLVSA
FT                   AIIESLSWRWVFWIVAMIVGMCLVLLFFFVPETFWDRTPRPRVPKQKRPRGPGRSVSDI
FT                   VSHGFRGRRPYVQPQDESTEQDLHDPALAPKKSKHAHVGFADDHPEEGGHAIEPEKSDL
FT                   VPEAGNATNGEQSTNNPPTPSNEKGDDFLQPLPQALVPGAHPDDLETARRAAISPARTE
FT                   SLEPASTPLTATLQYTNRLRERPKIPYSQLLKVWNGRIAQDSWVRVAARPFVLFAYPAV
FT                   LWSTVVYSLSVGWLIVLSESVAHIFQSKDHYNFTSLQTGLIYISPFVGGLLGTAVAGKV
FT                   SDVIARFMTRRNGGVYEPEFRLVMAIPIALSTVIGLMAFGWSAEIGDSWIVPTVFFGLI
FT                   SFGCCLGSTTAITFCVDSYRQYAGEALVTLNFSKNILHGLIFSLFIVDWLDTNGSRTVF
FT                   LSIGGIQLFFMLMSIPMYLYGKRARMWTVRKRLMERL"
FT   CDS_pept        join(574868..574963,575051..575173,575261..575397,
FT                   575503..575712,575880..575925)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128706"
FT                   /orf_name="Pc20g02540"
FT                   /product="Putative uncharacterized protein Pc20g02540 "
FT                   /protein_id="CAP85583.1"
FT                   /db_xref="UniParc:UPI0001831919"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH0"
FT                   /transl_table=1
FT                   /translation="MWQWGEAVRPFKVLAEYLDLGVVAMVKASSLEVDESDDASPISRF
FT                   RAMLSSPQYVVNNAPHGSTFRVERSISKYPTMKVTHTRIFPFAECARPFLVYAKPFKSG
FT                   ACRESFTSRGVSIDVCELRGNGVPALVSSWRWILMSPFVSARAGMASWIRLWLRIYNLI
FT                   YRVWKRSIQQASGAHACYRFWGRHLMWALKGSPFLGGSKT"
FT   CDS_pept        join(complement(576444..576581),complement(576196..576420))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128707"
FT                   /orf_name="Pc20g02550"
FT                   /product="Putative uncharacterized protein Pc20g02550 "
FT                   /protein_id="CAP85584.1"
FT                   /db_xref="UniParc:UPI000183191A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH1"
FT                   /transl_table=1
FT                   /translation="MRMNFSGHSVILYFERLPKGWMGLSSDIGAHKITQQRALSAAHVE
FT                   QAISYHGDEEGRKMRYGPMERRLCMKPPRMANATNWANAQCAQRKTHTLHASHVCMRVN
FT                   NTEVKWRCGGRLKERK"
FT   CDS_pept        join(578349..578957,579028..579970,580029..580096)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224541" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947806"
FT                   /orf_name="Pc20g02560"
FT                   /product="Pc20g02560 protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85585.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniParc:UPI000183191B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH2"
FT                   /transl_table=1
FT                   /translation="MKINHSSFLLFLLPAISAVLADTTYNDNIDSRVSRETAGNNARLV
FT                   DSDIVASNVAKGAPDVPVDGKDGRPHAGPWVETNADRDRKGVKGTDDIDSVSTKYDTKI
FT                   PSSEHLSTEEGKMIPHSNGGVMDDPHRAGPKEGTRGTEGGVSEKGKEGKLTSEKAPGGP
FT                   KEAPPLPHSETKKLGSDSDDTTTGTGSRSAESQGSLGMLGKPADLPEKPHDIPYPKPPA
FT                   MVKDDPLGLGHDSVASGSPSSSSSSSLTHDYDYDHDSGIPDAGSSLHSLVFSFTMILVS
FT                   EIGDKTFLVAALMAMRHPRLVVFSAAFSALILMTVLSAVLGHAVPTLIPKTFTKFMAAI
FT                   LFLIFGVKMLKEGREMSPDEGVGEEMREVEAELEEKEHEQLRMDRRRSSVTPHNLEAGR
FT                   AGGRPKTRGSGNRLPSPPESLSSSSSRGSSPQPRQRLDSIFSGLSNLFSLLLSPAWVQT
FT                   FVMTFLGEWGDRSQIATIAMAAGQDYWWVTIGASAGHGICTAAAVIGGRAIAGRVSMRV
FT                   VTLGGAVAFLVFGVIYFIEAIF"
FT   sig_peptide     578349..578411
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH2 "
FT   mat_peptide     join(578412..578957,579028..579970,580029..580093)
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH2 "
FT   CDS_pept        join(580904..581000,581196..582564,582617..583673)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947807"
FT                   /orf_name="Pc20g02570"
FT                   /product="Pc20g02570 protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="CAP85586.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI000183191C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH3"
FT                   /transl_table=1
FT                   /translation="MARLMGSRMMRSRSREAANPGFMPNKGSLERNWLTGVTEEPSTPS
FT                   PGFIAPRHVVPESPENHEGHTNVSGTTLGHNDVEPVGSQVADKIATHLPFVQQQATLVM
FT                   SLLVRPELNPDSLAAESKRLLDSNHPNRKRLRRSVEGLTDELEDSPLSRDGRSFLDISQ
FT                   ARRLLSPAQLDASIAYIYMTNCALLTLNMFLPSMGIESQSEVMQQLDSQFPGCVMSNLV
FT                   ESSMTRDIGASNTTETTFNLALGIRTQFFIMELERRQHEQDFNPLSILRQIFAMDLAPS
FT                   EDDSPASFRGFNLPGVLQDEDGHLPEYLPERFLIAISDRFNELHEEISEWDSLDIDGLR
FT                   KAYRWRSFERDLARWVYARDREIKDDIRRLSERLRISPSPRRLTSVPAGTPNRRPGSTV
FT                   PPSGDISRPRPLPQQTHSPQKERLVNAPGANRAPQAETVVQAEQSAQAGNIPGDIASRS
FT                   GITSQTVPEQSVSNQVAQTVSKDPGRRKSKSNYRDPASLAALMRRQATSRPQPASNVAS
FT                   QAQNISTGTNIVTQADPSANRGVDSVEIQQSPDMTYRDIGDESTYVNNDEDLDLGQGPE
FT                   PDVMTSTSPPTSSRIGRVSHNPNPRFFDSPRDGNTQRSVPAARRFLDKQSNARVVSPIS
FT                   QYDAPSPGNQFTVLGKRNRNADPPDDDLSDESDVEFEQNNQDLDPRRRVEKPQQKLPAA
FT                   KRQRPEDNAGSVGERLPSSINQSFRHNQPISTQGAQRVQRAESDDITDDETAVEQYEAP
FT                   TRTQGPWAASNSQAALVNRRVRGATHRWTEEEDERLIYLLGIYGTSYSAIKKQDNACPP
FT                   SEGGPMLERRSQVNCKDRARNLKKKYLR"
FT   CDS_pept        join(584958..585211,585247..585420,585472..585535,
FT                   585699..586937)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671682"
FT                   /orf_name="Pc20g02580"
FT                   /product="Pc20g02580 protein"
FT                   /protein_id="CAP85587.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000183191D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH4"
FT                   /transl_table=1
FT                   /translation="MGNGKGKNKGKGRGKKRSRSLKENKVAAKVEIKPEDKIEDKIEIK
FT                   GKHHCLRKRPTHAPTSRCLRLGHVVQCPIHPNSFPRRLSDATGAQGQKEVEQQLISFFW
FT                   SFKVDRACQRTLLDICLLLLWLCYVGLYILASYYSTEERFIFLSIPDFGEKLHIEQYKG
FT                   YRRHSVCAHNNHPMWKNTKPRHLAFRAHHRHVITCLQFDADKIIVGSDNTHINVYDTKT
FT                   GALRAKLEGHEGGVWALEYHDNTLVSASTDRTIRVWDIAKAKCTHVFQGHTSTVRCMKI
FT                   LLPVQIDQHERPQIISGSRDSTMRIWKLPQPGDSEYFPPTESVEECPYLIRVLTGHQHS
FT                   VRAIAAYGDTVVSGSYDCTVRVWKISTGESLHCLQGHTFKVYNVCLDHERNRCISGSMD
FT                   STVKIWSLDTGALLYNLEGHSSLVGLLDLKEDLLVSASADSTLRVWNPANGHCQSTLGS
FT                   HTGAITCFQHDGQKIISGSDASLKMWDTRTGVFERDLLTDLSGTWQVQFDTQHCVAAAQ
FT                   RGDVSYIEVSTHPTDIPSIYNLLFMKILDFGASPETIPSGQFGKRVLVDELGNEIESPK
FT                   "
FT   CDS_pept        588003..591038
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128708"
FT                   /orf_name="Pc20g02590"
FT                   /product="Pc20g02590 protein"
FT                   /function="L-aminoadipate-semialdehyde dehydrogenase
FT                   activity"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /protein_id="CAP85588.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0004043"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000183191E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH5"
FT                   /transl_table=1
FT                   /translation="MEQLLCNRANEASNALAVIDGDHRFTYRDLLAKADILAADLLKKG
FT                   LGTEEPVGIVVGPGWQQIIARVAVLRAGGTSVPIDPSAPDIQLHAMLGDLSTRFVMTTN
FT                   NLAGKVSQFNILPIETVLDPEYQTEKHGEINAMSGKSEGHRSHILHTSGSTGKPKAVQI
FT                   SSKAVLHLAASLPVDIGEGDKVGQLNNPGFDLSLFEVWVTLLSGGTVVHIPKSIIKDPV
FT                   SFAAFLKDTGLTALILPCALFTAVSASTPSAFQSVRHVVSAGESPSPQAMQKVLSSDGP
FT                   PENLWNGYGPTETTCLSTLQRVTLEEAECGPISAGVPFGDTVLHLLDEAQKPIVDDEIP
FT                   GEICIGGPGLSAGYLNHTEANAEKFIRIEVADSQDPRRVKITRLYRTGDIGMWKGLPKR
FT                   LQYIGRVDLQVKHQGFRVELEAIEQTIAANDSIRAVACLHQKAGDGPGLDRLIAVVAPA
FT                   NDMPLDPQKIIEWTQNRHPYYMVPNQVRVVSEIPLNSRGKVDRDALHKEIKESRPLKST
FT                   QDNAKDESSLAKVTKILEENLGLSNIGPDDNIISLGLSSLQVARFLGLIKQKIGKLISI
FT                   KDLYINPSIRSLVHHLHQADETNYGPSEVLQFEADAHLADDIELIPDWTSEGRVFLTGA
FT                   TGFIGVNLLYRWLSRPSMKEVEIACLARGNENYSPMDRIKNALKKYDLWSEDISQEMKR
FT                   VIVLDGDMTQERLGLPHSDYQWLINWAPAVFHAAAKVNWCDSYNGHFAQNVQGTKNVLR
FT                   VAAEGRRKTMHYISSIDVWAVTGLILGTDVVSEDGPLKVHLASLPFDTGYAQSQWVADE
FT                   MVQRVRDKGLPVTIYRPGFVVGDSKTGAGNPDDFFGRLIAGCIQLGYWPHMPHQNQEYV
FT                   TVDYVCDSIIRIASDNRNIGHAYTLSSPNPGQITNMERLCVLINQAGFSVQEIPYAEWL
FT                   EKMQAWDGFESSPCLPLMPLLAEPILRGDTRLQTSKYSPRYDCANTLKAIGACDDIRFV
FT                   QLTPDLVKKYIDFWARKGFYNF"
FT   CDS_pept        join(complement(591837..591941),complement(591529..591768))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824379"
FT                   /orf_name="Pc20g02600"
FT                   /product="Putative uncharacterized protein Pc20g02600 "
FT                   /protein_id="CAP85589.1"
FT                   /db_xref="UniParc:UPI000183191F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH6"
FT                   /transl_table=1
FT                   /translation="MPRLGLRGFAVVLAVIIMSLLGALFGNTGWVYYIVVGIPGIWSLA
FT                   NLALIVFKRPVHPGAHIALDFIFTIVQLFFGIISLLAEQVSSLYGSSLHSSHSSWSMAV
FT                   AAFALMVING"
FT   CDS_pept        join(593413..593908,593965..595539,595632..595708)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183624" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947808"
FT                   /orf_name="Pc20g02610"
FT                   /product="Pc20g02610 protein"
FT                   /protein_id="CAP85590.1"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniParc:UPI0001831920"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH7"
FT                   /transl_table=1
FT                   /translation="MGNPEHDFSSKHTEAVSNTEAVSNHPPYSSITESIDEPPTYGQSN
FT                   ASYRVSHDGFPRSVVVVVDECITHLKLLSAIAKLRNFIKGTDKLFGIHDAEIRNFSNNQ
FT                   QAQAAARIREKRWAVYVARAVDRFTIWWQSYLPSLKTSHISTLNTASEANIAWSANMMP
FT                   PLDVIMVWHAFMLNPRAFLEDCLRQSKMSVWATGMPWDIINASIDDKTLVFYPDRDSEA
FT                   RINFEAITGHSWENIHDSPAKSLPCIGCKQEIIAPWTEGSIGCDTDVAFAHCTGYADKS
FT                   LRVSCPACKFNTTHDTLRVQKFRSDVQKLLKDDIPMPGTLLSQNGTPADDGNGDNVSFP
FT                   NRLIKEGIRSELLQLTDLTENESTTIETIRDHLEAYLKSRSVMRRVNKTILASGNSSMP
FT                   ERISLRNMLSRYWDNSSPFAIDLVGAVIRQGTFVDKMDNIGWVRSPNPRSTMGHFIGKY
FT                   GVFFQIMVKNKGHAVVPTLDVDLIWHTHQLSPIRYYIFSTTQMEGIFINHDDKIDETKL
FT                   NDAFAWTSRQYQKLTGGKIYSECTCWYCEAVRESNNQGLGRLISPSTLHAKTNAALLHN
FT                   SADNATDGKSKEPHISSHNAVRILAQADPKAMQTKTAQLESCWEKAQRRSHNRSRSRGG
FT                   GSAHGDPPRKTVYGPYARDPDIHREIYPCNPACVNITAGVVGNCMSGTQGVGLAQASQQ
FT                   MCKYLWTEPSVLQVSRELDNV"
FT   CDS_pept        join(complement(596655..596946),complement(596276..596584),
FT                   complement(596131..596174))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947809"
FT                   /orf_name="Pc20g02620"
FT                   /product="Pc20g02620 protein"
FT                   /protein_id="CAP85591.1"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="UniParc:UPI0001831921"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH8"
FT                   /transl_table=1
FT                   /translation="MHTNYFFSALALALPVYSLSATARMGCYSEVDSFKNQGPYTYQSP
FT                   GYCQTECAENGFKVAALSRGNMCYCGNKMPSDSAKVADDKCDLSCSGWPAESCGGQDTF
FT                   NIIQATENLQASASENASTTIAPTAATAAGGIIVAPSTASSQTGIVTAASTASSKGGNV
FT                   VSKAAGSGSVATASPTPTYNAAGTVRAGSSLLGAVVAVILYPSLVRQQDVS"
FT   mat_peptide     join(complement(596655..596877),complement(596276..596584),
FT                   complement(596134..596174))
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH8 "
FT   sig_peptide     complement(596878..596946)
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH8 "
FT   CDS_pept        join(599867..600228,600297..601633,601690..601733)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194592" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977596"
FT                   /orf_name="Pc20g02630"
FT                   /product="Pc20g02630 protein"
FT                   /function="metallopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP85592.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017141"
FT                   /db_xref="UniParc:UPI00018319E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH9"
FT                   /transl_table=1
FT                   /translation="MMKTLALLTLAVVPSLALNIPTQQRLFPESKLSGNHYNPLSTPST
FT                   RETCPQPRKVNTPNDGLHSSQTFLSDDAFRARQAKRLSRAVQIPTTVGDYMKDPYDEAF
FT                   EPIVEFQSLLEEMFPLVHDHANVEHINRLGLVFTFEGADTSLKPLLFMAHQDVVPIDDA
FT                   SDWTHPPFAGVFDGEWIWGRGSSDCKNVLIGLMSVVEDLLSQDWQPQRTVLFAFGFDEE
FT                   SHGFLGAGAISAALEEKYGKDSFEFILDEGGMGLQSLGDESNPNGEILYALPAVGEKGS
FT                   LDLIIDIAVPGGHSSIPPAHTGIGIMAEILYELERKELFPAWLDTTHPAYGMLECQAQY
FT                   SPEHVETWLSDKLAANDPAALGEAVASSRGPAVRYTVQTSQAADLIHGGVKTNALPEKI
FT                   SAVVNYRVALHQTPDELRERAIRLIRPIAESHNLTLRVDFPGVAESTEGDVSDRTLTLS
FT                   PLSVPLSPAPISPTNPLTSKVWAHFAGVARSVFESHSNPLSKSESGSKPTVVVTGDVMT
FT                   GNTDTRFYWSLSDNIYRWSPSRAGGSLNIHTVDERIRLDVHLEGMMLYYDLIRSFDAWD
FT                   GKSE"
FT   sig_peptide     599867..599917
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH9 "
FT   mat_peptide     join(599918..600228,600297..601633,601690..601730)
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH9 "
FT   CDS_pept        join(complement(604461..604654),complement(604104..604396),
FT                   complement(603031..604054),complement(602779..602981),
FT                   complement(602585..602728),complement(602396..602531),
FT                   complement(602275..602344))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194581" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824380"
FT                   /orf_name="Pc20g02640"
FT                   /product="Pc20g02640 protein"
FT                   /protein_id="CAP85593.1"
FT                   /db_xref="InterPro:IPR014870"
FT                   /db_xref="UniParc:UPI00018319E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEI0"
FT                   /transl_table=1
FT                   /translation="MQLYRLGLLVASFVSSIGAQSTFSPARPPAIPLAVRSPYLSTWLN
FT                   VGKDGGNGGYLAGQWPVFWENQVNGWTGMIRVDGNTYTWMGLPGSKTVNQTAFEYTSTK
FT                   SIFTMNVENKLEMNITFLSPVTPTDLKRQSLVFSYLNVEVSSLDGQKHDVQVYTDISAE
FT                   WVSGDRNAIAEWEYGTTDGVAYHKVHRQTQLAFTEKSQQGEWGNWYWATDDSKDMTHQS
FT                   GADTDVRGQFATTGKLSNGDDTNFRAISSVWPVFGFSYDLGSVDSSPVSTLFSLGLTQD
FT                   EAIQYEGASQYAPVPSLWKSYFATELAALSFFHKDYTESSNLASSLDRRVAQDSIATAG
FT                   QDYLVVTSLSVRQAFGATQLCGTQDKMYMFLKEISSNGNMNTVDVIFPAYPIFLYTNPE
FT                   LLKLVLTPLLENQEAGKYPNDYSIHDLGSSYPNATGHSDGSDEKMPLEECGNMLIMSLA
FT                   YVQKSGDSDFLNDHYSLLKQWTSYLVEDSLYPANQISTDDFAGPLANQTNLALKGMIGI
FT                   QAMAVIANMTGHTADAADYSRIAKDYITQWQDLAIAKGANPPRTTLSYGDTASHGLLYN
FT                   LFADAQLGLNLVPQSVYQMQSDFYPTVANKYGVPLDTRHTYTKGDWECFAAAVSSVDTR
FT                   DMFINDLATWINETPTNRALTDLYDTISGDYPQNTFVARPVMGGCFAPILVR"
FT   mat_peptide     join(complement(604461..604597),complement(604104..604396),
FT                   complement(603031..604054),complement(602779..602981),
FT                   complement(602585..602728),complement(602396..602531),
FT                   complement(602278..602344))
FT                   /db_xref="UniProtKB/TrEMBL:B6HEI0 "
FT   sig_peptide     complement(604598..604654)
FT                   /db_xref="UniProtKB/TrEMBL:B6HEI0 "
FT   CDS_pept        join(604763..604811,604892..604964,605095..605275)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948837"
FT                   /orf_name="Pc20g02650"
FT                   /product="Putative uncharacterized protein Pc20g02650 "
FT                   /protein_id="CAP85594.1"
FT                   /db_xref="UniParc:UPI00018319E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEI1"
FT                   /transl_table=1
FT                   /translation="MPSTLTGRLKKGIKGIGPSETRMPECALYGGISKRLGILEGKGDR
FT                   GVVTVKKVVYFPRMAQMQSQIPKTRSGSFRKKRHAFRLHGRQAAVYADRRNEWRQ"
FT   CDS_pept        join(complement(607278..608271),complement(607116..607208),
FT                   complement(606688..607034))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128979"
FT                   /orf_name="Pc20g02660"
FT                   /product="Putative uncharacterized protein Pc20g02660 "
FT                   /protein_id="CAP85595.1"
FT                   /db_xref="UniParc:UPI00018319E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES1"
FT                   /transl_table=1
FT                   /translation="MPFEPFKRERDGAKAFLERMRNGVSNNEILAELLDKESNIFTDHV
FT                   YELPKAQMTKARLPDVAKYKLQLHASFNKPDLNADYSGHSSVYLVGQPNRWARRLSRTP
FT                   KPCHWSIYSEGHFYHLKLEDGAQGSSIVLRDEPQREWKALSGPFIAYHIGVTDYYPDEI
FT                   SLLAKWVITQMNHDTLSTAAYEQFVFGLAIRILRGPSNTTAFIGNFWQIMEHDIGCRRQ
FT                   ALAPNGFLTGIQLASPEEDISTWLKRWYLIYRIETDARGLDLCWRKGTKGQISWKAHEF
FT                   HPFIRPLAVGPPAIANVLAKVGQRIPLLSKAVPPKHRKKMPMMAVYRRKKGAPLPRDLM
FT                   LKHYYASLFSIHIRPGCNMSDKDFWFQVNDYLNSGCVEHITFNRGFSYKFIFGPEIIGS
FT                   VRFVRYREPPAEEVLHSSSSTIVEKECLESESTIDAEQSTGECIYPPDTLATNLFEHKG
FT                   VPCQVLIDMAETFKSPVEI"
FT   CDS_pept        join(complement(610143..612422),complement(609746..610036))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194570" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671921"
FT                   /orf_name="Pc20g02670"
FT                   /product="Pc20g02670 protein"
FT                   /function="calcium ion binding"
FT                   /function="calcium-dependent phospholipid binding "
FT                   /protein_id="CAP85596.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005544"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="UniParc:UPI00018319EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES2"
FT                   /transl_table=1
FT                   /translation="MSLQVNDPRSRTRSKSPGRSRSRSRSRDSRVPSPSPSPSHRSRSP
FT                   AVEVPRTKGYNPDEEAEIERQYKLISERRRETNDEPPVIPRAPRSSRYDVDRSDSDSES
FT                   RRRDVESARRRRDDRYEHSDEERGSAAASSRSHRRRPSPDRGSRVNHHDSDSDDDLAYG
FT                   DAPGTHPSYARPNRYSYAQPTQFASAAPGYPAAPGYPAAPGYPAAPIDWASVPECERPG
FT                   FVPPSSQPAAPATMPGAFPVASTYPASSGAVPAPVNPSLQYTGLPAQYATSAGYAPSHY
FT                   RTASASDAGYAPPAAGYANPGVYQYAQIDPNVKYSSKPVPVPTTAPASKPIYPAATHEQ
FT                   FSRPMPQQLQQQPPDQSYRYKHEPQRQEPQKQEPQFVEIAPGSRSSARPHSHSPSSSSL
FT                   AVGGASAAHSAHPPASPLLEPYHGTYQSMSPMPSPIVIPSIRDDDISDLEPLDGGTSAS
FT                   ESGRRSKHSRSHSSVGEKESRSRSSRDKERDNGKEDKRITRPAASHNRHDSSSSILSSD
FT                   ARVLISPTTGRKRVSFYDAGPDAAAMHSALNHARNIDNKTIIQVLPRLTSDEILLLRQE
FT                   YKTRVRMQGKGINLAKHLRLKLGSSSFGKVCYATALGRWESEAYWANCYYQAGTSRREL
FT                   LIESLMGRSNAAIREIKNSFRDTRYDNSLERCMRAELRADKFRVAILLALEGQRQDERE
FT                   PLDRRLVRHDVQDLHHAIVREGGETAMIHIIVSRSDSHLREVLRAYEDNYGHNFTRAMI
FT                   SKSRNLVGETLAHILNGAINRPMRDALLLHQALRESRTGRERSELLISRLVRLHWEPRH
FT                   LDLVKNEYRRRYHERLEEAIAEEILSLNGGQNWGEFCIELARNA"
FT   CDS_pept        join(complement(614326..614759),complement(613111..614260))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194559" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948838"
FT                   /orf_name="Pc20g02680"
FT                   /product="Pc20g02680 protein"
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /protein_id="CAP85597.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="UniParc:UPI00018319EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES3"
FT                   /transl_table=1
FT                   /translation="MATRLGPETDVNRRTSLGFLRRSKSTEPLGDQKSRKKMSKSQEEE
FT                   MRRQRESYAPKIPPRLPDLSPAPQLETFGGEERDKFDPIPIRPQSGLPASPSMGSVNNV
FT                   DPYARTESMTHRGRYSYASSAVSTVNSPRRVRRRKDPTSYNVLVIGARNSGKTSFLNFL
FT                   RSALTMPAHKHPSRTPEEVEELERQTSAWEGFTSQYLETEFDGERVGLTLWDSVGLERN
FT                   IADLQLRGVTGFLESKFEETLAEEMKVIRSPGARDTHIHCTFLLLDPMRLDENIAMAER
FT                   AANGTSKPTDAPVVGILDQNLDIQVLRTVLGKTTVVPVISKADTITSAHMSYLRKAVWN
FT                   SLKQANIDPLEILTLEDQEEEYSSESADEEEILVLETKPESTETGDANEANEAKESENA
FT                   TDNVPGSPSQLSQGTRRSNASQAANQHVPFSILSPDPHSLAAGDKPVGRRFPWGFADPY
FT                   DAEHCDFVRLKDSVFSDWRSELREASRVVWYERWRTNRLNRNGQPTPASPAQKQNYGGR
FT                   QGPHDGRRTR"
FT   CDS_pept        join(616139..616232,616335..616523,616583..616719,
FT                   616776..616904)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948839"
FT                   /orf_name="Pc20g02690"
FT                   /product="Putative uncharacterized protein Pc20g02690 "
FT                   /protein_id="CAP85598.1"
FT                   /db_xref="UniParc:UPI00018319EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES4"
FT                   /transl_table=1
FT                   /translation="MGVGHTGLACHANHYNIQHTEYSYFPGTSCQGKGLAFPTRNDRVE
FT                   QKWGGFPSRAGTFFFKENSQRDASVRVKGGIKVGTKLPFEQDSFSFDPQRAHITRLQVE
FT                   GQAFTLNSLSTLITVYQQNIPGGFGRPPDPQPLLLSTTKYSTDIYRLSVTLTLRRGFEA
FT                   YYKIEASEIEAYNLMEIPL"
FT   CDS_pept        join(complement(618476..618587),complement(618091..618421),
FT                   complement(617986..618042),complement(617774..617935),
FT                   complement(617373..617721))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194548" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948840"
FT                   /orf_name="Pc20g02700"
FT                   /product="Pc20g02700 protein"
FT                   /protein_id="CAP85599.1"
FT                   /db_xref="InterPro:IPR009291"
FT                   /db_xref="UniParc:UPI00018319ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES5"
FT                   /transl_table=1
FT                   /translation="MRLSISLALVGLSTTQLVCASLTDRAASDLPPYVLEYAPLVWLHS
FT                   QETYMPSDIQQQLDHTRPHVNWTALEGVESPLTLNNLDTLNSMGNTSVYLTSLEGIEAD
FT                   PQPAWFQGIRPDSQGRTENGTASIIVIADRGNGTVDAFYFYFYAFNKGGTVLGLEFGDH
FT                   IGDWEHNMIRFVDGSPDAIWYSQHASGQAFTYAAVEKKDKRPYVYSAKGTHANYAIEGQ
FT                   HDHTIPGFNLPTGFLLDYTDRGVLWDPVLNGYTYTYDETAGFQAVNSEDPVAWLDFNGR
FT                   WGDDQPPNEPSVFGEAKNVAGPNGPKFKGLDRELVCPSKPCIVLPFRTFSVDTTS"
FT   mat_peptide     join(complement(618476..618527),complement(618091..618421),
FT                   complement(617986..618042),complement(617774..617935),
FT                   complement(617376..617721))
FT                   /db_xref="UniProtKB/TrEMBL:B6HES5 "
FT   sig_peptide     complement(618528..618587)
FT                   /db_xref="UniProtKB/TrEMBL:B6HES5 "
FT   CDS_pept        join(complement(620634..620704),complement(620451..620583),
FT                   complement(620333..620390),complement(619968..620227))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194537" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128980"
FT                   /orf_name="Pc20g02710"
FT                   /product="Pc20g02710 protein"
FT                   /protein_id="CAP85600.1"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="UniParc:UPI00018319EE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES6"
FT                   /transl_table=1
FT                   /translation="MTDAYAFSYPSPLEGYENLEPLTDERTEDGKSLKNPQHGVLSKAY
FT                   TEFPDPLSKGREGGFDVHIYHFQNNPDQAAYARALWERIRREFPELRIYTFFDRPVGPH
FT                   PVAMFEVNLFTPAQFGAFVPWLVINRGPLSALIHPNTVESEDERNHTQRATWLGDRIPL
FT                   DLSIFRPRKN"
FT   CDS_pept        join(complement(622602..622699),complement(621336..622542))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217207" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948841"
FT                   /orf_name="Pc20g02720"
FT                   /product="Pc20g02720 protein"
FT                   /protein_id="CAP85601.1"
FT                   /db_xref="InterPro:IPR004882"
FT                   /db_xref="UniParc:UPI00018319EF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES7"
FT                   /transl_table=1
FT                   /translation="MDDDYVAKVLAKEAKESSIKYASQGMSAFMPSRPTSNAPKPNTRF
FT                   LRNLIKVTDNHNTALKLKEEREARERMRQLKDKASGALGPTSPDHPSKRSDDRSEVRGS
FT                   RDHRRGDREDRNRSHRKRTRSRSPSAERDRSRRHRRRNEEYDGIRERDKDRDGHRREHR
FT                   DHGSSRKGRRDRDKEHTRRRRERSYSRSPSYSPHRDPSTDRHRHRRHKRQSGRSARSVS
FT                   RSRSPESYRSRRSKREDASPHGSRRSHLETSTQHKRVSPLSTITARQSEMGDESDPLED
FT                   LVGPLPPRQDEAPIRSRGRGAYKHNMSNIDAHFAPGYDPATDVHLDEDKLHSIGQESSR
FT                   RPVAGLMTKDDDWDMAMEALRDRERWRSKGEERLRTAGIDEAVIDKWKNNTAFAGMDGE
FT                   GKPEDVQWSKKGEGREWDRGKFVDDDGHIDIRASW"
FT   CDS_pept        join(623023..623241,623313..623532,623596..624032)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948842"
FT                   /orf_name="Pc20g02730"
FT                   /product="Pc20g02730 protein"
FT                   /protein_id="CAP85602.1"
FT                   /db_xref="UniParc:UPI00018319F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES8"
FT                   /transl_table=1
FT                   /translation="MTDSSPEALAALQQLEQNGKLKDRLAIIRISDPISTEVGGSYPSP
FT                   SKRSSDASLSNFDDPTPASLEADLSHYKELFSKLRFSYLEQVTKEKFLRAIVGDPPVIV
FT                   GHNENMELETQLADVKAELKARKEDARIMIEEMEQMGRDLASRYKNVELQTTQLSTLPA
FT                   SIENLESTIAELRAKQIATMDPSDPNNSSSQNLPLPATLALLAEREAELAALNRQLAAV
FT                   HSALPRKTREAEAVERERSVLERRKSDAIAQAREAQRKKQQGESDGLEEIGRWYRGAEE
FT                   TLKELVGTQT"
FT   CDS_pept        join(complement(625256..625263),complement(625161..625198),
FT                   complement(625086..625104),complement(624910..625008),
FT                   complement(624401..624809))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194525" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977846"
FT                   /orf_name="Pc20g02740"
FT                   /product="Pc20g02740 protein"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAP85603.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniParc:UPI00018319F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES9"
FT                   /transl_table=1
FT                   /translation="MAPRVSSKTYKVPRRPFESARLDAELKTVGEFGLRNKREVWRVQL
FT                   TLSKIRRAARELLTLDEKDPKRLFEGNALIRRLVRIGVLDEGRMKLDYVLALKADDFLE
FT                   RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFMVRLDSQKHIDFSLTSPFG
FT                   GGRPGRVRRKKAAAAAGGEDAEEEEEE"
FT   CDS_pept        join(626863..626898,627017..627084,627153..627200,
FT                   627316..627646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194513" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977847"
FT                   /orf_name="Pc20g02750"
FT                   /product="Pc20g02750 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85604.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="UniParc:UPI00018319F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET0"
FT                   /transl_table=1
FT                   /translation="MPHSYGLRAGTRYAFSRGFKEHGMIRLSTYMKTYRVGDIVDLKVN
FT                   GAVQKGMPHKVYHGKTGVVYNVTKSAVGVILYKKVDNRYLEKRISVRIEHVQHSRSRED
FT                   FIKRVKENAIKKREAKEKGVHVHLKRQAVGPREAHFVKQAGNKPETVVPIAYDTHI"
FT   CDS_pept        join(628481..628665,628716..629669,629732..629771)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948843"
FT                   /orf_name="Pc20g02760"
FT                   /product="Pc20g02760 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP85605.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00018319F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET1"
FT                   /transl_table=1
FT                   /translation="MTFSTTAAPSSAPAQLGSTPPSVNKDLIPQSREMGDVIPNRTPPA
FT                   SQEKPEAKPFAHFVAGGLGGMTAATLTSPLDVLKTRLQSDFYQAQLQALRAAKPAPAPT
FT                   SNALVSVTRTAGMHFSETFQILRSIHVHEGWRALFKGLGPNLIGVVPARAINFYVYGNG
FT                   KRILSDYFDYRTAEQTPMGIHLAAAAIAGIATGTATNPIWLVKTRLQLDKSNAEIGKSR
FT                   QYRNSFDCIKQTVRHEGIRGLYRGLSASYLGVTESSLQWVMYEQMKMYLARRDALKQAD
FT                   PAYDYTSWDSAELWGGRITAAGLAKLVAAAITYPHEVVRTRLRQAPTVSLGNGKVEMKY
FT                   TGLVQCFKTVWKEEGMVAMYGGLTPHLLRVVPSAAIMFGMYEFILRMFGTTS"
FT   CDS_pept        join(complement(634203..634250),complement(633968..634138),
FT                   complement(633751..633900))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824629"
FT                   /orf_name="Pc20g02770"
FT                   /product="Pc20g02770 protein"
FT                   /protein_id="CAP85606.1"
FT                   /db_xref="UniParc:UPI00018319F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET2"
FT                   /transl_table=1
FT                   /translation="MKWQSTLFILGALSTQALGAKIMCNVDHDYADKGAIESGISYIRG
FT                   LSGQPTAEANKCNRVSCSWGSGIYLCADDGKDHTLQNWGVLADATQAVLDSCGNDSGVK
FT                   GRLMHEKGWGVAVQGAPC"
FT   mat_peptide     join(complement(633968..634129),complement(633754..633900))
FT                   /db_xref="UniProtKB/TrEMBL:B6HET2 "
FT   sig_peptide     join(complement(634203..634250),complement(634130..634138))
FT                   /db_xref="UniProtKB/TrEMBL:B6HET2 "
FT   CDS_pept        join(635679..636186,636241..636397,636462..636714)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000222418" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948844"
FT                   /orf_name="Pc20g02780"
FT                   /product="Pc20g02780 protein"
FT                   /protein_id="CAP85607.1"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="UniParc:UPI00018319F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET3"
FT                   /transl_table=1
FT                   /translation="MSRENVEFQTADHVTLRGWFFRPSMEPLETKLPCLVMSHGFSALK
FT                   EMGLDAFAEYFALNLPISCLVYDNRGFGDSDTKEGQPRQEVLPSQQISDISDAITYAQS
FT                   RADVDPNRIGIWGSSYSGGHVLYVGAVDRRVKVVLSHVPFTDGWETLSRLLPSDAIDGV
FT                   NKAFQEDRLARAAGKPAGMIAVVEKDPLKPSTLPTPDSYQFFSEWEAKSNWKNEITLKS
FT                   LEAARGYNPTAHIHHISPTPLLMTVAENDVVAPTDIALDAYSRAGEPKKLRMFPGGHFD
FT                   GYAGEGFERNASVHAEFLKEHLVG"
FT   CDS_pept        join(639475..639620,639662..642131)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948845"
FT                   /orf_name="Pc20g02790"
FT                   /product="Pc20g02790 protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85608.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831ABE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET4"
FT                   /transl_table=1
FT                   /translation="MNSNFNFNNEEVNETMQWPGPPGSFTSSEGFTGTDNDRVGAHPET
FT                   TASRTSSSADLTSLTSSEAYPQESGWMNIDPFSQVREAPQRYDSDLDGIDPRYHLEDEN
FT                   NIPQSLAEDLGSSTITQRPADDPSESTVLPLGGLDRTTIGIPNPAHFSLQPPTQPSYEG
FT                   IVDQVVNTYRALMSDQTCSPHQISQGLQNLETIKYFFHTKLPASPISIASSEPDTRDKP
FT                   LFRCWQCDPQKKKATFPSFGAFKRHLTMHGILDCEWRCTYCDVTLHRRDRMRNHLIHVH
FT                   NKFNLLPADVEATRVRYPPPTNCPIPICLDRTPSWAVYFEHIKSHCLISPVSGNASTNG
FT                   DRSDHSGNGGGNGNRHVHGSSSAGPSNSNRGSQSSQSSNQSGGTPYPSTIFGGFSNRGN
FT                   VCAGPVSHSTSDDQLNTSRRQSATEAIEQISIDDLLRSPHGPRASHLPRGVSGQPNNLL
FT                   PPQDPRLSRSNHSSKRKRQDKQKEPTDEQAPSSNKCRRCNHDMARCGHCQSVDSCHKCG
FT                   DLPRSGIQVGASTTMPAQALPDASSAFINLDESYLNSEALANLVTPQNMPTQLPHYNPN
FT                   EIMHSFDPQSFGDMTNTFMDEFPNDPFIRVAMDVVSHPPLRDLGDKIQGSPVFESDAKL
FT                   LRTIGLGTLIDPLSTKRQLIQPQAKASSGPAPGSYADLRNNGSSSILEAPQPVSRCQCP
FT                   CVTVPAVDYEAHASLQLSPDERVEMAFKMTPARESSHPLRTRVRVFVKLFSLRASAARS
FT                   NTEKQRTRSFSSETTDEDAESETDSDQELTPTSPSSSEITPLLHWTEDVQDWSFSFDIK
FT                   WALTKLAQWTSGIDADTCRKLLLSDPGHILDLMSMYIVYKFKISWLLMGRNGLSVFLSI
FT                   "
FT   CDS_pept        join(complement(644303..644751),complement(643622..644223),
FT                   complement(643389..643561))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194458" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128981"
FT                   /orf_name="Pc20g02800"
FT                   /product="Pc20g02800 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP85609.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001831ABF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET5"
FT                   /transl_table=1
FT                   /translation="MATDDDNFDIDIYGDGTYNANEPGEFKQDDSELVLDAPENQPQPS
FT                   TGPSNDANQENPTSTQGQQVNNNGAPSAPQQPSNHGLPAPPQGVKRKEFEDQSVDPDAT
FT                   TALLISDLSWWITEDDIRGLANQAGVEDQLKDVTFSEHKVNGKSKGQAFVEFTTARAAT
FT                   ATRHHIERNDTPARRHTVQYTTPHQNPFRTLPKDAPMRNAGGRGGGAAHPTGGNYGMNN
FT                   AGGGFRGRGSGFNRGMGHMNNFNNRNNFNPMGGFQGGGPNPMMGGFQGAPMGGMPNYGF
FT                   NNRGNMMGGGMRGNMRGGRGVGMGGGPNMMGMPAMTPPMGGMGMNPMAGMNPMMGGGMA
FT                   GGMGGNMPMQGQQGFQGPNPGFNQGYYNPNNPNNPNNPNNQNQASGSGSGSDGGSWNPH
FT                   GAKRSRQD"
FT   CDS_pept        join(645620..645704,645774..645832,645897..645924,
FT                   646001..646041)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194479" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128982"
FT                   /orf_name="Pc20g02810"
FT                   /product="Pc20g02810 protein"
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /biological_process="protein targeting"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85610.1"
FT                   /db_xref="GO:0006605"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="UniParc:UPI0001831AC0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET6"
FT                   /transl_table=1
FT                   /translation="MSETLQELADIPKDFVREGSQFVRRCTKPDKREFIKISQAVGMGF
FT                   LVMGAIGYFVKLIHIPVNQVLVGGA"
FT   CDS_pept        join(complement(648841..649144),complement(648680..648778),
FT                   complement(648247..648623),complement(647807..648172),
FT                   complement(646981..647746),complement(646678..646877))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194480" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128983"
FT                   /orf_name="Pc20g02820"
FT                   /product="Pc20g02820 protein"
FT                   /protein_id="CAP85611.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0001831AC1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET7"
FT                   /transl_table=1
FT                   /translation="MNDITQNQPVTEVGTYLCTISIHGSLLISTTTIQNMSSRTPDDGT
FT                   ESSRGSEGIWHPAHEWLENDELDTDYHPALEPSEHDGAWEDDIPNEDQQMGSGVASENT
FT                   HINIGNIQIELTADDSESEDTDDLNEGHTRVPASRLFELLASSGLQHILQANGWPTAME
FT                   EEQETLEDEDDELSDEDFMPIFRNRLRARRSTETLKLPPVPNPEGKKLMSEGHFGTDQF
FT                   YGDRLRQRKKFLATSLMWRELGIDTDGVRKRAGQSISQGLIPSSIADKIIHYDTRSYSG
FT                   QFSDDGNFFFCCAQDFKVRMYDTSNPYDWKYYKTVDYPFGQWTITDATLSPDNRFLVYS
FT                   SIRSQAYMASTDPEDNSDPTVLDLSTPPGQRRRRSWGSSHFGIWSLRFSGDGREVVAGT
FT                   SEDSVIVYDLETRQPVLNLRERHQHHVNAVCYGDTSSPHILYSGSDDTTIRVWDRRSMG
FT                   DGREAGAFMGHTEGLTYVDSKGDGRYVLSNSKDQTMKLWDLRKMMTSADIENIDPFDYS
FT                   TGFDYRFEQYPDQYRRNAKNDCSVVTYRGHRVLKTLIRCHFSPPGSTNSRYVYSGSEDG
FT                   KVYVYNLDATLAGTIDVGQATFNSRPRDPDAYATAYEMSGEMLWRTCVRDASWHPNAPV
FT                   LAVHSWNAGAAKDEGDPPAGKSYDDRLRHIPEFDQYRESAPHGRPRRPLRSRPVRRWVG
FT                   DEEAEDAIW"
FT   CDS_pept        join(complement(650480..650531),complement(650317..650414),
FT                   complement(650033..650236),complement(649890..649928),
FT                   complement(649689..649763),complement(649471..649644))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948846"
FT                   /orf_name="Pc20g02830"
FT                   /product="Putative uncharacterized protein Pc20g02830 "
FT                   /protein_id="CAP85612.1"
FT                   /db_xref="UniParc:UPI0001831AC2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF44"
FT                   /transl_table=1
FT                   /translation="MRLSNHLILFSTHLALSIAAGCGDADACVGTEICTTATFTTPTAT
FT                   TITTCRIVSPAVRAKSAAPHTVRPLNVDRLTQTGRTARRIMAHVWQMRTAATETSVWTD
FT                   FVLDLESRLSRELVVNVALELPNCPNYLSLYYPSGRTTIHCNGEPKPIPIERNIHIQKP
FT                   EIRLLQASVFQHIMRSSWFLKGQLSSTPYGNNAIPSHQSHRAGAGNTKWV"
FT   mat_peptide     join(complement(650317..650391),complement(650033..650236),
FT                   complement(649890..649928),complement(649689..649763),
FT                   complement(649474..649644))
FT                   /db_xref="UniProtKB/TrEMBL:B6HF44 "
FT   sig_peptide     join(complement(650480..650531),complement(650392..650414))
FT                   /db_xref="UniProtKB/TrEMBL:B6HF44 "
FT   CDS_pept        651517..652554
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217600" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824630"
FT                   /orf_name="Pc20g02840"
FT                   /product="Pc20g02840 protein"
FT                   /function="carbon-sulfur lyase activity"
FT                   /protein_id="CAP85613.1"
FT                   /db_xref="GO:0016846"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniParc:UPI0001831AC3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF45"
FT                   /transl_table=1
FT                   /translation="MATKTLMASCQCKNFQFTVAVPTECFPLNIHLCHCSICRYTHGAP
FT                   CSFHAPLPVGVEPQFIAPSSLNKLTSYQHPASTATGYFCSTCGCQIGGADGQWVITPAI
FT                   FDANREDEGIWKFNAHMLPTSAPDGGLAAVFSLIDGHRMEIENLGLSPQAIAGSDSQPP
FT                   DPESKELLAQCHCGGVSFTIARPSEEFIASPRSKGWISPLDKSKWLASMDLCDDCRLVT
FT                   GTHVISWMFVSIDHITPRLPKDLLIGSAKGYRSSKDVLRVFCGTCGATVFYHCDGRPEI
FT                   VDVAMGILRAPEGAMAENWSVWRAGRASFPENGMRYHAGFSRALIEGMQRWGAERGHPQ
FT                   DFEIA"
FT   CDS_pept        join(653177..653254,653433..653754,653818..653846)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234882" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824631"
FT                   /orf_name="Pc20g02850"
FT                   /product="Pc20g02850 protein"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAP85614.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI0001831AC4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF46"
FT                   /transl_table=1
FT                   /translation="MQSVPESRQQSFEEIYGPPENFLEIEVRNPQTHGTSRNMYTSYEI
FT                   VCRTNIPAFKLKHSVVRRRYSDFEYFRDILERESTRVTIPPLPGKVFTNRFSDDVIEHR
FT                   REGLQRFLQIVAGHPLLQTGSKVLASFIQDPNWDRNAW"
FT   CDS_pept        join(complement(655642..656690),complement(655553..655582),
FT                   complement(654576..655497))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194447" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824632"
FT                   /orf_name="Pc20g02860"
FT                   /product="Pc20g02860 protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85615.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI0001831AC5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF47"
FT                   /transl_table=1
FT                   /translation="MESSSALRPLDESLLRELPQLSLRIAPLREPVSSRTLSVPSPLEP
FT                   NASGARDSNNISNSSSNSGKIQANAKEGLPTVTEFLNAARIRKTELSADSQSNVERPPR
FT                   PILPAFVNLRALEKFPFSSSFDDDALQGPRKRRRRDPQPDSFSEHLQLPIPQAQKEQRP
FT                   PPFGPFAILNGLNEPPPNAALLPPIEAGSNISQLLNKPSRGDAAADSGTSVSAHAAISD
FT                   GQPAERRDTRLEDILRTSLNADGDHDQNDNAENVQSTNPVDPDEIALAVREAEKLKDSK
FT                   ESPLPPAADAPMSPKTRGRSRKNLRKWSEEETTNLLRGVIKCGIGNWTAILAQPELKFN
FT                   QRTASNLKDRFRVLCPWAYSASDPDLAAKQLHDTLANSLLKAKAEGSDESPSKLHLSHL
FT                   IPSNFEPNFGAGSPACNPQEPLISSTAPDTDPRGSTTAQSQSPSSGNSTPALSSKSRTT
FT                   LASLGIPEPHVSRTKRRSRRPFTAAEDEALLKGYAVHGFQWTLIQQDSRLNLSHRKATD
FT                   LRDRFRTKFPHAYRDGGSVSGKALTSQNQAQESAVGTSTPRPHAGTEQSPSKAYAMTPT
FT                   QTPATTPRTSVSRSRHAATPSQSNPAQIDPALLPPPPQGFLEHSMYLPPAAAAGALSFS
FT                   LDDGPGTGASSAVETPWEDNTLAPMIWDELT"
FT   CDS_pept        join(657129..657190,657259..657667)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194436" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824633"
FT                   /orf_name="Pc20g02870"
FT                   /product="Pc20g02870 protein"
FT                   /protein_id="CAP85616.1"
FT                   /db_xref="UniParc:UPI0001831AC6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF48"
FT                   /transl_table=1
FT                   /translation="MPTIFPTWPHILFGVLEPISLALGSVFPLYDLEGFIAGQTPTIAA
FT                   PATLHPSSVALAYQLGNVYSLLFLVGVGVCHATTEPRVLRNYLIGLAIADVGHVYATYL
FT                   AMGWDAFADVGAWNALTWGNIGITMFLFVNRIAYFLGIFGYAKAPKAAAKRE"
FT   sig_peptide     join(657129..657190,657259..657268)
FT                   /db_xref="UniProtKB/TrEMBL:B6HF48 "
FT   mat_peptide     657269..657664
FT                   /db_xref="UniProtKB/TrEMBL:B6HF48 "
FT   CDS_pept        join(complement(659356..659961),complement(658807..659292),
FT                   complement(658434..658736))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194425" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948847"
FT                   /orf_name="Pc20g02880"
FT                   /product="Pc20g02880 protein"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85617.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="UniParc:UPI0001831AC7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF49"
FT                   /transl_table=1
FT                   /translation="MSAQSSIAASDWGHSYPSIFQLNLEIPAFFMPYRWWEDEATTVFW
FT                   AFDIQGISRVIQFGLFRDENFPRTSLCARNVDTIDTFLMALSEPHEYQLLGNLSHIQRV
FT                   EEILRRSSISPFQAIPWSWLPPQPSPTLDAREIAAAIEAESHFHFKQVAFEELVRAALG
FT                   YNAIFVDWFLQQHEALYIILRDHLGAYPEDIPLYTEVGKHLRSRSPFAYRALVQCLIAV
FT                   RPGGNRDVTKPTAGFEFIAGPIQALFKEQPGRLIAMLKMLSVLTIRFRRKYVHAPTMDW
FT                   RTPFDTSIPFLDDYLESTSPTDLARSMRGLDEHHFAELTRQSLIAEDAVVGQLKVQWRE
FT                   LSVSVWECCAALPDLIPYLQECAQTLLTTRNYHSFTAIIKGLHTYSILKTRPGNTGTQG
FT                   NVVTLETLFPQEILSLMSPAQNYAAYRQHYQKFPGIPFLIPHIRDHKENGESVLQPVFQ
FT                   YLQSTQ"
FT   CDS_pept        join(complement(662126..662252),complement(661767..661906),
FT                   complement(661670..661729))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128984"
FT                   /orf_name="Pc20g02890"
FT                   /product="Putative uncharacterized protein Pc20g02890 "
FT                   /protein_id="CAP85618.1"
FT                   /db_xref="UniParc:UPI0001831AC8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF50"
FT                   /transl_table=1
FT                   /translation="MEGGEQNNLIDPNSILALGRPTFGSPLGILGIRFACSKRHTVVSP
FT                   RRTNGHIIWGMHNNAVVDYFLTVTPGTRNIERNILLPKVPNWSILELGSGSGILCITLH
FT                   FPLL"
FT   CDS_pept        join(complement(665360..665370),complement(665076..665213),
FT                   complement(664723..665007),complement(664296..664590),
FT                   complement(664188..664241))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231325" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948848"
FT                   /orf_name="Pc20g02900"
FT                   /product="Pc20g02900 protein"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85619.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="UniParc:UPI0001831AC9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF51"
FT                   /transl_table=1
FT                   /translation="MRGPGKHQKRLSAPSHWLLDKMSGTYAPKASPGPHKLRDCLPLIV
FT                   FIRNRLKYALNGREVKAIMMQRLVKVDGKVRTDTTYPAGFMDVISLEKTGEHFRLIYDT
FT                   KGRFTVHRIQAEEAEYKLCKVKRVQLGKGGIPFLVTHDARTIRYPDPAIKVNDTVKVDI
FT                   ATGKILDFVKFDSGVVIMATGGRNMGRVGVITHRERHDGGFNIVHVRDALDNQFATRES
FT                   NVFVIGQDKPWVSLPKGKGVKLSIAEERDRRRAHDLAN"
FT   CDS_pept        join(complement(666855..666885),complement(666539..666796),
FT                   complement(665672..666477))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000013358" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977848"
FT                   /orf_name="Pc20g02910"
FT                   /product="Pc20g02910 protein"
FT                   /function="NAD+ or NADH binding"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="aspartate-semialdehyde dehydrogenase activity "
FT                   /function="protein dimerization activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85620.1"
FT                   /db_xref="GO:0004073"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831ACA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF52"
FT                   /transl_table=1
FT                   /translation="MAPSFPKKKCGVLGATGSVGQRFILLLADHPFLELHAVGASERSA
FT                   NKKYKDAVNWKQSKPMSEKLSNLVMRDCKPEQFSDCDLVFSGLNSDVAGETEMAFIKAE
FT                   IPVFSNAKNFRKDPMVPLVVPTVNPQHLDLIPHQREQYGLKKGFLVCNSNCAVIGIVIP
FT                   FAALQAKFGPVEEVEVFTEQAVSGAGYPGVPTMDILDNVIPYISGEEDKLENEAQKILG
FT                   SLNASATGFDEQTGLRIGATCTRVGVTDGHMAFVSLRFKNRQTPTAEQVKEALREYKSE
FT                   AQKLGAPSAPEPAIKVFDAPDRPQPRLDRDISGGYTVSVGRVREGAPGGHFDIRFAALS
FT                   HNTVIGAAGSSILNAEVAVIKGYI"
FT   CDS_pept        complement(<667461..>667695)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(669560..669838),complement(668427..669519),
FT                   complement(668194..668375),complement(667974..668141))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230995" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671922"
FT                   /orf_name="Pc20g02930"
FT                   /product="Pc20g02930 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP85622.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="UniParc:UPI0001831ACB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF53"
FT                   /transl_table=1
FT                   /translation="MRVLRVSRALPTPFCRPQISRTILARGARLNSSDAGTENTKESNS
FT                   SSQNTPPSPFWTPGKALLVSAFAAGLGYGVSSYTQTPTQTSKKPQYGSHNPRAIQTNNH
FT                   PQAINELRTKLDEDTISTDEDDLHQHGFSEWSSLNADRLPVAIAYPKTTQEVSEIAKVC
FT                   NKYRMPMIPYSGGSSLEANFSAPHGGMTIDFAFMNKVLEIHPDDMDVVVQPSIQWMDLN
FT                   EQIKETGMFFPVDPGPSAMIGGMVGTNCSGTNAVRYGTMKDWVINLTVVLADGRIIKTR
FT                   RRPRKTSAGYNLTGMFVGSEGTLGIVTEATLKLAPIPEQTRVGVVAFPTIRDAASTAMQ
FT                   LIRKGVSVQCMEIMDDVQMDVINRAGGTGREWKVSPTLFFKFSGTVAGVADSIDMTTKL
FT                   AQGNNAQSFEFARDDREAHDLWSARKQSLWSMMALRKEGSEVWSTDVAVPISRLPDIIE
FT                   ISKKELVDLGLFASILGHIGDGNFHASIMYDRNNPAERERVEKVVHDMVDRGLEMEGSC
FT                   TGEHGIGLGKKGSLKKEVGLDTINVMRSIKRSLDPNWLLNPGKIFDYDEETPGPGH"
FT   CDS_pept        join(670302..670311,670580..670653,670723..670849,
FT                   670900..670994,671056..671667,671721..671873,
FT                   671927..673147,673213..673341,673400..673516,6
FT                   73571..674182)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194414" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948849"
FT                   /orf_name="Pc20g02940"
FT                   /product="Pc20g02940 protein"
FT                   /protein_id="CAP85623.1"
FT                   /db_xref="UniParc:UPI0001831ACC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF54"
FT                   /transl_table=1
FT                   /translation="MADAMEQLAQLVREVERIVTAPYVPSLQQSQSSTIGAWAFCKPCQ
FT                   LGLLADVFIEALSRSRVALPLITAFASTATFRDALLERHPVVLDAFLEKAMDTNGAEYL
FT                   PACIALFSSPLPAGVVPPARIAPFITKLVSMMAENPCVETVAPLQALISGLKGSPRILD
FT                   DIPSEVMSNLQLEFTKTLRNLDDHMGNLLCLATFAQIATALGTTSPNQHGSEAPWLLNI
FT                   KHFFGQKRGLKTLDLVVLRVILACSSSCNLAPPEAAESIRLAICIAGAIEPEQKQVWIA
FT                   GNNPKIAKLCEKAVRDGLCGQTQTMVIVFLHTLLPAHLLPSQLRELGLKVILSKNSQET
FT                   VGTIPHQLIPRLAKSLAESGELATRQLLTFTFDVLRSSKSSGMGEMATLQLAHLVLAGV
FT                   QDVHPEILLSCAKNSMVPLREVLGELVEHFPRRPSESQCSDRAWCASKLYTKQNRLFLS
FT                   LLGLYNMATAQSGSDLIMKSFMRRVEQSMPSLDCAFSTITSKAFRGSLTLRDRHDLWPT
FT                   KVNRNWRSGVTELFMQNAQTSHDSMMRKIEDTCSDLERRCYDVEGPLRAAEEERDIYAS
FT                   ENEQLKRQNKELNEQLCTNNTEVQTKLQNSHECFVELGHEKTRLEQLLQGQYEYTEELT
FT                   VSLASTREELQQQQRSSEKALLEEKEKARSKELEMMATLTGKDDQLEELQEEMCSLQMK
FT                   NEQTRQSLDQVTSEKAKLSEHCSSLEQELASATEALKQTRLLADEREDEVNRLLAQEEE
FT                   LRKELGTVETTVAQQNVEVERLYSTLEESEEGSRREIERLKHDREAEASRAASEIAKHE
FT                   TDNRRLHAAMQAAALDASKDAQLKDKRIQHLERKVQALRDERAAKAREFSEAQQHIGRL
FT                   MGVMGFSANAPESNAAPRHQRARSSANTTPAARIPQHISDDEDGTQLAQSFESITSNFH
FT                   EPTPKRPRGNRKSTNHPYNFDTPSAAAPKSKSPLRASDMSRSMRKPLAEADRNSPTKSQ
FT                   SSSALKRNQVDDAFQEMQTQENTEENRLHNLDLDMDLEFSRDFLFSSTAFTGSTDQIAP
FT                   Q"
FT   CDS_pept        join(675232..675527,675586..675742,675796..676243,
FT                   676302..679507)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194403" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128985"
FT                   /orf_name="Pc20g02950"
FT                   /product="Pc20g02950 protein"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP85624.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="InterPro:IPR007855"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001831B9A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF55"
FT                   /transl_table=1
FT                   /translation="MTGPDLPSLQHPKSNLLRMVPPNIPTPARRNPPVLDLPVRDWITW
FT                   RSWRTCAVDLLNLPREMNTHDIYDAFHRYGNMISIDLWEDASGRPDCKGRIRFKPPPTE
FT                   EFWRTGSFGVKLRSGRVAVISLSVCCGDSNGTIQSPVRPDIQLPGEVELKTVQVDIGVL
FT                   LGLSTFHSMQSFTNLAYPRCVVDVMRKCLFLYFRVGIRGSDTADVNQHDHRVKITFLQL
FT                   TQIYQQYDKATRERSLLIVLDSAAIWHRKAKDIQSTLTEPLSWREEDSWYRQTSVTHNP
FT                   NSLKTLPANLKKTGHIIDLGRWNVFKISFAPDVDPNVRRVDDTSHYLMRVEEIFKDYNI
FT                   TVQDGSHFVEKADRPVPVWHWIDFSESKSNKASALLQDLGNQNYLHLPFKVRYQLEVCL
FT                   SQGYLSEFTMTREFIETLKGLGDDQATRLLEFVATEKKQYLAPMEIFDLKFFKGVTDSR
FT                   IPNYCCFMRTARITPTTIYYNTPTVDISNRVVREWSTKGTPGRFLRVRFTDEKTEGRIN
FT                   ASQRGCNDEVYTRVKRTLANGIAIGDRHYEFLAFGNSQFREHGAYFVAPDAGISAGTIR
FT                   AWMGQFNHIRNVAKYTARLGQCFSTTRAFTGSSVQTIPCDDIIRNGFTFSDGVGKISKF
FT                   LAQMVTSQHDIKTLTGEPPSAFQFRLGGAKGMLVVSTDPLPQEVHIRPSQQKFETSQAG
FT                   LEIIRWSQYSLATLNRQIILVLSALGIPDEVFHSKLNTMLGSFHRAMLNDSKAINLLQK
FT                   YIDPNQMTLTLAQMVSDGFRRNEEPFVNTMLELWKSWHLKHLKEKAKIAIDQGANVLGV
FT                   MDETGVLKGYFRKELPSRRASYAEKLAALPEIFVQVCRLDGGGEYEVIEGLCILARNPS
FT                   LHPGDIRVVRAVNRSELHALRDVVVLPQTGDQDIASMCSGGDLDGDDYLVIWDPNLIPA
FT                   NWFVECMDYKGSKAPDLDHDVTVDEITSFFVTYMKNDCLPRIAHAHLAWADRLPRGVWE
FT                   DKCIRLAQLHSDAVDYNKSGAHARMARSLDPKFWPHFMEKRFKRPSSIYKSTKILGQLY
FT                   DAVITPDFVPKLEKPFDSRILESPLAPASEAYMEYARELKAEFDMNMRQIMAQYEINTE
FT                   FEVWSTFVLRHGFVIKDYKMQEDLGRIVGTLRRGFRHQCYDKVGRDGGNIPALVIAMYR
FT                   VTQEQVAAALEARRNEALQREDVSIAEVNSTELPLISFPWIFPDVLGDVATGRARQAMI
FT                   SDGQESADSAKPIGEGLVFTHKQILKIVEDMDGDIKSTAENMKLKDPKNMEPKAEAGSN
FT                   SAPPDQELIARRRIDKTKPKQKSEDRDTGLYIEEDDEKEGGVAIGSAKTEEKIDKREAV
FT                   TEDIVEMEGDVKPSALDDLIKMIGG"
FT   CDS_pept        join(complement(684656..684890),complement(679747..684605))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194392" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948850"
FT                   /orf_name="Pc20g02960"
FT                   /product="Pc20g02960 protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="nucleotide binding"
FT                   /biological_process="DNA replication"
FT                   /protein_id="CAP85625.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="UniParc:UPI0001831B9B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF56"
FT                   /transl_table=1
FT                   /translation="MEPFRVRLNCIDHYQATASELDPPLLFRDEVSEKDFKPKVPVIRI
FT                   FGATETGQRVCVHVHGAFPYLYIEYNGSLAPEDVNSAIRTLHLSIDHALAVSFRRNAYD
FT                   RRTAFVAHITLVKGVPFYGYHVGWRFFFKIYLLNPFHMTRLVDLLHQGAVMKRPLQPYE
FT                   AHVQYIPQWMCDYNLYGCAIMSCSQAKFRAPVPEYFELSNLAHRWHDRSILPESILDHP
FT                   ALQKQSHCALEVDVCVQDILNRLDVKERPLHHDFTELLKPVAVNERLVPSVAGLWQDET
FT                   RRRKKRMGLTDPGSTPFGPEELVSMSADPRDQSKGGWIHEEEFREMASQLAANEKQADG
FT                   GKDTSFGTFLDTDDQAKYVKTALDSTEDFFPGKISTSTFDSSRSQEPAEQKLSEISVDE
FT                   GLALSSQTDGQYYSDSDQGGHSLEGIIEHEPETKQDPLGDSFYDEIFDEMPFLDVAAPA
FT                   ESAETNCPEAAMDGGYKEGDYVAQERRPRDQSQNKSVAPKRQRSETLDCHHSPTKRARH
FT                   IAEHGLSDGPLESPNTRKHQQDDKPKNVSFDSNLDSHAETPSSESKSSSQRTVRPKAHS
FT                   YTSGLKFPVVKDPNDPLTILRYSQDEATSSRKDPESSQPLLNSFPSGSATELSGKTSET
FT                   QSSSELHSSATVMGPVSLDPHLSQTVKSIRQSFSFAPNTSLHCFKFASPTFSEVSSSIN
FT                   EHGRPSVVYQKAFYSDEADVPERPREYGGREFRLESNTIHYLPDFDPTAEAPAMFGEQT
FT                   PTAHDRDQQEKVDQQLREWCTSKVWEFAPVPPSRSEVIRWFEELEASQEPDRKAAQPIP
FT                   PEMKSNLLSQIEGPTQKNAHGFKYSQNGVSTSVEHQAQHMSTMSLEVHVNTRGTLMPNP
FT                   EEDEITSLFWCIQSEDEDIEVNSHLPGVHVGMVYHGEGERPEAKISKALTIDVEHEPTE
FT                   LDLINRLIDIVRYYDPDIITGYEVHNASWGYVIERARKKYDFDICEELSRTKSQSNGRF
FT                   GKEADQWGFNHSSSIRITGRHMFNIWRAMKSELNLLQYTMENVVFHVLHRRIPHYSPKH
FT                   LTQWHQSGRPRNILKVVQYFTSRVQMNLEILEANELTPRTSEQARLLGIDFASVITRGS
FT                   QFKVESLMFRIAKPENFLLVSPSRKQVGQQNALECLPLVMEPQSDFYTSPLLVLDFQSL
FT                   YPSVMIAYNYCYSTFLGRAMHWRGRDKMGFIDYKRQPRILELLKDKINIAPNGMMYAKQ
FT                   EARQSLLAKMLSEILETRVMVKNGMKADKDDKVLQRLLNNRQLALKLIANVTYGYTSAS
FT                   FSGRMPCSEIADSIVQTGRETLEKAIAFIHSVERWGAEVVYGDTDSLFVYLKGRTRDQA
FT                   FDIGEEIAQAVTDLNPRPVKLKFEKVYHPCVLLAKKRYVGFKYEHRNQKEPEFDAKGIE
FT                   TVRRDGTPAEQKIEEKALKTLFRTADLSQVKSYFQRQCAKIMQGRISIQDFCFAREVRL
FT                   GTYSDRHLPAGAVISTKRMLEDPRSEPQTGERVPYVVVTGAPGARLVDRCVAPQTLLHD
FT                   AQLELDAEYYITKNIIPPLERIFNLVGANVRQWYDEMPKVQRIRRVEGSALARPNSVGG
FT                   ASRKTLESYMRSSSCVVCRSRLSDAAVPVCGDCLQKPHLTLLDVVSRLQRAEKRVVDLE
FT                   AICRSCMGVSPGDEVSCDSLDCPIFYSRARDAANWRHSKAVLEPVVELLERKGDEGLDW
FT                   "
FT   CDS_pept        685215..686627
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194391" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948851"
FT                   /orf_name="Pc20g02970"
FT                   /product="Pc20g02970 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP85626.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR021715"
FT                   /db_xref="UniParc:UPI0001831B9C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF57"
FT                   /transl_table=1
FT                   /translation="MSRKPADVASKTPNEYIPSFISKKPFYVDDETNNDYLEHQRLQKA
FT                   TPDQSKWYDRGKRAGPAATKYRKGACENCGAMTHKTKECLSRPRKQGARWTGKDIQADE
FT                   LIQKVDMGWDAKRDRWNGYDATEYRQVVEEYEEMEAIKRMAKENSDLKKLQAGEDGDEG
FT                   PDSDIRYAEESDMGRQQSTATRNLRIREDTAKYLLNLDLDSAKYDPKTRRMVDMGAQDD
FT                   QAAALVAEENFVRASGDAAEFEKAQKYAWESQEKGLPQIHIQANPTSGEVLRKKEMVDS
FT                   EAKREAHRKALLDKYGGVEYTKPNALRETMVVENERFIEYDESGAIKGAPKNATKSKYP
FT                   EDVMVNNHSSVFGSWWYQFKWGYACCYSTVKNSYCTGEDGKKAFEEEGNMLMMTGAADD
FT                   NDEISDNAGNANLSHESEQADDRGQEQDSNTNGKKRTLEELKSGVTEEEYESYKRSRLA
FT                   AEDPMANFIGKD"
FT   CDS_pept        join(687130..687133,687208..687270,687421..687492,
FT                   687603..687742)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128986"
FT                   /orf_name="Pc20g02980"
FT                   /product="Pc20g02980 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85627.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018267"
FT                   /db_xref="UniParc:UPI0001831B9D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF58"
FT                   /transl_table=1
FT                   /translation="MTKGTSSFGKRHNKTHTLCRRCGKRSFHIQKSTCANCGYPAAKTR
FT                   KFNWGEKAKRRKTTGSGRMRSLRDVHRRFQNGFQTGTPKGARGPVTN"
FT   CDS_pept        join(complement(689228..689488),complement(688638..689108),
FT                   complement(688260..688571))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194367" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948852"
FT                   /orf_name="Pc20g02990"
FT                   /product="Pc20g02990 protein"
FT                   /protein_id="CAP85628.1"
FT                   /db_xref="UniParc:UPI0001831B9E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF59"
FT                   /transl_table=1
FT                   /translation="MPSQPPLPPLLAPYVSNLPDSSLTLVSSILGATSNWLILRFLHAA
FT                   LSSPSPNAAFGSDELHNGTKKKVVLVSFMRSYEFWRTEAKRLGLDLARLAEKQQFAFID
FT                   GLSELFYAPQPTATSPSISPAGLGSSPRTTLPMRSPPGAVPGRSPQPAGPTATGARGNA
FT                   TSKQAEPGIAKKLHFSGRGLASLDALEKDISSVIEQQKSSMEDGDELLLIIDQPDLLLA
FT                   ATGPSMGIGATEMSEWITALQQHAHATVLTLATDAPLIHNASTSGGLATPIETEHAALV
FT                   IGLAHRARSVMQLRTLDTGAAKDVSGVLRISRGGGLNASEESLEEREALYFIQRDGGVK
FT                   VFGRGES"
FT   CDS_pept        join(690393..690425,690498..690527,690589..690683,
FT                   690742..691052,691119..691798,691853..692373,6
FT                   92455..692878)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194356" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948853"
FT                   /orf_name="Pc20g03000"
FT                   /product="Pc20g03000 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85629.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR005600"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831B9F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF60"
FT                   /transl_table=1
FT                   /translation="MASTRDSHSFACDECRLRKSRCSKERPVCLQCRQLNKECIYSPKV
FT                   SRSPLTRQHLTYVEDRLHSFETALGRLFPGGDLDATLRSLLQNPEVARAPSSKSSSRHS
FT                   TPKHEPERAEPAPEALPQQADGFDWAEKEITLGDLTDGMAALSIKPEGAGYFGASSSVV
FT                   PLRALFDHGFDLNIPVRSAKSGGVPLKAQLLESAPSGLIEQAFIDAFFLNYHTSYPFIH
FT                   EPTFRMQFNDPSLRPHGTAWHILLNTILALGAWCIGDDSSDLDITFYQEARGYLQQASV
FT                   FETGNLTLVQGLLLLSNYAQKRNKPNTGWNYLGLAVRMAMSLGLHKEFPGWKISLLQRE
FT                   IRRRLWWGVFIFDSGAAKTFGRPILLPEDSVMDAKQVRNIHEEDLTPTTTTLPAESPGP
FT                   TIYSGLIAQASFHLLTNSVYQRLISSPSLTPEDTLNLQKPIEEWYNGLPSYLKHQQLPL
FT                   SMQPANPDPDSLALVRNRLLWRNWNLTILIYRPILLRWAARRWAPLSGSGTATPDAGSE
FT                   DPFETECRLRCLQNARLTISSISDYMANYMCTRLGAWYMLYFLFQAGLIPIVFLMTDPS
FT                   NPEAASWLQDIETTKSLLTHPSLGTNRFATRCLEVINRLLGPPTHPMPQGIPTEGDQLN
FT                   PQHQQQHEHMLPQLQPNMMPFPGQLFSDPGFGGSLFPVEQQMQMHNAGGMDFSEWVNFP
FT                   PAE"
FT   CDS_pept        join(complement(695159..695239),complement(694713..695109),
FT                   complement(694219..694661),complement(694076..694166),
FT                   complement(693717..694022),complement(693551..693647),
FT                   complement(693364..693490),complement(693136..693285))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977849"
FT                   /orf_name="Pc20g03010"
FT                   /product="Pc20g03010 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85630.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831BA0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE4"
FT                   /transl_table=1
FT                   /translation="MATIAESSPKGGFALVLQNPFLCGVASFSTLGGLLFGYDQGVISG
FT                   VITMESFGARYPRVFSESGFKGWFVSTLLLAAWAGSLINGPITDRIGRKMSINLAVVVF
FT                   VIGSVIQCAAMNISMLFAGRAIAGLAVGQLTMVVPLYISEVSIPEIRGGLVVLQQLSVT
FT                   LGILFSYWIDYGTNYIGGTRCAPDIPYSGGTISKPTFDPYHDVPAGGCNGQSEVSWRLP
FT                   LALQIVPAVILGIGMLFFPDSPRWLLMKERDDDSLHALSRLRRQDRDSPVLLNEYLEIK
FT                   ASIMLENSFARDNFPNLSGYQLHAAQYMSFFTTWSRFRRLAIGCIVMFFQQFMGCNAMI
FT                   YYAPTIFGQLGLDGNTTSLLATGVYGIVNCLSTLPALFFIDKVGRRPLLMAGAAGTCIS
FT                   LVIVGGILGGFGSSLVSNKSAGWAGIAFIYIYDINFSYSFAPIGWVLPSEIFNLSIRSK
FT                   AISITTSATWMCNFIIGLVTPDMLESITWGTYIFFAAFCLLAFAFTFLCIPETRGKTLE
FT                   DMDLIFGDTAAHEEKKRIKHIEAELRGTPIEEDDLIKPVGSHVEQA"
FT   mat_peptide     join(complement(694713..695109),complement(694219..694661),
FT                   complement(694076..694166),complement(693717..694022),
FT                   complement(693551..693647),complement(693364..693490),
FT                   complement(693139..693285))
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE4 "
FT   sig_peptide     complement(695159..695239)
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE4 "
FT   CDS_pept        join(696233..696761,696870..697078)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194345" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948854"
FT                   /orf_name="Pc20g03020"
FT                   /product="Pc20g03020 protein"
FT                   /protein_id="CAP85631.1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI0001831BA1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE5"
FT                   /transl_table=1
FT                   /translation="MSSPLRIGVLLVGTVQLLDLSAVDLLYMTTPEYLQECSLPRPLVD
FT                   LGRPCEIHYIAHNANDTAKTTAQMSLQLTDSLTDSAVSPGKLDIVLIPGPPPKAMPPPE
FT                   EYLDFVRAHFAAGAPILSVCTGAYVIGHAGITKGREVTAPRLLIPEMRRKFPEAKLWDD
FT                   SVRVARDGNLWTSGGITNGHDLVAGYLREHYPAALVNTILVAADIPSRPAAYATPAVSD
FT                   TLYILWQIIRAVPNAVVGWFRGR"
FT   sig_peptide     696233..696298
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE5 "
FT   mat_peptide     join(696299..696761,696870..697075)
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE5 "
FT   CDS_pept        join(complement(699619..699690),complement(699442..699567),
FT                   complement(699221..699234),complement(698693..698953),
FT                   complement(698181..698639),complement(698044..698119))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194334" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977850"
FT                   /orf_name="Pc20g03030"
FT                   /product="Pc20g03030 protein"
FT                   /protein_id="CAP85632.1"
FT                   /db_xref="InterPro:IPR019400"
FT                   /db_xref="UniParc:UPI0001831BA2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE6"
FT                   /transl_table=1
FT                   /translation="MNALSADEMERFQKLSNSYQPDVQGPLVSTKQSSHSIALDYSNAD
FT                   PTLATKTNVSFGGLSLLCYHNIRRMNAWMKLNPNRYQAFLPMPLNQYCSSRIDPVKTEI
FT                   DEVGLQALIDGVIEGSGFGVEILYLDRSEGGAVTPHQLSSDSPSGATIRLLYRPGHYDI
FT                   LYPVEPLNMAPIVNLQYGMTSDYSPWDPTALGFDVNSSLMAIPNLMQDTSFGMGAPMSP
FT                   MPSVSPTPASPFRMSPQQDMYQSPMPTHAAPIPPIPVSPPPQIAPPSSAPPPMTSLPSR
FT                   SSDGPQIRLNPLVMKPNLSRSLPVTTPFKNSPYNQAHFQNSDFEPIHWEPHERR"
FT   CDS_pept        join(complement(700714..>700915),c
FT                   omplement(700627..700658))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   gap             700959..701058
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(704716..704759),complement(704504..704662),
FT                   complement(704386..704446),complement(703128..704324))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194333" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948855"
FT                   /orf_name="Pc20g03050"
FT                   /product="Pc20g03050 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85634.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="UniParc:UPI0001831BA3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE7"
FT                   /transl_table=1
FT                   /translation="MSDDDDFMQDSGDEDYDFEYEDADEDESGDIGIENKYYNAKQIKV
FT                   DNPEEAVDEFLGIAPMEQDKSDWGFKGLKQAIKLEFKLGRYSDTVAHYRELLTYVKSAV
FT                   TRNYSEKSINNMLDFIEKGSDNAEAYQCMEEFYSLTLESFQNTNNERLWLKTNIKLARL
FT                   WLERKQYGQLGKKVRELHRACQREDGSDDTSKGTYLLELYALEIQMSSETKNNKRLKAL
FT                   YQRALRVRSAVPHPKIMGIIRECGGKMHMSEENWKEAQSDFFESFRNYDEAGSMQRIQV
FT                   LKYLVLTTMLMKSDINPFDSQETKPYKNDPRISAMTDLVDAFQRDDIHAYEDVLSKHPD
FT                   VLADPFIAENIDEVSRNMRTKAVLKLIAPYTRFSLQFISKHIKVSVPEVLDILSFLILD
FT                   KKLNAKIDQDNGTVVVESASDVERLRAVGEWSSALRNLWQTTLNGEGLRANDPSQGSIF
FT                   QSSLLGDEGMRSTRARKDGRGKMPAKWF"
FT   CDS_pept        join(705768..705817,705874..705920,705990..706091,
FT                   706238..706359,706412..706613,706669..706787)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977851"
FT                   /orf_name="Pc20g03060"
FT                   /product="Pc20g03060 protein"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85635.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI0001831BA4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE8"
FT                   /transl_table=1
FT                   /translation="MQLCGRQKVVQRKMVLLGDGACGKTSALNVFTPSSPRFSKKFYYL
FT                   QKHTSKCRLLTLVIGCTQRAYNIFVDNIHVELSLWDTAGQEEFDRLRALSYEDTHVLML
FT                   CFSVDSPDSFENVSSKWIAEINENCPGVRVVLTALKCDLRKDEDMNENPNTISFDQGLA
FT                   KAKEIGAVKYLECSAVQNRGIRESFYEAAKVALEVNAGGSSSSGSQCIIQ"
FT   CDS_pept        complement(707706..708614)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194322" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671923"
FT                   /orf_name="Pc20g03070"
FT                   /product="Pc20g03070 protein"
FT                   /function="octanoyltransferase activity"
FT                   /biological_process="lipoate biosynthetic process "
FT                   /biological_process="protein modification process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85636.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0009107"
FT                   /db_xref="GO:0016415"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniParc:UPI0001831C7E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE9"
FT                   /transl_table=1
FT                   /translation="MRLAHLHLPHTTPFSRVSHLQQTLTTRLLTHKKLASPGSISSQEP
FT                   SNPSATLSKTPPSPPDPTIITFTPNPVYTTGRRDLPPSNTSPPSTTNPILSLPPALEPI
FT                   RSLFTPDGTKPAKAEYHPTLRGGQTTYHGPGQMVAYTILDLKRLGLTPRCHIRVLENSV
FT                   IDLLKSYGVEGFTTEDPGVWVNPVSGSRSASGSALQPRKITAVGVHLRRNISSFGIGLN
FT                   VTDEPMWFFKQIVACGLEGKEATSLQGVGVPGLEVGDVAAAFVEKFVSRVNADFACGEN
FT                   SLGEKIDEVYQVREEDLLNSV"
FT   CDS_pept        join(complement(709763..709879),complement(709087..709698))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194299" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671924"
FT                   /orf_name="Pc20g03080"
FT                   /product="Pc20g03080 protein"
FT                   /function="FMN binding"
FT                   /protein_id="CAP85637.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI0001831C7F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF0"
FT                   /transl_table=1
FT                   /translation="MAESLNPPLSYEASATTTHPHVATSLPSEVIACLKNSRFLHLATC
FT                   DDKTPHISLMSYTYLPSTPFDPHPIIIMTTNPASRKTNHLLSNPRVSLLVHDWVSHRPP
FT                   TRAPTQGDREGSPPPAATRSSLASLLLNLNTSALSSISTTITGEAQFLEPGSEEESWCK
FT                   ARHLENNTFEEEEINLFGQQQQQDPSARRPSLSIDTDVRVVTVRVTEGRIADWKGGVRD
FT                   WVLLPAEQQDAGLVNGVASS"
FT   CDS_pept        join(complement(710846..710922),complement(710688..710771),
FT                   complement(710503..710606),complement(710322..710407))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948856"
FT                   /orf_name="Pc20g03090"
FT                   /product="Putative uncharacterized protein Pc20g03090 "
FT                   /protein_id="CAP85638.1"
FT                   /db_xref="UniParc:UPI0001831C80"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF1"
FT                   /transl_table=1
FT                   /translation="MRLTNDESEVDNKLGRRIKWEEEEEELKLQGRGRVEEGAMIGVGV
FT                   PIRSESMRITPSQYHVGMSGDAVDFILLNGSCLCAGKELPRVLDVLGTIGLPQATACTW
FT                   NSVLRTSPLIRD"
FT   CDS_pept        join(710950..711607,711668..712152)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194298" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671925"
FT                   /orf_name="Pc20g03100"
FT                   /product="Pc20g03100 protein"
FT                   /protein_id="CAP85639.1"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniParc:UPI0001831C81"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF2"
FT                   /transl_table=1
FT                   /translation="MLAPRAARSVRSVTSLLRPFSSSAVAYRAPSIRDITAQSTEEYLR
FT                   RRKEFRENLEQARLKREQQESQSVNASASSSTPSREYAPTAPEVSNASIHDRIYPTFDA
FT                   ATALDQKGLGSLSTHRYLGDDQNQEAAAKRGPLSSLIYGTKEGQHFDKDMERSFSQVLA
FT                   RGKYVHSIVMHDVKPDKVDEYVDLVGQWYPRMAGTEENRVNLVGSWRTQVGDNDTFVHI
FT                   WEYQRYEGYHDSLHNISQHPEFREFDRKLKSLIKSKRTSLMQEFSFWPTTPPRRLGGLF
FT                   ELRSYTLHPGNLLEWETHWRRGLTARREVMEGVGAWFVQIGELNTVHHLWQFANLEERK
FT                   ICREQSWGIEGWAETVHKTVPLIQSMQSRILVPMPWSPVG"
FT   sig_peptide     710950..711027
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF2 "
FT   mat_peptide     join(711028..711607,711668..712149)
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF2 "
FT   CDS_pept        join(713065..713204,713409..713418,713495..713652,
FT                   713712..713758,713831..713926,713982..714649,7
FT                   14711..714824)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000157893" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948857"
FT                   /orf_name="Pc20g03110"
FT                   /product="Pc20g03110 protein"
FT                   /function="phosphotransferase activity, for other
FT                   substituted phosphate groups"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85640.1"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016780"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014472"
FT                   /db_xref="UniParc:UPI0001831C82"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF3"
FT                   /transl_table=1
FT                   /translation="MVYIRQHELANLKNYKYAGVDHSPVSRFILKPFYNKCVIPCFPMG
FT                   MAPNAITLSGFMFVVINFLTVMWYNPNLDTDCPPWVYASCAIGLFLYQTFDAVDGMQAR
FT                   RTRQSGPLGELFDHSVDACNTGLSVLVFAAAMNMGQSWMTFIALFGSTMTFYVQTWDEY
FT                   YTQILTLGVISGPVEGILTLCVVYIFTAYMGGGSFWHQPMLETIGVPKPSFLSSQVYNM
FT                   PFTQWYLVYGAIMLCFAISSSVMHVMKVRRERGQDPFSPLYGLLPLAVIWTLIPAYLYL
FT                   QPVILENHTIPFGLFVSLVNAYSVGRIIIGHLTQTSFPYQNVLLYPLALGVLDSVGALI
FT                   GLWSAPMLGYGVGQVGFVFGLLGLAVGVYGSFVFDIITTICDYIDIWCLTIKYPFVEET
FT                   ERKTGVSKKTI"
FT   CDS_pept        join(715399..715401,715531..715593,715818..716000)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224977" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948858"
FT                   /orf_name="Pc20g03120"
FT                   /product="Pc20g03120 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85641.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI0001831C83"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF4"
FT                   /transl_table=1
FT                   /translation="MVLAVDLLNPTPQAEARKHKLKTLVPQPRSFFMDVKCPGCFTITT
FT                   VFSHAQTVVICAGCSTVLCQPTGGKARLTEGCSFRRK"
FT   CDS_pept        join(complement(718205..718242),complement(717788..718088))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194277" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128987"
FT                   /orf_name="Pc20g03130"
FT                   /product="Pc20g03130 protein"
FT                   /protein_id="CAP85642.1"
FT                   /db_xref="UniParc:UPI0001831C84"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF5"
FT                   /transl_table=1
FT                   /translation="MSTTNIQDLNAKISAFESHPQCKPPNTHPTIFFLYDFVRNTHNQL
FT                   KAVDAEKYAAGDNGAKNAVGEVEGRNAFANMLINDTSGKLSMMTGGNPSNPADFGAEIK
FT                   AKAQILTQ"
FT   gap             718486..718585
FT                   /estimated_length="unknown"
FT   CDS_pept        <718586..719395
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194266" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948859"
FT                   /orf_name="Pc20g03140"
FT                   /product="Pc20g03140 protein"
FT                   /protein_id="CAP85643.1"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="UniParc:UPI0001831C85"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP5"
FT                   /transl_table=1
FT                   /translation="HGYTQSGSLFHAKSRALTKHIQKAFPLHEVTAIYPTAPIRLLPAD
FT                   IPGYEPSSEGGADNEIESYGWWRRSNTANPPLYIGIEEGFATVARTLKQEGPFDGVIGF
FT                   SQGAALAAMVAALLEPGRKASFEQFSKISAEGAAGMTIPAPFGEEGFQHPQLKFAVCYS
FT                   GFRAPGARYRGFYEEPAIQTPVLHVLGSLDAVVEEARSQALVEACAGEPEKDGLVVWHP
FT                   GGHFLPSQRPYLDATVRFIREQMERSDGSNGKGKEVEEDVNDMDLPF"
FT   CDS_pept        join(complement(721280..721363),complement(721168..721224),
FT                   complement(720867..721103),complement(720326..720814),
FT                   complement(719670..720272))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948860"
FT                   /orf_name="Pc20g03150"
FT                   /product="Pc20g03150 protein"
FT                   /protein_id="CAP85644.1"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001831C86"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP6"
FT                   /transl_table=1
FT                   /translation="MSGGLLKPEKDFTKDADKLIPEAEALAKTDVQGAVDKLLGLEKQS
FT                   RQASDLATTSRLLIAIVTISKNSGDWNLLNDQVLLLSKKHAQLKQATTKMVQTVMTFLD
FT                   ETPNLEVKMSVIETLRTVTEGKIFVEVERARVTRILSNIKKTQGDLTSAADILCELQVE
FT                   TFGSMTRREKTEFILEQVSLCIERGDWTQAQILSRKINKRYFSRKPKKSAEQIETLKKE
FT                   AEEREKTRAPDEPPMEVDDDVTDLKLRYFEQQIILANHDNKYLEVCKNYREVLDTEAVE
FT                   NNPEHLRASLARIVYYVVLSPYDNEQSDLLHRIKQDSRLSQIPEESRLLKLFTIPELMR
FT                   WPMVAEQFGPHLCSTDVFDAEAKQSTENQANQRWQDLRKRVIEHNVRVVAKYYTRIQMG
FT                   RLTQLLDLTEEETEKYISDLVTSKTIYAKIDRPARLVNFAKPRDADDVLNEWSSDMKNL
FT                   LGLLERIDHLITKEEMMARIQPTRSDKGKAH"
FT   CDS_pept        join(722482..722806,722860..724223)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194244" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948861"
FT                   /orf_name="Pc20g03160"
FT                   /product="Pc20g03160 protein"
FT                   /function="binding"
FT                   /function="uroporphyrin-III C-methyltransferase activity "
FT                   /biological_process="siroheme biosynthetic process "
FT                   /protein_id="CAP85645.1"
FT                   /db_xref="GO:0004851"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0019354"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012066"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831C87"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP7"
FT                   /transl_table=1
FT                   /translation="MKDASCDPKPPVPLMAAWNTESQVHLIVGSNPLAAARCARSLEVG
FT                   ATPIIIAPETDDMHFTLSEHIANGSAQWIRHEFEDKDLTTLGREEVDHIVDLVFVTLGS
FT                   NNSLSPHISKLCRRLRIPVNVSDAPELCSFTLLSTYSDGPLHIGITTSGRGCKLASRLR
FT                   REIASFLPQNLGTAIDRLGAVRRRLWEEDSAAGLIEGIFDREDDDSTGQKHTFNNLVTE
FT                   GDAAAAKTRRVRWLSQICEYWPLRKLVSITDADMDAILKAYTAGNDTTNGTNGLDALSK
FT                   KGKIVLAGSGPGHPDLLTRATYHAIHNADIILADKLVPAPVLDLIPRRTEVHIARKFPG
FT                   NADQAQEEFLVMGLAALKQGRQVLRLKQGDPYLYGRGAEEFEFFRKEGYSPVVLPGITS
FT                   AMSASLFADIPATHRGVSDQVLVCTGTGRKGAAPNPPTYVPTQTVVFLMALHRLSALVE
FT                   SLTTFPAEDTGPQSRTLWPKETPCAIVERASCPDQRVIRSTLEHVCLAFEEAGSRPPGL
FT                   LVVGASCHVLHNPQGQRWVIEEGFHGLDELRSEVDVVAVSMDEKQ"
FT   CDS_pept        join(724533..724588,724619..724727,724847..724931,
FT                   724936..725133,725545..726365)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000241645" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977852"
FT                   /orf_name="Pc20g03170"
FT                   /product="Pc20g03170 protein"
FT                   /function="deoxyribose-phosphate aldolase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /biological_process="deoxyribonucleotide catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85646.1"
FT                   /db_xref="GO:0004139"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009264"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022979"
FT                   /db_xref="UniParc:UPI0001831C88"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP8"
FT                   /transl_table=1
FT                   /translation="MSARPPKPVYFSNGQALQSQTANQRAHSPPLTVRLTRFIESIYFF
FT                   LGLYFTTLFSLDSYAAAENSSFNINNQKNRYTTRSRWGAQPHSVEEAEAEVEVAVVRDL
FT                   VRDALAVWMMSVGRSARAVNKQTVKAVELLLKCNLKEEKSPNGPRCALHQPPSMSEIPA
FT                   TNAEWADKIANMKKQLPRRSLTQPPIPTQIHRTIDHTLLTTPVDASQIDTLCKEALEYD
FT                   FAGVCVRLEHVARAAGHLKGSNTAVACVVGFPEGTHETIEKVREAKEAVQQGATELDMV
FT                   IRYNLLKEGRYKEVFDDVLAVRHAAPTPIVLKAILEATELEEHQLIDATIVSCMAGADY
FT                   IKTSTGWNGGASAQHLKLMNFAAQMCGCTCLIKASGGIRNAEELLRMLKAGANRIGTSS
FT                   GVKIMKEIDEGEVLEQGCGHAVA"
FT   CDS_pept        join(complement(728624..728968),complement(727198..728562))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194233" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948862"
FT                   /orf_name="Pc20g03180"
FT                   /product="Pc20g03180 protein"
FT                   /protein_id="CAP85647.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001831C89"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP9"
FT                   /transl_table=1
FT                   /translation="MLSESFVASTLSSAKSPTASLRDVGVCIHELQPSSILRSTFKKSS
FT                   TLTNCLAVSPSHIFTAQADKAVLHVYNREKGNQEGVVPFPERIRSIAVAGGKYGDVLVL
FT                   GTEGGRLIVWETCTGRQVATTASHLQPVTSLVVDPTSNFILSGSADASVHVWSLPGILS
FT                   FSKPALSATRQPTNSPIRTFSNHRAAITSLAVGHSNGRHNIVVSTAKDNTAIAWDYHTG
FT                   RALRTFLLPLSATSVALDPVDRAFYVGYEDGSVQSVDFYRSQSAQHPLHDPSVQSTPAQ
FT                   VSMEDRWLPPSAETGSAKAISLTYDGTTLLSGHANGKVLSWNVARRKYTSSVADYTHPI
FT                   TNLVMLPPGGIPHPSSDLKRKAHTIVKPRHDSGLSAPNHAPGAVPAEYMFHTQIIAPSD
FT                   SRKPTEFSQALTHSSFPTSMIEDGLAELAAFRQPGSAEVTRVASNAVPARETLEDTAAR
FT                   DSQVTELENEVAVLKKKVAVNETARHNADDEVVQLRSDLANLQDYINELHEKQEAAQQE
FT                   KVLRQARKQEHETKKREAWLAAEKKGRNGDAVIQKMDIDGDVTSDSDDPSDE"
FT   CDS_pept        join(730217..731329,731389..732381)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217213" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824634"
FT                   /orf_name="Pc20g03190"
FT                   /product="Pc20g03190 protein"
FT                   /protein_id="CAP85648.1"
FT                   /db_xref="UniParc:UPI0001831C8A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ0"
FT                   /transl_table=1
FT                   /translation="MDSGATDIPSHACFPAQIQTHIRNQGSNSSSMSHDVMAMAEPIPS
FT                   PRRWSPTYVPRRRSRQMPSLSFVPSPVMPRIESHDFSTSASRRTTDRGPACMSPFRSVR
FT                   RMKEPFQLMLPTSPASLEGPPPNFPEKTRRPSKAPADHTLRTWRSDQNLTCGSLEAFGL
FT                   LPSPPISESRPASTGPELSYFDSQSSDESVRSSDGKDEKDEPGTQPEVSTKAATLEIGE
FT                   KIQYTAYRPPDWKNQPRTDVMNVHEAHSEFVRQCESGNAQQSNPQSPKKAAPSQASPKP
FT                   ESSETVLIPGSSPRPQRPRTATVSSEASWVPSNFSYCERWLQGVPVDKVDDQKTSTKEF
FT                   TNRRKFQIVENDPPMPKLDIIPGAKALEEPVRFVVASKTKPKLVDIARQSSPSPPLLPP
FT                   PCLQPNTVPTTPDQRQEEVSAFSPDTPLDMSDSGYGTRDSGYSFDSFEGSKVDDDDDAY
FT                   TDPGSLTSSDSVGSTVICEKPESTQGEREISPQPEIRSGSVSPKASSPPTTHAPGRKSP
FT                   MSEQEDEKPRILHHDWTLDDHEWTLDELDHSVKDFPRHMLRLASPVMVFLRKNDEKALI
FT                   KPFRTIFPDVAENLLDGLCAALLARNYLLSLSTTCRTKPTTSPRKDAYTIDGVPKKAYN
FT                   TLGIQLPPGSASKPKDPLFSSRSADLQTQLERIVDNLLFAICGRSDPTLKSAVEVLAQV
FT                   LETNASH"
FT   CDS_pept        733195..734445
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000235998" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977853"
FT                   /orf_name="Pc20g03200"
FT                   /product="Lipoyl synthase, mitochondrial "
FT                   /EC_number="2.8.1.8"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="lipoate synthase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="lipoate biosynthetic process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAP85649.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0009107"
FT                   /db_xref="GO:0016992"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001831C8B"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HFQ1"
FT                   /transl_table=1
FT                   /translation="MAAPTRSLRRLSSFRTTISPSLTVTAPIGCRSYATTDSSSATNTP
FT                   GTTRRRATKFQDKLNAGPSFSDFVSGGQDEPLDPSEAYALKTALVGPAGRKKEMTRLPE
FT                   WLKTPIPDSKNYQRLKKDLRGLNLHTVCEEARCPNISDCWGGSDKSSATATIMLMGDTC
FT                   TRGCRFCSVKTSRAPPPLDPHEPENTAEAISRWSLGYVVLTSVDRDDLVDGGARHFAET
FT                   VIKIKQKKPSMLVECLTGDFRGDTEMAALVARSGLDVYAHNVETVEELTPFVRDRRATF
FT                   QQSIRVLDSAKKAVPELVTKTSLMLGLGETDEQLWDALRQLRAVNVDVVTFGQYMRPTK
FT                   RHMAVHEYVTPDRFELWRQRALDMGFLYCASGPLVRSSYKAGEAFIENVLKKRRAGSGT
FT                   AERTVDQTAATTDEATR"
FT   transit_peptide 733195..733293
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HFQ1 "
FT   mat_peptide     733294..734442
FT                   /product="Lipoyl synthase, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HFQ1 "
FT   CDS_pept        join(complement(735831..736652),complement(735516..735773),
FT                   complement(735132..735455))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194222" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128988"
FT                   /orf_name="Pc20g03210"
FT                   /product="Pc20g03210 protein"
FT                   /function="phosphoserine phosphatase activity"
FT                   /biological_process="L-serine biosynthetic process "
FT                   /protein_id="CAP85650.1"
FT                   /db_xref="GO:0004647"
FT                   /db_xref="GO:0006564"
FT                   /db_xref="InterPro:IPR004469"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001831C8C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ2"
FT                   /transl_table=1
FT                   /translation="MAESTRTTRPSLGQMRSSSFLQDHQQYKPMAPINPISQTIGEVLA
FT                   NQTEDQLVLNSNPIKPDPERVTDSGIIHSIFNHQANPLPTGTSQVVATIYYKSNNPVHP
FT                   HYHPDSGPQNVPGDKIPAPKVPEGSAPTEDMDKFPREPPAPEPEPLDHLYGPYVSQLCL
FT                   TNFLQILETLPTPYQRMNTSHRCLDRDEHPRVVEVTFSPPPNPEYLSFPDLRKHESIWR
FT                   FEREWNVEVVLQKESVFRRHKRLAVFDMDSTLIDNECIDEIAKFIGVEKEVSEITERAM
FT                   NGELDFTASLKERVGLLNGVSADVFEKLKSVLKIAKGARELCRALKALGYKIAVVSGGF
FT                   QPLAEWLAGQLGIDIAIANHLEIDEATQTLTGKLVPSYPIVDAAHKRTLLKSIAAENGI
FT                   PLSQTMAVGDGANDLLMLHAAGLGVAWRAKSKVQLEAPVRINGESLVDVLYLLGMDNED
FT                   IAELTSDVQ"
FT   CDS_pept        join(737635..737818,737884..738629)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000249397" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948863"
FT                   /gene_name="ParA"
FT                   /orf_name="Pc20g03220"
FT                   /product="3-phosphoadenosine-5-phosphosulfate reductase
FT                   ParA-Penicillium chrysogenum"
FT                   /function="phosphoadenylyl-sulfate reductase (thioredoxin)
FT                   activity"
FT                   /function="transferase activity"
FT                   /biological_process="cysteine biosynthetic process "
FT                   /biological_process="sulfate assimilation, phosphoadenylyl
FT                   sulfate reduction by phosphoadenylyl-sulfate reductase
FT                   (thioredoxin)"
FT                   /protein_id="CAP85651.1"
FT                   /db_xref="GO:0004604"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0019344"
FT                   /db_xref="GO:0019379"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011800"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0001831C8D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ3"
FT                   /transl_table=1
FT                   /translation="MPAKMPNYSSEMEGVDNHDNMTESGYVSAGSGSSEDYVPEIVFTK
FT                   PHLQFLNRQLQFLEPQEILRWCITSLPHLFQTTAFGLTGLVTLDMLSKLEVPRPQMVDL
FT                   VFLDTLYHFDETMSLVDRVRRRYPNNNVHIYKPAGVETTAEFEAKYGAKLWEVDDQLYD
FT                   WVAKVEPAQRAYREMNVHAVLTGRRRSQGGKRGDLDIIEVDEAGLIKINPMANWSFDQV
FT                   KQYVKENDVPYNELLDRGYKSIGDWHSTQPVAEGEDERSGRWKGQQKTECGIHNPRSKY
FT                   AQYLMEMERKRQEEALSQALQTQLTPVV"
FT   CDS_pept        join(739240..739863,739916..742921)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948864"
FT                   /orf_name="Pc20g03230"
FT                   /product="Pc20g03230 protein"
FT                   /protein_id="CAP85652.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001831D5C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ4"
FT                   /transl_table=1
FT                   /translation="MKWLPRFRPRKASSGDPKGNSAVAPSPPVGPEMIAPSTNSIPASS
FT                   LSEQATSPSVVDSSPFPTAVCAAQLQAGQAAASISPSAGSPPAPSTSAVQDIDIWTTAY
FT                   EVVENREPELMTDYASHLASIQGNPTTKNHISSSEFVEDVVTQLLEEREKKQWRLPLLG
FT                   NNVIVRKQAERLAKVLLWADPVVKRAVSTQPYAALAWSSVSILLPLLTGAATPDVAMLK
FT                   GFNSISDVQVYWAIFEETYLSSSHRQHYENLIEPLAKLYSYIIEYQARAICHLSKTQLS
FT                   RGWQNVAGEDDWAEKASEIEALSEARSSLISHDNETEIRERWGRQLREIQESSAILKEI
FT                   RQVLDETQRQTQGNYEDKAEKDLLHDLASDYEGYKDFNRLRVQGTCEWFFNDEKFCKWR
FT                   DSNTSGLLWLSAGPGCGKSILSRALIDERRLSLNVTTSTVCHFFFKDGYEDRMYSVNAL
FT                   CAVLHQLFSHDPSGALIKLALPAHKNYGKSLVRNFSELWNILLDCAKSPHAGEIVCIFD
FT                   ALDECEQQSRLQLISKLKDFYCQPQGSSALSSKLSFLITSRPYAEIERNFSGFSTTEYL
FT                   HFDGDKKSVAITREIDLVIDDHVSQIIGNFTANDQLEISKRLKTMENRTYLWLYVIFET
FT                   IKEDPSRHGKRSSVEKLLNNIPSKLSEAYEKILGRSRCQEETQHLLEIILAAARPLTLD
FT                   EANVALTLALAEEDFTSHSALENDLWPKNNFESIVKGLSGLFISVHDSKLFFIHQTARE
FT                   FLIDPSGRGTWEGRLSMSKSSRTISRTCFKFLMLPDLRASVKDADFWDDDDYDLNDPNH
FT                   VTLEQLPPFFCYAADHWPSHFLSQGATDIDQSLKDARTLCNRHQAWVWVTASGWTPGGR
FT                   LTLFHHMTDLSLASYFGLKQVVENILTEEHIDVNTEDESSTLALRSSRSALSAACLGGK
FT                   SDVVTLLLDKGANVNSYHKLHATALYTALVYGHQDIVPILLEKGADVNITGEHHGTALY
FT                   MASHLGNPDIVLSILERGADINYNHKWHGTALYRACRSGHPKVVKILLENGANVNIGDR
FT                   GYGSALLAASTHNCPDIVIDLLKKDADTDYNNQKYGTALRMASGHGWQNVVEVLLAHGA
FT                   DPNIRGTEYGSSPIQVASFFGHQGAVEELLKHGADVNFPDQQGNTALLAAARQGHREIV
FT                   SMLLRCGADVTVKGERYGTALNAATEAGHTEIIEMLAKRGAKV"
FT   CDS_pept        complement(743002..744297)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000200289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948865"
FT                   /orf_name="Pc20g03240"
FT                   /product="Pc20g03240 protein"
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity, transferring nitrogenous
FT                   groups"
FT                   /protein_id="CAP85653.1"
FT                   /db_xref="GO:0016769"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001831D5D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ5"
FT                   /transl_table=1
FT                   /translation="MTQSVLSRRAQDVVDAGSENPMWDVMKDTWHASTNPTGYVNVGVA
FT                   ENALMHDELLEFINKKLELPAKYLTYNDGGGGSSRLKAAIAAFLNHNLKPVIPLEPSHI
FT                   MATNGVSSAIEHVAWSFADPGEGILLGRPYYGMFIPDMSLRTGSSVVPVSFGELDPLSV
FT                   EGVDKYEEALLEFHRTTGKKVKALMLAHPHNPLGRCYSREVLVKLMRLCQKYQVHFISD
FT                   EIYALSVFENTVGEHPPPVKFESALSIDLTGIIDPRLVHVLWGMSKDFGANGIRLGVII
FT                   SQANRDIHMALTGPSLYSYASGITDHLTALILEDFDFTTRYIQQNQKLLSESYAYTANY
FT                   LKEHGIEYATGCNAAFFVWMNLGKKYRELHPEDECENVGERIMQRLLQKKVFLASGFLF
FT                   GSEKDGWFRIVFTQGHDYLSVALERINAALEE"
FT   CDS_pept        join(complement(744974..745576),complement(744878..744928))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977854"
FT                   /orf_name="Pc20g03250"
FT                   /product="Putative uncharacterized protein Pc20g03250 "
FT                   /protein_id="CAP85654.1"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniParc:UPI0001831D5E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ6"
FT                   /transl_table=1
FT                   /translation="MSSLNITLRGHHTATRFPEQAMVYLTVESTGESEATVMCEVNSTT
FT                   NDLLRGLEIPPAIEEDGTISPIAVSDISFSNIYLTTKNRNAHDSKNVSDSPRIYDAVIT
FT                   IYVIFCDFNGLHRFIQKADKYPNARLNNVVWYLTDATKDDIGAESRKKAVRDAVTKASQ
FT                   YAEAVGFGDVIPVDIREIDESLNPSALPQKPTYRHPSGVVFEASCDIGSEARTE"
FT   CDS_pept        join(complement(746367..746418),complement(746265..746311),
FT                   complement(745826..746101))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000256797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128989"
FT                   /orf_name="Pc20g03260"
FT                   /product="Pc20g03260 protein"
FT                   /function="carbon-sulfur lyase activity"
FT                   /protein_id="CAP85655.1"
FT                   /db_xref="GO:0016846"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniParc:UPI0001831D5F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ7"
FT                   /transl_table=1
FT                   /translation="MALTGSCMCGGITYTVEADTYLSALCHCTDCQKFLTPLFHTGATK
FT                   NYDVVGNSGKINKHFFCPTCGSGLYTELEVMPDNTVIKAGTLDGGEANLKGKIDVEFYV
FT                   KDRPTYLAAVEGAKQEPMFG"
FT   CDS_pept        join(complement(748914..748969),complement(748699..748855),
FT                   complement(747097..748638))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000195659" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671926"
FT                   /orf_name="Pc20g03270"
FT                   /product="Pc20g03270 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85656.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI0001831D60"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ8"
FT                   /transl_table=1
FT                   /translation="MGRRKIEIKAIKDDRNRSVTFLKRKGGLFKKAHELAVLCSVDVAV
FT                   IIFGHNKKLYEYSSCDMHDALGRYQYFGPPHEHKGPEDFAGKRDDDDEEDEASPAPEDI
FT                   QAVQQNHPAIPPHLQSQPAFQHMNHAPSASPPIHHAMTRHGTPQPQGTSRPSSRNHIRR
FT                   VSSNLGPQQHGTPPPPPPPGPQNGGFTYMPNPSMYNPNVHAMNQQPRPAQFAHYGHPPG
FT                   QHQGTPPMHPHGLPQQMPPQHQGQQHFQHGHPVGMPPGPHQHVQQAYMQEHGRNSMPPG
FT                   FAPDHQERPASEHPQDDSVMKAEHSQSPPQIKSLSKSRSIFTPIDDRGSVLARHFGAGA
FT                   GSYESHNSHSLKVEAPQASIASKSMPVRAATEAPRAGSIASTPKIKPPSRTNSGPLPSK
FT                   RPQLKVQIPSETSDAGSATADSSHDSAVNKNSPPAKGNVENGPPGVVLPPPSPSAGAIL
FT                   SAGAQGPPNPFARPPPPVAATRNDSYGSNSGNPNNGNNSNNIETPISALPSRFVSDALL
FT                   PSPSSFFPEWGFGRSGPDSNMLPSPLTFPTPAVQSGPSFSREDEQDKKRKSPDSGSAGE
FT                   GAHKKPKT"
FT   CDS_pept        join(750664..750853,750927..751084,751148..751241,
FT                   751295..751523,751577..753951,753995..754086)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195648" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948866"
FT                   /orf_name="Pc20g03280"
FT                   /product="Pc20g03280 protein"
FT                   /protein_id="CAP85657.1"
FT                   /db_xref="InterPro:IPR012965"
FT                   /db_xref="UniParc:UPI0001831D61"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ9"
FT                   /transl_table=1
FT                   /translation="MSFFSRVFRGKDSTATKKQVKPTAPVNTAPAKPKWTDAWQRTEVA
FT                   PEEVQDLVRGCVHELKARALDTPFLLLPFRPSSDPSAARTFIRNYFNQSFEKGSPVNGD
FT                   ALSQELRLTEPMVVCGVMKWCWSRLPGGVVTWEAYETFKMGEHDSDMARDAFSTFIPIG
FT                   GDSEARTNIILDFFDLLAAIAAHGKSNGLGGRKLSRYAGWWAFEHVDTGNGFEAAYKNW
FT                   AAAADATSHLFFAYLRSLSPDVPGGVSGISSLPISLQSLVEATEYPPETPTLLQMTTTK
FT                   VVMIVENVSPTPFSLLRRAKNFEYRDDDWHLQEFANYEDPVSALTDECLRVLTCISSTN
FT                   QSSVSSTKQSTSLRDASWSRFEDIGFGGSIESDPEDEAKETAPPVTAKSGSAAGLKSVP
FT                   QSGTGDLGRPTTPSWADFMSSGFADENNLKQHVGPLLLPPDKVLPPIASARGMSSQSHK
FT                   RSLDIEPALEPAELASINTLDMDDSFWWVWISSLSGDEPSARKAVFGRCALLETRIRDT
FT                   KWLILEEQVKGAAPEPEAGAQIVEKKRFFSFGSRKGKLGRRKSSAKKVPSSIEDSYKRP
FT                   NNLGTQSKTSIGPDQHKRIQEAAAALQRKHREQEAEAKENRAAPNNSRYSKTNSVMTLQ
FT                   PAIVNEASQAMKWTKNYDKGAFRAAYLSDNRAGTGHIEEPEETPEPISKDPEEKPTAPL
FT                   APLPTNTAKSAPPPLPKEAAAAVSTPLPPFPKEVPTKPVNVATPEEEKPITKPAVVEQP
FT                   TERRESMDEMGKKLKKKTGNSAFKSMFSAKKKPEQQQPPVKNGDSKEISNVAATRAALE
FT                   AKAKAAQESGPVKKKPLPTAAAVAVTPVATEPEKPSSPQPVQPTINEPVTNPTSPTPPS
FT                   ASLKENGENGAPPKTRRAVEYDALSRVGTNERDAADQEFSKFDQGPLTDQPAFVPADSP
FT                   VEVTPAAQKPELPQTPTNGNGVRPVSATSPESTEATQDRWKAIREAAAQRTAAAQAEKA
FT                   HEHDTEANTRTSQSERTDEGDTSGEEIAFPAIEARVARIKARVAELTGNAEDGPRR"
FT   CDS_pept        join(complement(755551..755628),complement(755199..755436),
FT                   complement(754698..755089))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948867"
FT                   /orf_name="Pc20g03290"
FT                   /product="Pc20g03290 protein"
FT                   /protein_id="CAP85658.1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI0001831D62"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFR0"
FT                   /transl_table=1
FT                   /translation="MTPKVLVVLTSHDKLGSTGNPTGWYLPEFAHPWEVLHEKVSLTIA
FT                   SPKGGEAPLDPASVKMFESDEASQKFLKEQKALWTNTHKLADVLPRAGEFDAIFYVGGH
FT                   GPMFDLTEDPTSLALIQTFAAANKPVAAVCHGPCVLLNATAPSGVPLISGVGVTGFSNA
FT                   EEDAVSLSAAMPFMLETELGRVSGGKYVKAAEPWGEMVVVGKAAGTGSTIITGQNPGSA
FT                   TGVGKEILKALGL"
FT   CDS_pept        join(complement(757060..757493),complement(756311..756458))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948868"
FT                   /orf_name="Pc20g03300"
FT                   /product="Putative uncharacterized protein Pc20g03300 "
FT                   /protein_id="CAP85659.1"
FT                   /db_xref="UniParc:UPI0001831D63"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFR1"
FT                   /transl_table=1
FT                   /translation="MAYNSDVEEYLRLHQLFQLSGEELNYHPGTSATQPPVHSTEWSLY
FT                   NPSISHASESLDPSWSMHTTIGHPTADNLYQSTMQSSSTSQHRGTEDGIQDHFSPDRTT
FT                   IQIQSSRSSPPTQLASPSNYHNVEVADVEATSTRHEPQQQEKKDGSPTSPVPEFPISSR
FT                   VPDSKAVSSMPRYPCRDENALVYMYVQQNG"
FT   CDS_pept        join(complement(761217..761223),complement(760890..761134),
FT                   complement(760748..760814),complement(760623..760694),
FT                   complement(760380..760569),complement(760211..760323),
FT                   complement(759272..760158))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195637" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824635"
FT                   /orf_name="Pc20g03310"
FT                   /product="Pc20g03310 protein"
FT                   /protein_id="CAP85660.1"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0001831D64"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFR2"
FT                   /transl_table=1
FT                   /translation="MTYCTPYLLQLGLTKSKTSLVWIAGPLSGLIIQPLIGVIADRSRS
FT                   KWGRRRPFMVFGSLVVAFCLFVLGWTAEIVGLFVKDPEKAKNGTIALAVLSIYAVDFSI
FT                   NVVQACCRGLIVDTLPIPSQQAGSAWAGRMSAIGQLFAYVVGAIDTVSIFGTFLGDTQF
FT                   KQMTVIAALSLMLAVGVTSYSVKERVLISARDDGSAGAIQVLSQLFKTTFELPPRIQAI
FT                   CWAQFWAWIGWFPFLFYSTTWVGETYFRYEVPKDDMAKATDMLGEVGRVGSLSLTVFSF
FT                   ITVLSSVLLPFCIMQPDAKRTRFTARPPPKVAAILKAISAIRPDLQTAWLISHVMFAAT
FT                   MIFAPLAHSRAFATFLVAVCGIPWAISGWAPFAFMGVEINRLTMGGYYPTIPSSRSGVT
FT                   MITSASLRNSAADTELDVLRLNHHDPTDSDTDEEEQASNIPSTGELAGIYLGVLNVYTT
FT                   LPQFVGTFISWIVFSILEPGEEPANSNSDTQWMNLDKDRYNAISICLFIGAISALVAAE
FT                   ATRRLRYIL"
FT   CDS_pept        join(761455..761601,761656..761952)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977855"
FT                   /orf_name="Pc20g03320"
FT                   /product="Putative uncharacterized protein Pc20g03320 "
FT                   /protein_id="CAP85661.1"
FT                   /db_xref="UniParc:UPI0001831D65"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG20"
FT                   /transl_table=1
FT                   /translation="MEGVPAHLAACGILIIHVLACTQLSSHEPKPESERAGGLASNRSK
FT                   LKTPGLGYVRDWERGRQVSNPFGELSRVLFSEPSGELAGAETVHGTLGVRCLLAVRILG
FT                   GGCVGCDGGADGCLYSCREASKGILRGKTLSQSKKKERKSALA"
FT   sig_peptide     761455..761526
FT                   /db_xref="UniProtKB/TrEMBL:B6HG20 "
FT   mat_peptide     join(761527..761601,761656..761949)
FT                   /db_xref="UniProtKB/TrEMBL:B6HG20 "
FT   CDS_pept        join(complement(764445..764534),complement(764370..764390),
FT                   complement(763961..764311),complement(763694..763891),
FT                   complement(763555..763639),complement(762842..763498),
FT                   complement(762666..762778))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000046192" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128990"
FT                   /orf_name="Pc20g03330"
FT                   /product="Pc20g03330 protein"
FT                   /function="binding"
FT                   /function="glucose-6-phosphate dehydrogenase activity "
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85662.1"
FT                   /db_xref="GO:0004345"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="UniParc:UPI0001831D66"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG21"
FT                   /transl_table=1
FT                   /translation="MDMAFSTIELKDDTIIVVLGASGDLAKKKTFPALFGLFRNKFLPK
FT                   DIRIVGYARTKMDTDEYLKRVRSYIKVPTKEIEDQLDQFCKMCTYVSGQYDQDDSFINL
FT                   NKHLEEIENNRQSKEQNRVFYMALPPSVFTTVSDQLKRNCYPKSGLARIIVEKPFGKDL
FT                   QSSRDLQKALEPNWKEEEIFRIDHYLGKEMVKNILILRFGNEFFNATWNRRHIDNVQIT
FT                   FKEPFGTEGRGGYFDEFGIIRDVMQNHLLQVLTLLAMERPISFSSEDIRDEKVRVLRAM
FT                   DAIEPKNVIIGQYGRSLDGSKPGYLEDDTVPKESRCPTFCAMVAYIKNERWDGVPFILK
FT                   AGKALNEQKTEVRIQFKDVTSGIFKDIPRNELVIRVQPNESVYIKMNSKLPGLSMQTVV
FT                   TELDLTYRRRFSDLKIPEAYESLILDAFKGDHSNFVRDDELDASWRIFTPLLHYLDDNK
FT                   EIIPMEYPYGSRGPAVLDDFTASYGYKFSDAAGYQWPVTTSAPNRL"
FT   CDS_pept        join(766904..766928,767062..767071,767214..767267,
FT                   767332..767474,767572..767669)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948869"
FT                   /orf_name="Pc20g03340"
FT                   /product="Pc20g03340 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85663.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001780"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018266"
FT                   /db_xref="UniParc:UPI0001831D67"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG22"
FT                   /transl_table=1
FT                   /translation="MPSEQGHRLYVKGRHLSFQRSKHALTQNTSLVKIEGVDDTKAAKF
FT                   YLGKKVAFVYRAKREVRGSNIRVIWGKVTRPHGNSGVVRAKFRNNLPPKSLGATVRVML
FT                   YPSNI"
FT   CDS_pept        join(complement(768621..769349),complement(768554..768577),
FT                   complement(768446..768466))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948870"
FT                   /orf_name="Pc20g03350"
FT                   /product="Putative uncharacterized protein Pc20g03350 "
FT                   /protein_id="CAP85664.1"
FT                   /db_xref="UniParc:UPI0001831D68"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG23"
FT                   /transl_table=1
FT                   /translation="MAWSTRNSIIPESSFPWSDGELENWRTEYLKQPETLFMSPSPDPS
FT                   TTTRTPTARPPSYNYQQQLPSNQLPSAQFPSTPVALGTMLSPTPSSSYLDPSTIKRSIS
FT                   NHSPRSVPTQATATVLSPASLYDVRCPSPWDDLPVSTPIIKETLQSESDEVRTEPSQTK
FT                   MPCLTRRRTTKRKCVFCSLLKAIMSIRMLNICRLEKPRITELSNANGRTVNMTVCSRAK
FT                   VCSSGTFRHSISILGLSSVPGTIDSQGNVWSSDWI"
FT   CDS_pept        join(771693..771790,771850..772083,772143..773887,
FT                   773946..774676)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000031440" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977856"
FT                   /orf_name="Pc20g03360"
FT                   /product="Pc20g03360 protein"
FT                   /function="molybdenum ion binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP85665.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniParc:UPI0001831D69"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG24"
FT                   /transl_table=1
FT                   /translation="MDIGVRDGKVVGVRGRVSDRVNKGRLGPKGLHGWASINHADRLKH
FT                   PLIRRNGKLERASWDEAMSLIVDKAHEVQSRLSNHGIGFYTSGQLFLEEYYVLAMVGKA
FT                   GLNTLHMDGNTRLCTATAAASMRESFGSDGQPGSYSDIDYTDCLFLVGHNMAHTQTVLW
FT                   SRVLDRLQGPQPPKLIVVDPRRSDTAKQADVHLAPKNGTNVALLNGLQYLLFSNGWINE
FT                   DYVSKHVVGLEDLRTVVNRYTPDVVERITGVPVTQLHQAAEILGTTSSLLSTALQGVYQ
FT                   SNQATASACQINNINLLLGLIGKPGSGILQMNGQPTAQNNRETGCDGEYPGFRNFQNPT
FT                   HIQEIADIWNIEPVKVPHWNLPTHVENMLKYISDGSIKMFWISGTNPLVSLPHLQKVRE
FT                   LLTKPELFVVTQDIFLTETAAISDVVLPAAQWGEKTGCFTNADRTMHLSQKAVEPPGQS
FT                   KADMDIWLDFARRMDFQDKDGKPLIPFTSAEEVFNAWRKMSCGRPLDCTEMSYQKLAGG
FT                   SGIQWPCTSVYPQGKERLFDDAKFFTDTAYCESYGHDLETGAPFTKSQYEAMNPAGRAI
FT                   LKAAHYQLPLEETSEQYPLRLTTGRNVYQFHTRTKTGRSKRLQEAYPEPVIQVSIADAD
FT                   ALHLVDGEMVVVRSRRGSVELPVVIGDITEGHVFIPFHFGYFDATDDRARAANELTREQ
FT                   WDPVSKQPMFKSGAVRIEKCVQIEGGKTNHAKEKHTEAVRSVEKGKGMAEPADENGGHT
FT                   GNKEPVRRLELWMGALNEGLEILVEIYRDLVPRLVHDLEVQSGLEVMRRLTTEVLHQFK
FT                   PVIDRYHGSHQYGRTVAQYLQKAVFPAVEETNDPYEALAALQSLDLFLTYIEGHLTALS
FT                   PASQALWDSEFVNVISSAQGSIQRQKAWVNQHIKVKSPQTLLVPTVAAEDLYDSQSSMA
FT                   GRIRS"
FT   CDS_pept        775155..775934
FT                   /pseudo
FT                   /gene_family="HOG000217140" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(776150..777344),complement(776090..776103))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000280651" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128991"
FT                   /orf_name="Pc20g03380"
FT                   /product="Pc20g03380 protein"
FT                   /biological_process="Mo-molybdopterin cofactor biosynthetic
FT                   process"
FT                   /protein_id="CAP85667.1"
FT                   /db_xref="GO:0006777"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR020817"
FT                   /db_xref="UniParc:UPI0001831E4D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG25"
FT                   /transl_table=1
FT                   /translation="MALSYHEALRMVEAEAQRRARTLQLNMEKLPLNLSLNRVTGCEMR
FT                   SPISTPQYDTSAMDGYAVDSGATRDASPDNPILFHVEGLVAAGNEPFPLFNTASQSCSC
FT                   VEIMTGGRFPTAVEPDNVRLDCCVKFEDTKKVPGPYTGDEYIEITKPARYRQNRRSAGE
FT                   DFQRHHVIMPAGTIIRPHHIMALASVGITEIAVLPKLRVGLYSTGAELLASHGNQPVTG
FT                   RVEDANGPYIAAALADSGVDVEFLGILDDDVEMMMHTLRSNLEKKDCDLIISTGAVSTG
FT                   RFDLIPSALQRLGAHIVFHKIGIRPGHPVMFATVPNISPERSDEIPFFGLPGNPVASAA
FT                   CLRFLVMHYLKCLQSQLPETPLTARMSCPNDAKTARQSAHVITSFPSEKDVFRPGVFHS
FT                   LEK"
FT   CDS_pept        join(complement(778205..778671),complement(777936..778137))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948871"
FT                   /orf_name="Pc20g03390"
FT                   /product="Pc20g03390 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85668.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831E4E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG26"
FT                   /transl_table=1
FT                   /translation="MAGPPHHVPLSASGTPGQDESTRDLYLPYGYAAHQYPPSLAAEPS
FT                   TFSENHLLYNTLMQHSSAPVHLSYSMPFSSAHGTFNPASHNMAHHPSSENNTPSDPSTM
FT                   GYISSGYSTACTTPLGSGRSSPSMQEIPQSSVSRPEVPTICGRGRAHRPKHDELYGMYQ
FT                   CNWKDCKYRGMFSRKGVLMRHIETQHVAPHSFDCPVCGKLFCRRDNMTEHLGKVQCQRV
FT                   "
FT   CDS_pept        join(complement(780883..781218),complement(780588..780797),
FT                   complement(780306..780495),complement(780107..780235),
FT                   complement(779515..779618))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948872"
FT                   /orf_name="Pc20g03400"
FT                   /product="Putative uncharacterized protein Pc20g03400 "
FT                   /protein_id="CAP85669.1"
FT                   /db_xref="UniParc:UPI0001831E4F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG27"
FT                   /transl_table=1
FT                   /translation="MTASPPSTSGTSTSTCNPYGSFLRGILAEISAMRGLRISRYYAEP
FT                   GRGYTPSDKSGRDCGADQLVALRSWVTIQCISFPRTRLAVERWIRRGALLRMLKVARVS
FT                   IDFTVEDVRRIMAKTANTATSRTSPARLYELRTSYSYIPLPAREHTQIAFAVHKAIDKA
FT                   LARMGLDEATHDYLGVDIDQIGIQQDLHLWRYPRPSRPSRQNDLLNKHIVHPSIGNVGE
FT                   NLGLQAELQSGGSYFAAVFEDTARLSIGELRVRQGTSFIATRKEGELFYPAATGKELLK
FT                   YLGWGSPCTRSKEYGPYDQVIGRVVASAKVTGTKEIETARL"
FT   CDS_pept        join(781313..781391,781523..781635,781721..781895,
FT                   781971..782179,782310..782360,782425..782524,
FT                   782647..782905,783080..783266)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977857"
FT                   /orf_name="Pc20g03410"
FT                   /product="Putative uncharacterized protein Pc20g03410 "
FT                   /protein_id="CAP85670.1"
FT                   /db_xref="UniParc:UPI0001831E50"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG28"
FT                   /transl_table=1
FT                   /translation="MTYFSKCQNSLQYKQSAAAFPARAWVATTSSSLPLCLRHAGRPCG
FT                   SVDLGLNCAFSSIKAPASSVCLTNVCTTDNAINVKEANAHGPGAIVLQAACEDLPPSLD
FT                   AHAALTIATCVVAVNFLSGSFSTTAALIRWSRTAENNRIAHLFLVPTFPSRLIRRGSGL
FT                   VHRTGGRMLEVFNDVEKQASPISIDGRRSVFELALGGTRRWPDPSRALRRRTLRATVFL
FT                   SSPFTTLGRIDELQGFSHGSGQLVRETHSTWWGDPFSVVITGDRRREWCARAVQGARWI
FT                   YPGWVRIVTTRALSWSLGRLQLVECRSSLAWPAASAHWSQPSKIESPKLARMRISVSAA
FT                   PMQRMSPISSSVDWVPLFIHAELACFLYLRLGLHNEGYQSLEDAGTYGCD"
FT   CDS_pept        join(complement(784270..784272),complement(783889..784197))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824636"
FT                   /orf_name="Pc20g03420"
FT                   /product="Putative uncharacterized protein Pc20g03420 "
FT                   /protein_id="CAP85671.1"
FT                   /db_xref="UniParc:UPI0001831E51"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG29"
FT                   /transl_table=1
FT                   /translation="MFNYILHCPHSIYTSTKDAYSQWVSSRSSLVVPGDLAVNFDSEWA
FT                   KLSVESSHYPRLRAAEESARSWYTGVVAFRQDVRDLVDDFELGVAVGPFLQSHLANFP"
FT   CDS_pept        join(complement(787421..787651),complement(786956..787266),
FT                   complement(785678..786905))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160991" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948873"
FT                   /orf_name="Pc20g03430"
FT                   /product="Pc20g03430 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP85672.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831E52"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG30"
FT                   /transl_table=1
FT                   /translation="MTSERQQPDAASSNTEIDHANVEKPLDTPEQENEAAQPSDAENVP
FT                   EQPTEGAPLDQAPSQAAKMSKNKIIVVMTALCTIISTALPTIAAQFGASESGFSWIASS
FT                   YLLANAACIPLWGKISDIWGRKSIIVLANVVFLVGSLVCALAHNMTTIIAGRAVQGVGG
FT                   GGILILANISVSDLFSLRDRPMYYGLFGATWAVAGALGPVIGGAFTTNVTWRWCFYLNL
FT                   PVGGVSLLILILFLHIESPKTPFWAGMRCIDWTGTFLIIGGTLMFLFGLEFGGVNYPWD
FT                   SPTVICLIVFGVFTWALAMFLEWKVAKFPIIPPRLFNEWYNVLILLVCFCHGFTFIAAT
FT                   YYLPLYFQTVLQASPILSGVYVLPLVLSLAVGSMITGAVMKKTGRFREMIIGGMTLMAL
FT                   GFGLFIDLKVYASWPRIIIYQLIAGLGIGPNFQAPLVAFQANIRPADMATATATFGFVR
FT                   QLSTSMSVVLGTVIYQNIMGQQSAKLIASLGPETAAAISSSFGGSSKSLIESLTPSQRD
FT                   VVLGAYTHALNRMWIFYTATACLGFVLALFIRRRELTRHHTVQKTGLAEQERARQELID
FT                   SQRKANSKPETEA"
FT   CDS_pept        join(788016..788104,788308..788547,788606..788729,
FT                   788784..788885)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948874"
FT                   /orf_name="Pc20g03440"
FT                   /product="Putative uncharacterized protein Pc20g03440 "
FT                   /protein_id="CAP85673.1"
FT                   /db_xref="UniParc:UPI0001831E53"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG31"
FT                   /transl_table=1
FT                   /translation="MARAQYLGSYQPPLTSTLPTILSTQVAISPAWSSSSSREVRAAPL
FT                   VGFSSVVQLPLLRGLDSLAAGEVGGLLTAELLDCGSGGLQAKRGVAGELPQGLAYHHGT
FT                   ESTYHGGAHVRGAGEIGVETLCFALADKIYQYLPANEGLIGAKVDGNANVPQRANLHSS
FT                   REYAPFENKTFNGGAGSDANC"
FT   sig_peptide     join(788016..788104,788308..788317)
FT                   /db_xref="UniProtKB/TrEMBL:B6HG31 "
FT   mat_peptide     join(788318..788547,788606..788729,788784..788882)
FT                   /db_xref="UniProtKB/TrEMBL:B6HG31 "
FT   CDS_pept        789927..791600
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977858"
FT                   /orf_name="Pc20g03450"
FT                   /product="Pc20g03450 protein"
FT                   /protein_id="CAP85674.1"
FT                   /db_xref="UniParc:UPI0001831E54"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG32"
FT                   /transl_table=1
FT                   /translation="MVHIHDLPIELLHLILSFFVSPDELELLSGDQARKAKDGKAHQLD
FT                   DEEYDDDEPDGIETLYNTCLVSRKFREVAQPLLFRELFDDGLTGGLTPTVPFIRTIYRR
FT                   PDLGKHVHQISILPFPFVSGDRKHLSADDSEPFKGGIKDLGLGDQEEAWTSALEESDLG
FT                   ILAALLANKAPNLRGLHLPVRYFWIEPFIQLFHLNPQFLSNLESIWIESDDEMSGFDIA
FT                   FYEKFLTLPKVRFSTFEYGDLFDESFPSTWLPGTLETQELAFHHCHIDAGAIKKLMQAC
FT                   KKLRTFTYNNFSLDPNDRRIMRAGTVPEFDANQAHEAALVQKDTLELFHLEYAMELPDV
FT                   EHIEQLVSSHVKVGSFRDFSVLHTILIPHAALPVHPQLPSSLRRLHITDCNSSIRELTQ
FT                   NIAADCKNGLYPKLTHIKVFAIDITQPIKLPGQRIPEGKTPEQCFLALQDMFKGTKVNF
FT                   RILPYELPDFDDYDDLDLDYDEDLGFEEDFLEPGFEEHPPGADPGSGPIPPRLLDLLMQ
FT                   RAMMDPEFAHLRPDEGGDGDSWETDDDDDSWESDDSDSGN"
FT   CDS_pept        join(complement(793126..793166),complement(793042..793060),
FT                   complement(791981..792988))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948875"
FT                   /orf_name="Pc20g03460"
FT                   /product="Pc20g03460 protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAP85675.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0001831E55"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE4"
FT                   /transl_table=1
FT                   /translation="MAYNKSYNPDALPAHAEPEQVAQMLGNMNVSGQSHTSSHAPSHNQ
FT                   KPLPSRPPPQTSHSSGVPPRVPVSSAPPQHAYAAAPPRLDPQPHHSHSHSHSYGGRSSS
FT                   AHAPPPSQAPVHSQARPHPLHPSPPPQNYGFGPPPVHPQRNRPPPSSRPPQSPVPPPLT
FT                   APSDDPQQLFPLFRAANASHSGALTEGELGSALVNGDYTSFHPRTVRLMIRMFDRDGSG
FT                   TISFDEFVSLWRYLAAWRELFDRFDEDRSGRVSQPEFEKALVAFGYRLSGKFISVIFGV
FT                   FEGKAKQMSNAPKDARPPGMSFDLFVQACISLKRMTDVFKRYDEDRDGYITLSFEEALT
FT                   GKSCCSLCCCWGVSR"
FT   CDS_pept        join(793877..795150,795203..797138)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076711" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948876"
FT                   /orf_name="Pc20g03470"
FT                   /product="Pc20g03470 protein"
FT                   /protein_id="CAP85676.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001831E56"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE5"
FT                   /transl_table=1
FT                   /translation="MADPLSIASGVAGLLSLGVQVTKSLVDFYSAYKDQTPALAKITLN
FT                   LENLLGILQALDDARQHGQPQMDALVQEIDKAAVGCREIIEELSEECKKFQKDTALGLK
FT                   ARLQFVGRRATYPFRESTLKKLEEDIGEIRENLSLALNVLQLRNQTGLEYGISELKLLV
FT                   ERMNTIQISTTIRDWLRAPDATIDHNAACEKRHTSTGLWLVNGQKFQNWLVERNSFLWV
FT                   NGFAGCGKSVLCSTAIQYTVRERQHQPSVGIGFFYFSFNDESKRDCSGMLRALLLQLSA
FT                   QLQGAEGDIQELFKLYSSGTPPVKALLSSLRKTICRFNDTYILLDALDESPRGNKREGV
FT                   LDAVQTIRQWGLPTLHLLVTSRNEMDIRLTLEPPSSQDISMKNSDTDTDIQNFISYQLR
FT                   NDSKLRQWKSRHEEIQEKLTSKAQGVFRYVECQLLALKRARIRNHIDGCLRSLPRDLDE
FT                   TYERMLCSIDEQDAPEARLALTLLCVSDRPLTVEELIGALAIDVSKWQLDREGRSFSQD
FT                   HLLDICLGLIELAVVENEYSGEVSTIARIAHFSVQEYLKSDRISQQGAAKFAVQEELAE
FT                   TEMARVCLVYLLDPTLSDVESNEAMLEMFPLADFAAMEWSYFYKNSGKGKSDIKPLVLR
FT                   LFMDQPESFVTWVRVHDIDIGSPPMDLKRENIPPPLYYAIFLRLEFVFTAIIASFTEKI
FT                   TIDATLNTQEVVHEDVAQTMLDCRVGVNAQGGYYGNALQAASCGLFGDSVEEEDRQWEA
FT                   VEKMMQTLLDHGADVNAQGGIYGNALQAASYAGRERAVQTLLDHGADVNAYGGVYQTAL
FT                   QAASNPGHEALVRILLDRGADVNAREGTDASALEVASYYGHEKVVQILLDRGANINRDD
FT                   EYANALVFASYGGREKVVQMLLDRGSDVYVQEDLCKALEAASREGKEQVVQILLDRGAD
FT                   IDAQADGEYGNALQAASYAGQDKVVRMLLDRGADINTQGGDYGNALQAASWDGQEKVVQ
FT                   ILLDRGADVNAQGGGKYGNALQVASYMGHEKVVQILLHHGADVSAEGGENGNALRAALQ
FT                   EGHEKLVQILLDNGAKPEPIV"
FT   sig_peptide     793877..793948
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE5 "
FT   mat_peptide     join(793949..795150,795203..797135)
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE5 "
FT   CDS_pept        join(complement(797572..798452),complement(797383..797518))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178410" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948877"
FT                   /orf_name="Pc20g03480"
FT                   /product="Pc20g03480 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85677.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831E57"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE6"
FT                   /transl_table=1
FT                   /translation="MAGLLRLLKMQYTPPIDPKNVSFAGKIVILTGATSGLGFEAAIKI
FT                   LNLGVESLIIGSRSVEKGNKAKADLEKTTNRRNVVKVWELEMNSFQSVKGFAERVNRDL
FT                   DRVDIALLNAGLWNREYNQSPEGWEETLQVNTLSTSMLALLLLPKLKKSSYAENPAHLT
FT                   VVSSQQFVRVKPESVRTDDALLAHVNDPENFKGPKQYGISKLLLEYMMKHIANMVRDDD
FT                   GTHTLIVNTVSPGLCISALGRQYTHWWEKCCVWVLHRLFARSTEQGSRSLVSATLLGIE
FT                   SQGKCWRSEGYLDESAALTTGLEGEELQEKAWEEIISVLEVQAPEVSLISRGLYQGV"
FT   CDS_pept        complement(798923..801571)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948878"
FT                   /orf_name="Pc20g03490"
FT                   /product="Pc20g03490 protein"
FT                   /protein_id="CAP85678.1"
FT                   /db_xref="InterPro:IPR021840"
FT                   /db_xref="UniParc:UPI0001831E58"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE7"
FT                   /transl_table=1
FT                   /translation="MSIKIPSLSKLINLSCKRGDTPSQLQQIEPDIPGWQPSYLRRRVL
FT                   IIFVITFCGVIAALEALNHVSQVRNGLASSDESRHYLWTYGPTAIFTIIATLWSRVEFQ
FT                   VKQRAPWKSMAEKPGEAGESVLLDYLSEMQVISMAKAIRNRHFDVAAGIACSMLLRLLV
FT                   IFSTALFSLKKAQIHQSSATGQAIVDGNRIVMAQVSLRVIEVCLILGILLAVAMIFLGP
FT                   RTTIAPWNPTSILSVATIMAKSNEICRSLRGRGASPLDALHHSLKERRYYSQHTPKGFL
FT                   IETEGVDTRKFDTQENHILPWAPFPGLIARSVIFGAVALLIAALEIALRVSQKNDGLTN
FT                   VSSNVHQHCLFTIISSLVMLSIGLLFERVDFNTRTLAPYAQLKRPTGALFEESMAVNYL
FT                   DSIPTTNIIRSIRARHFAVLATTSATLITSFLVITASGLYSAMEVPYQISVNFTQESTF
FT                   FRANSADAGQIPSMAVAKHILRKNMTFPRWTYDELAFPKLSMDMPLSNNERESLFVDIR
FT                   TPALRAAPACYFQTGSELRWNFTKVSYGDEPTYQLRVLAPNMPCSLAYQDMGSTSLTPS
FT                   LAVLNSQGLFGQSSRLPCGNIYNTKPATLYIWGNIQNDSAENISAMTCVEAAETVDTLT
FT                   RFYLPGFDIIDEHPPIPDESSTRSAPDIDIPWISWNNFNTKDATAKRSNLDAFFTALIM
FT                   GKYAISAEHLLDPDSSDMVIKAINHQDRILKAQAFNTYFRSAADGTLDHAPLPGNITMS
FT                   NRLRLLQDAASTRILQALLTSILVLGVVGSIVMNTDHILPKNPSSIGAVGSLLADSNLL
FT                   ARYEKGMGDPNEQSLGPASFSRCRFYLGFQGNASHQEIRGSCRKTTVVRSTVYTIRSEV
FT                   VRRCWATGRCG"
FT   CDS_pept        join(802415..802509,802588..802619,802726..802775,
FT                   802866..802870,802948..803032,803086..803613)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000264264" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948879"
FT                   /orf_name="Pc20g03500"
FT                   /product="Pc20g03500 protein"
FT                   /protein_id="CAP85679.1"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="UniParc:UPI0001831E59"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE8"
FT                   /transl_table=1
FT                   /translation="MAAIAQGHKVHPDGRTWKSHFPKGDLWVFGYGSLIWKPPPHYDQR
FT                   IPGYISGYVRRFWQASTDHRGTPEQPGRVVTVIERTFWETLDDPIAHLESELSSTGKVW
FT                   GAAYHIPASHAEEVHDYLDEREIDGYSAHYTPFHPTVDVEGAGDSTGSSPIICMVYIGQ
FT                   PTNPQFLRDAAHREPQHVAQVISAGHGLSGKGSEYLFMLEKGLEGLGLGTADVHVTDLV
FT                   KRVKAIEAELAEAEEEEAEIKVTRSLEIPAEEVDRDGRETIE"
FT   CDS_pept        join(complement(805295..805378),complement(805122..805228),
FT                   complement(804799..805063))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671927"
FT                   /orf_name="Pc20g03510"
FT                   /product="Pc20g03510 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP85680.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001831E5A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE9"
FT                   /transl_table=1
FT                   /translation="MDFSGLSWHTSDDTLREGFQQFGEIQEAIVVKDRATQRSRGFGFV
FT                   RFATDAEADAALGAMNNQEFDGRVIRVDKAFDRPQRSEGGFQGRGGYNSQPQSSYQGGA
FT                   GGYAGYNNGGYNNGAAGGYGGGYNRGYNNYAPSGPAGYGAGGPGGYG"
FT   CDS_pept        join(806736..806768,806830..807354,807404..808984)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948880"
FT                   /orf_name="Pc20g03520"
FT                   /product="Pc20g03520 protein"
FT                   /protein_id="CAP85681.1"
FT                   /db_xref="UniParc:UPI0001831117"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF0"
FT                   /transl_table=1
FT                   /translation="MVAPSLAVTEFERPSRRVQGTFLMESNNPIYQWLSTVEDQRQSML
FT                   SKRLRSLRANRALAENQEQVKDTALATGIPRIHIPLETSDDLRANGHSASRKRDSRHLK
FT                   ETKASSTHDTIPGSEGHKRSRNCYELRPRYKTREDRYEYKGPSSAVETQSQSRKGRAKK
FT                   PRGRRHTMNDDFRAINVTGNRLTLRSNTNLGIFNKGRSSSVANQRGNTPTGLAKPASVT
FT                   RSQMYVTESDLAFSEMNFLSRRNNLNHPISTVRETLDGQHEREYHPQVQFDDPAHDCNL
FT                   GTSHSIHKLVDVKCKLDDSAMPLFAFEEAPASEISPVFGHSRSASPMPPNKRRKISKQS
FT                   SSIPYTWTETEIDDTEQSDALEQHLLNLLHVGVYPQALCSEIKNTVLTGQYWSLAELWE
FT                   LLKERKASWSNEAGRQIRASPEASTGQLAAVDASLQEVREVIAPGHSDVPSAGSVQNEM
FT                   SKQSADSNVACETACSVNSPPKQSSGLEQQQDRPHEASDKPGPPSLQAARTSNSPDRFI
FT                   DTLNEDQGEPSHQESAEDAVHFPASVPDVEHPHMSDIEFYELGRVDDDDVFYRTLDAAY
FT                   CAIVSPEVAAEVASDLQELLESPELNGNDLPNTPESTNIREPDIPTGQAEVAEPEYLVK
FT                   VSQDIIQNRYDGRPSEPSCQRKLSTSHLNDPCVDQNNELPWVATGYGQTQPRASTGIDA
FT                   GQAKPPGLSGFWRQNRLY"
FT   CDS_pept        join(complement(809925..810198),complement(809751..809803))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824637"
FT                   /orf_name="Pc20g03530"
FT                   /product="Pc20g03530 protein"
FT                   /protein_id="CAP85682.1"
FT                   /db_xref="UniParc:UPI0001831118"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF1"
FT                   /transl_table=1
FT                   /translation="MSFPSPDSSNPSFSMSAYMVPSRQNSYSESDDELASLPSESTNDS
FT                   DLETLSEYSSDAEAEWQESIEQLELLLTMVLVPFIGKYLGRRCAYWNPAAFKAAGVVEA
FT                   AASL"
FT   CDS_pept        join(810839..811464,811529..811826)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000107197" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824638"
FT                   /orf_name="Pc20g03540"
FT                   /product="Pc20g03540 protein"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAP85683.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniParc:UPI0001831119"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF2"
FT                   /transl_table=1
FT                   /translation="MDTNGQVTDAPPAEKPTGGMQYLSDPSLNPPVAFATAPLTMSEYT
FT                   EKEVDEVTEMFKGLSKKKKPSKKSKTADAGDDEEAPAADGEFDPSALKKKKKSSSKSKK
FT                   ADATDFDAKLAEAGIAEEAGEEKPEEIPEGDLEAGTGIWAHDATQTIPYSLLVSRFFSL
FT                   IESHHPDLLATGAKSYKIPPPQCLREGNRRTIFANIADICKRMKRSEEHCTQFLFAELG
FT                   TSGSVDGSRRLVIKGRFQQKGIESVLRRYIVEYVTCKTCRSPDTELNKGENRLYFVTCN
FT                   SCGSRRSVAAIKTGFRSQIGRRKRVG"
FT   CDS_pept        join(complement(813652..813678),complement(813078..813597),
FT                   complement(812642..812991),complement(812361..812579))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195692" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824639"
FT                   /orf_name="Pc20g03550"
FT                   /product="Pc20g03550 protein"
FT                   /protein_id="CAP85684.1"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="UniParc:UPI000183111A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF3"
FT                   /transl_table=1
FT                   /translation="MNIPLRLCLLRRLRHVVTIPSIGSKAILMRRVAFSPPHQPYFAPP
FT                   PRQTPPSNGDHPVPQSSISPPAMSPPTNKQGYAMAEYPAPTTASPPPPDQIAEQNQAAF
FT                   LQNQALSRLSISSRPPQTVTMEKMPGGAPAYGQFVGTHSTYQDDVGVFNGGSYRISHRD
FT                   TNSLLTLQLAVGCPLTVRPGAMIAMSPTITLRGHVSFSFKKLIIGGSMTTSQYTGPGEV
FT                   LLAPPMLGDIVVLPIDTGEAWNAGRDSFLAHTSGVHHLYQSQGLSKGFFSGEGFFVYEF
FT                   TGHGLLWLQSFGAIVKKDLREGESYFVDNGHLVAWKCAYEIERPASGGLLSSFSSGEGL
FT                   ACRFKGPGTVYLQTRNLKAFATQMKVTSSYL"
FT   CDS_pept        join(complement(818097..818189),complement(817454..818032),
FT                   complement(814603..817419))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234561" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948881"
FT                   /orf_name="Pc20g03560"
FT                   /product="Pc20g03560 protein"
FT                   /protein_id="CAP85685.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000183111B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF4"
FT                   /transl_table=1
FT                   /translation="MLSILFFISLFPFVKADDDWDDFTNNLATDLAPLITLFGERLTKQ
FT                   FLSESISILDNVIFALSPLGVLTAVVSVIRICGSSSLRAFVGRAQEGPAEAESELLPCV
FT                   SESTAELFNDGGITRVFGRPKIVEIVAWQDVNHKTGEKETKIGTLKDALEEKAWSCNNK
FT                   VLPTELPELDIPNLSLNKGIKRRDQFWFHCAAILGGVLQTGRCFSSFEPEITLTIHLRY
FT                   HYHFKKDDKAVASYAFPLYLIGTTLLFLGMFFCAFIMERSSKEFYLKAEKPSKIYWLQP
FT                   GNQDVGDQVFNAFLAVNEGPESSMTKKLRYTKSIRDRRFDRKYLEIYSTLTSTVLGFIF
FT                   QFIGLRGLHASVILAQLGSTFIMSIIRTCLRTERMAPDENKMKDDRDLMGHKQQELDAF
FT                   AFYLENVEYFNMVLLPDRPATIPSPRFVPHVDAPLARQLIRTRTQLANLTSNPNQSSSA
FT                   TWDDMPIRRMAHNLAQTIESTMDLISGWGVDLGKTFEFRLGFECRGASPGSVTQSPGTY
FT                   SIGLMRCGDALRWKMEASEIEAILGLWTWSLYKSGDDCKSSRLFRLVGLSEEEASKKET
FT                   YLYFHKWIFRQTEARLVPSDLIDDSRRLFGFEPKEGLPLGNLLVIKTENEVETMAAQDI
FT                   FIQFLKEVCLNVKELGGEVDVVSGIQNSLLGSCTRIDELVSCFEAHSLGSREDALLCIV
FT                   PVLRNRNLLPDLAADCAKVRARREQLISQGKWKNAFDLLRWLCERSEGPQFQRSVYELG
FT                   YLCLRALLNNSETVRKEGFAQVCKLLNSDIREEFLQTQKILLPSDWSMSQDRIEWWRSF
FT                   SSELGWTAWSISEEVPGMSFMEPALKSLNVPQSLPGVIGTGQDLQATEDAMRSMQDWLT
FT                   LRDLVNAGFRRLREEEDNRLCFEWAVENNYHCLLYFLLLKWVELNDRIPFLITIAYTLA
FT                   ATKHSHLATQTLLRQGTNIDATDVQGHTALFNQAAVGHVEGIVMLLDNGADPNGSNEAP
FT                   NARPLIAAVYGGHLMAVALLLQYGADANMTDQHGMSALLWAMASDYIDIVELLLSSGAE
FT                   TESVMSDGSTALIWASTDKSLPILELLIKHGADINAQDTDGKTALMRAVSRERSLPVLR
FT                   VLLDKGADVHMEDDKGRTALDMARKANFHEAVAILKSSDRNSLASWLPDLTSRSP"
FT   mat_peptide     join(complement(818097..818141),complement(817454..818032),
FT                   complement(814606..817419))
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF4 "
FT   sig_peptide     complement(818142..818189)
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF4 "
FT   CDS_pept        join(819423..819485,819548..819980,820032..820256,
FT                   820310..820365)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977859"
FT                   /orf_name="Pc20g03570"
FT                   /product="Pc20g03570 protein"
FT                   /protein_id="CAP85686.1"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI000183111C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF5"
FT                   /transl_table=1
FT                   /translation="MAASSEFASAMTTRSLRMVRTELEFLADASVITPQQLSSILSQLP
FT                   TDSETSRAVYTSPSPPRQQAQPAPAQHVPVQAQPPPAPYTPSYSPPVSQMNNVSINEKA
FT                   FMHNQHVPVQAQPPQAPPAYPQVPPVLGLASAMYAYTPTDAGDLALQPQDRIQIIEHMN
FT                   DDWWRGRNERTGQEGIFPRSYVNVVNEKAGISSPPPTNYGNMPLAVSQSGQPEDPNDPK
FT                   KNKFEEGGKKFGKKLGNAAIFGAGATVGSNIVNSIF"
FT   CDS_pept        join(822108..822263,822325..822633)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977860"
FT                   /orf_name="Pc20g03580"
FT                   /product="Pc20g03580 protein"
FT                   /function="sequence-specific DNA binding"
FT                   /protein_id="CAP85687.1"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013729"
FT                   /db_xref="UniParc:UPI000183111D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF6"
FT                   /transl_table=1
FT                   /translation="MSDWESTTKIGSKFRGAGAQPRETVVKGKSALNAAQRSGSVYTEK
FT                   KYTTGNLSAKAGAPEGQHLTKVDRSDDIVKPKTVGHAVADAIKRRRTEEGYKMTQKELA
FT                   TKCNTTITIVQDFERGTATPDQKVLGSMERVLNIKLRGSDIGSEKFPKKK"
FT   CDS_pept        join(complement(824634..824660),complement(824061..824567),
FT                   complement(823890..824006),complement(823660..823836),
FT                   complement(823416..823598))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231322" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948882"
FT                   /orf_name="Pc20g03590"
FT                   /product="Pc20g03590 protein"
FT                   /protein_id="CAP85688.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000183111E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF7"
FT                   /transl_table=1
FT                   /translation="MRPILLSGHERSLTQIKFNSDGDLLFSVSKDKIVCAWWSANGERL
FT                   GTYNGHQGAVWTVDVSPNTILLATGSADNTVRLWNVKTGECVKVWEFSTAVKRVSFSPD
FT                   GNRLLAVTEKRMGFNGTIAVLDISYGENLSAQAAEPTLTIVCEESKATVAGWSFLSKYI
FT                   IAGHEDGSVSQYDPKSGDQLENVQIHEFDSQITDIQFAPDRLSFITASKDKSAKLLSSR
FT                   NLAILKTYISDTPLNTASVTPKKEFVILGGGQAAMDVTTTSARQGKFEARFYHKVFEDE
FT                   CGRVRGHFGPLNTIDVHPAGTAYASGGEDGYVRVHHFDKSYFDFMYEVEREQARK"
FT   CDS_pept        join(825426..825549,825619..825639,825694..825731,
FT                   825784..828311,828366..828474)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000040280" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948883"
FT                   /orf_name="Pc20g03600"
FT                   /product="Pc20g03600 protein"
FT                   /function="ATP binding"
FT                   /function="formate-tetrahydrofolate ligase activity "
FT                   /function="methenyltetrahydrofolate cyclohydrolase activity"
FT                   /function="methylenetetrahydrofolate dehydrogenase (NADP+)
FT                   activity"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /biological_process="one-carbon metabolic process "
FT                   /protein_id="CAP85689.1"
FT                   /db_xref="GO:0004329"
FT                   /db_xref="GO:0004477"
FT                   /db_xref="GO:0004488"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="UniParc:UPI000183111F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF8"
FT                   /transl_table=1
FT                   /translation="MAAAKIDGTAIAKSIRQGLKSEIEQIQVNNPRFKPNLVIFQVGSR
FT                   SDSSTYVRMKLKAAQEANIICTLINVPESSTELELIQEITKANYDPAIHGILVQLPLPS
FT                   HMSEHAITSTVADEKDVDGFGAINIGELAKRGGRPLFTPCTPLAVMELLKASGVDPAGK
FT                   EAVVLGRSDIVGSPVSYLLKNADATVTVCHSKTPDIARVVKTADIVVAAIGQTELVKGD
FT                   WLKPGAVVIDVGINYKPDATKKSGERLVGDVDFESASQVASQITPVPGGVGPMTVAMLL
FT                   KNVVHSAKGYFEKQKDRHVTPLPLRLQTPVPSDIAISRAQYPKPITQIATEVGIAPHEL
FT                   EPYGHTKAKINLSVLDRLAHRRNGRYILVAGITPTPLGEGKSTTTLGLTQALGAHLNRI
FT                   SFANVRQPSQGPTFGIKGGAAGGGYSQVIPMDEFNLHLTGDIHAITAANNLLAAAIETR
FT                   MFHESTQKDAALYKRLVPASKGKREFKPIMFRRLKKLGIEKTNPDDLTEEEITRFARLD
FT                   IDPETITWRRVLDVNDRHLRGITVGQADTEKGLSRETGFDISVASECMAILALSNDLED
FT                   MRERLGRMVVATSRNGDPVTCDDIGAGGALAALMKDAIKPNMMQSLEGTPVMVHAGPFA
FT                   NISIGASSAIADKLALKLAGTEPDEDHEAKTGFVVTEAGFDFTMGGERFFNIKCRSSGL
FT                   VPDTVVIVATVRALKVHGGGPEIKPGAPLQEVYRTENVDVLRQGCVNLRKHIANAKQYG
FT                   VPVVVAINKFETDTDAEIAVIREEAIAAGAEDAVPANHWAEGGAGAVDLAKAVMTASSK
FT                   EKHFQLLYGLDGTIQERIERIGQAMYGAEKVEFSELAQKKVDTYTKQGFSNLPICIAKT
FT                   QYSLSHDPALKGAPTGFTVPIRDVRLAVGAGYLYALAADIQTIPGLPTAPGYLNVDIDT
FT                   ETGDIDGLF"
FT   CDS_pept        join(829341..829622,829840..829875,830004..830187,
FT                   830251..830287,830340..830836,830891..831315)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000019858" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948884"
FT                   /orf_name="Pc20g03610"
FT                   /product="Isocitrate dehydrogenase "
FT                   /EC_number="1.1.1.42"
FT                   /function="NAD+ or NADH binding"
FT                   /function="isocitrate dehydrogenase (NADP+) activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="isocitrate metabolic process "
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="CAP85690.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004450"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0006102"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI0001831120"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF9"
FT                   /transl_table=1
FT                   /translation="MNALRSSSAVARRSLATPPAPLSSTSRLISSSSFTSSLSKRSISS
FT                   TSLSQRTNRVAASSRWSGSIPSSITQIRTMASETKIKVKNPVVELDGDEMTRIIWQEIR
FT                   EKLILPYLDIDLKYYDLGIEYRDETNDQVTIDAAEAIKKYGVGVKCATITPDEARVEEF
FT                   KLKKMWLSPNGTIRNILGGTVFREPIVIPRIPRLVPGWTKPIIIGRHAFGDQYRAQDRV
FT                   IPGPGKLELVYTPAGGEPERVQVFDFQGGGVTQCQYNTDESIAGFAHSSFKMALMKGLP
FT                   LYMSTKNTILKKYDGRFKDIFEEIFQKDYKKDFDAKNIWYEHRLIDDMVAQMIKSEGGF
FT                   VMALKNYDGDVQSDIVAQGFGSLGLMTSALATPDGSAYESEAAHGTVTRHYREHQKGNE
FT                   TSTNPIASIFAWTRGLVQRGQLDNTPEVVTFAEELERACVDVVNDEAIMTKDLALACGR
FT                   KDRESWVTTGEYMAAVERRLKANLKARL"
FT   CDS_pept        join(832471..832518,832606..832642,832705..832772,
FT                   832840..833222,833282..833349,833415..833932)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824640"
FT                   /orf_name="Pc20g03620"
FT                   /product="Pc20g03620 protein"
FT                   /protein_id="CAP85691.1"
FT                   /db_xref="UniParc:UPI0001831121"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGG0"
FT                   /transl_table=1
FT                   /translation="MVKAPGLDDLIISCALICDLAFYACIILERKYGIGIHSSKLSEYD
FT                   LQNQLFWLWLSVPFYNMTMIFAKLSALTLFARLFRPRPFLLATYIIMGALVIIGLWTTL
FT                   SGFFFCVPVNAFWDPSEDVRLANCLPAAPVWFTNAALQTSTDLVILVMPMPLLWKLQLP
FT                   KRQKWGILVVFSLGIFIIGTSSARLYPLSIMVGGGDFLEENAQAALWSSLEANVSIICI
FT                   SLPPLHPLLSRIFSFCFLPRPIQSRASKRRSSRTQMTEPLNRDGGIWCNELFTPGPASY
FT                   CTSISKVNTNEEDHENEEGIRVKRELRMQSDTLPTPDIEPHSANGVHLDMGEGAVAARS
FT                   HTAPENPRSNSSVERDFVDFEFPDYREKMNAPI"
FT   CDS_pept        join(complement(835775..836204),complement(835327..835663),
FT                   complement(834970..835241),complement(834731..834906),
FT                   complement(834399..834681),complement(834204..834343))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158126" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671928"
FT                   /orf_name="Pc20g03630"
FT                   /product="Pc20g03630 protein"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="CAP85692.1"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR015830"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="UniParc:UPI0001831122"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS6"
FT                   /transl_table=1
FT                   /translation="MATSYQDRCAQKRADQLSLIPPEWRLDPVPSIESAPNALAYLRRI
FT                   LSPEELALTEETDIAVLLRKLSSGELSSLKLTRVFAKRAALAHQLTACCTEIFFEQAFA
FT                   VAQGLDDYLAKTGKTVGPLHGLPVSIKDLFSVEGVDTSIGWVGLTNNPAKADKSVARML
FT                   RRLGAVLYVKTNLPQSMMMSDSYNHVFGQCVNPFNRELISGGSSGGEGSLVAGRGSVLG
FT                   IGTDLGGSIRIPAALCGLYGLSPSPGRHPYERGNPGQDIVRSVAGPMACNLATIERYME
FT                   VLPEARPWEVDQHVAPVGWRKELASPGAKRLRIGFLVDDGVVKVQPPIARAMREVIEAL
FT                   KAAGHDVFEWDASSHSYAYELWAKAIFSDGGEGCRRQIEKTGEPLIEGMLVGKPEDTLT
FT                   TSQTHQLNADKYNFESAYLDRWVSSDIDALIMPNTAWVGYKPWTWVKSSAYVGYTSIWN
FT                   FLGYAALAVPVTTASRTKDVPDKEWLAHVPRNDSDRFNKQQYDVNLVEGMPVGIQVVGG
FT                   RFGEEKCVAVAKAIEQAMQGKITSRARL"
FT   CDS_pept        complement(836348..837574)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948885"
FT                   /orf_name="Pc20g03640"
FT                   /product="Pc20g03640 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85693.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831123"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS7"
FT                   /transl_table=1
FT                   /translation="MKGKKPRGIRHDRDCGRCKVRGIKCDLNRPRCQACLQGGEACNYP
FT                   QRVVWVDDKKPKRPKGTSPQIHNAETPNVEAYKSASINLYGFIDLLDAFCQQIQSSSRD
FT                   IPEEGIQLISRTLSFARSRVQDANNKESLQSHLVALTNLSQVIQSAHPIALFGIATFAM
FT                   FEVCCGSFGNWHCHLQGARSLLDLHCQHKADLDDLCGEISGLADVLAYLVWFDVTGALV
FT                   RESPLIFEDWHRETLSAGFFGSVGCPTDTFDLFVYLAKHRDSNGIRAMELSARALAQIL
FT                   QLNAGDTTDRNLATTVYRGAAAIMAFSRAGMATGGDPSASTYHCNVVSSMVDRACDAIA
FT                   EIPSTSRFYVHLATPAYLIGMSASTARQCEIIRGYWRNCQSCEFPRYPDAEAQCDRRWR
FT                   ICGVGFSVG"
FT   CDS_pept        join(complement(838224..839439),complement(837959..838089))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948886"
FT                   /orf_name="Pc20g03650"
FT                   /product="Pc20g03650 protein"
FT                   /protein_id="CAP85694.1"
FT                   /db_xref="UniParc:UPI00018311F9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS8"
FT                   /transl_table=1
FT                   /translation="MQYPTPVPVFVQTSHPPPPTFLARPRPKFCILRPGGFWTPLIPLD
FT                   ELPSWLEICNWAPDMYMGMYPASMTFMPREGEYDVVCHHCSHGVDSLHQSVSEREASSV
FT                   TASNAASSKDCHEQHASPNAQHHDTVSLPAVLHRDSPNHFLEQPPFSAILQTPFVGMCV
FT                   VDVNSQYPDIAPDQAGPKRRMSLENSIPPQVFGAVGVGSPPLSVANSANARRPDTPYPH
FT                   AHGPGSFAKPQRVASLQNESVASMKSGSVASTRSLTVAAIEQMKRMRRRRLSRGSSLHA
FT                   SISVPEAKSLSQVSDSKISKVSKVSKNSKISKLSRISRVSGVSKISSIRVISKHSPKVV
FT                   LRRRRAEERKARKSAQAVTSMEKPEQVNSATKRRDRRERMMQRRRQSDRGKQPYANMMR
FT                   IPNWSPDRCLSFILFMLGLAMSSVIPDCPFLRLVILLFSADVRLVIVSR"
FT   CDS_pept        join(840356..840499,840580..841464)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948887"
FT                   /orf_name="Pc20g03660"
FT                   /product="Pc20g03660 protein"
FT                   /protein_id="CAP85695.1"
FT                   /db_xref="UniParc:UPI00018311FA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS9"
FT                   /transl_table=1
FT                   /translation="MGEWGQSKERGFTWIVLTCCVLLRGLTLRLRSASKTSEGLSKMGR
FT                   EKHLHTSKLYLILSYQHFQAIGPDATTSDVQLWQPSVAHNFSSDSYLLIFISPSTSFLQ
FT                   IFKNLPGNLESVMTTLTDPTNATRATPNVPIEKATLHIGSSTFISAPSQEVWAALVNTS
FT                   TWPSWNAFVPRVTIRSQPTPDPSPSTSAPDPTPTPAPAPASTTQSSNKNLSPILQKGTK
FT                   FTFHVRMDPTSTKPQPSTDVHLLISEFRAPNADTGEVGRIVWCADPDAPGALSPSLLTA
FT                   ERVHEITAVEGGTEVRNWEAQVGWLVYVVRWMYKAKLQANFEMWVADLKGFVEGGSKTG
FT                   SS"
FT   sig_peptide     840356..840436
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS9 "
FT   mat_peptide     join(840437..840499,840580..841461)
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS9 "
FT   CDS_pept        join(complement(843101..843368),complement(842917..842977),
FT                   complement(842611..842854),complement(842280..842508),
FT                   complement(842064..842209))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000187520" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128992"
FT                   /orf_name="Pc20g03670"
FT                   /product="Pc20g03670 protein"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85696.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="UniParc:UPI00018311FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT0"
FT                   /transl_table=1
FT                   /translation="MASFLPQTHEQPRPLEGQNGGIRRRFQVESTPFAGRIGANQEFSV
FT                   SPLEEAELLRKTPDAAPLVPWSQMICPNQFIQLNIWKAAFVEGVVTCLLVYFTCFLAVG
FT                   LGKMAGHLATGPVVPSLIGGLLNTLTLPLFIFAAGPVSGGHVNPTITMATFFARLSTFP
FT                   RSILYISFQLLGATVAGYLLRGSFDTRSFVIPGCVIDTSVVSVGSAFTIEVTTDFMLIF
FT                   LSFSVGLDPRQREVFGPALGPVFVGIILGITSFGTGYSQVGYTGFGGNPARCFGAMVGS
FT                   HFTSYHWIHWLGPIVASILHGIMYYFIPPYQYCV"
FT   CDS_pept        844585..844896
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948888"
FT                   /orf_name="Pc20g03680"
FT                   /product="Pc20g03680 protein"
FT                   /protein_id="CAP85697.1"
FT                   /db_xref="UniParc:UPI00018311FC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT1"
FT                   /transl_table=1
FT                   /translation="MSIATGENETGGRSATVGQLETHGLTPAEKHYWATELEISCLVWV
FT                   VRKIRHMVEAAPDDLTPVAYTDHIATINLATSLSSASPDRMNLRLVRASQYLQQTGTS"
FT   CDS_pept        complement(845718..846896)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195760" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671929"
FT                   /orf_name="Pc20g03690"
FT                   /product="Pc20g03690 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85698.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00018311FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT2"
FT                   /transl_table=1
FT                   /translation="MANPPVQLSLQTTQGKSPSTQVPSSLTPPVTPIAKERPPRSTPSP
FT                   IQDPKAAQTPSTSKDNVGTLQFTDDLEICHDENNRSLEFGRGVWSIVYKARSFPHPQTN
FT                   PPGTPPSSPTSRSQVLAVKAPLRRDARPVLNAEASTLTRLTFTQGHEQYIVPFHGYHAP
FT                   LGALVMSAIPTSLASYIEDQSKQARTHHTTATMFDPVQGPASYQDLARRLITGLNWLHQ
FT                   VAAVVHGDIKPHNILLRPIDTDDCVEAPAFPFQPLYADFSATVDIPVHAEARDTTRASM
FT                   SSFTPPFTAPEMLASLTSTEMAPTPASDVFSLAATLLAIATGDLLLYPNMNHRLRLEMA
FT                   RAGHQIVDFARSGVSGSRVPRNGFVERIVKPAVVKDPAMRITTPEWVQLASC"
FT   CDS_pept        complement(847788..849698)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195771" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977861"
FT                   /orf_name="Pc20g03700"
FT                   /product="Pc20g03700 protein"
FT                   /function="rRNA (adenine-N6,N6-)-dimethyltransferase
FT                   activity"
FT                   /protein_id="CAP85699.1"
FT                   /db_xref="GO:0000179"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="UniParc:UPI00018311FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT3"
FT                   /transl_table=1
FT                   /translation="MPKIATARTPLARFPLTKKLHPLISRQVGKNRARTQYVSEGLIGK
FT                   SRDPNLIMATNLLLDPADNVLERVSPYLRRNQPLDILDLWPGGGLISSKVNELLQPRRH
FT                   VLVEPDPRFNDFLQPLAQSNPCYKLVDEPIYGKFDWSYFFATHLPEQGRGNQENSAIIP
FT                   KNDSLLILANLPAARSGMDHFKPSRWFLNYMKNCLKQKDVNLYGAVRVLATMPSSEVSD
FT                   MLPRSAMERTRTGVFAETIGLHNIEVASPAEEERSHQWRGWNDLNKTRERVAETAAANN
FT                   IITPPTRELPPLEVVPHVPYRTSRVERPYQPRVLTQMHKKQLMDIAEADKLGLDSCSDT
FT                   TDPKAKAIIRKRALAWTKLARDNSATYFRQQLVDVILEQDQVGWTFARAAADPEESVES
FT                   LKAIEDRMVSLKSSYATLKSSIHHTMLEKHQHAIDDVRLGRLANHFVDVGLTHEQRPYE
FT                   PLYIHPDETYPRGDGRAVIYFEPDSNPPSLKKTFDLPSTTVQLVLDRYLAMLAVVGTRG
FT                   TMPVAEFLKTLFPTESINSHVRDIPSLASFAERRLKPGRGPMPLPEGSTSDPAFTYQDN
FT                   VDYDLSDVRLRTLSAATLLDIAVKYEKLPEKLGIIAFSRALGGTMTQAQIGEELLNMRL
FT                   R"
FT   CDS_pept        join(850049..850195,850276..851769)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195792" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977862"
FT                   /orf_name="Pc20g03710"
FT                   /product="Pc20g03710 protein"
FT                   /protein_id="CAP85700.1"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI00018311FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT4"
FT                   /transl_table=1
FT                   /translation="MPSNATGGATGATAPQSVENITRIAQNYEYNSSVPLRYWLRTATT
FT                   LLREARIYEREGHDEQAYLILFRHAQLILVHLSKHPDTKKNEEDRKALVAAEKEVEKNL
FT                   SKLEILRPRINKRYERYTQLMRERESRKQPSRTKIVAEPREQVADPALAGVAEPLEAGE
FT                   NRDLAVQLAQSELNRRATVRDSKSLSGPSAEELETRRAAGVWGDWDHSIKSESRAGDRD
FT                   LGQRVQDISSKPDHTDGPYGQRAKEPVVPSSATSTYNYPTVPRQRPLEPAVSPGNIAIL
FT                   DKNVERQAPPILPPKEHLEPSRASIVNDSATDLAPARPAKVLPGPALPEKIRPSEQATA
FT                   TRSDLDPSSYTFKPSAYLENGTPLRSVFLPANLRSRFLSLVAPNTRANLETCGILCGTL
FT                   VSNALFISKLVIPEQTSTSDTCETVNESALFDYCDSEDLMTLGWIHTHPSQTCFMSSRD
FT                   LHTHCGYQVMLPESIAIVCAPSKSPDWGVFRLTDPPGLKSVLNCHQTGLFHPHAEENIY
FT                   TGALRPGHVFEVSGLEFETVDLRPGSLKN"
FT   CDS_pept        join(852281..853272,853328..853472)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195803" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948889"
FT                   /orf_name="Pc20g03720"
FT                   /product="Pc20g03720 protein"
FT                   /protein_id="CAP85701.1"
FT                   /db_xref="InterPro:IPR006571"
FT                   /db_xref="UniParc:UPI0001831200"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT5"
FT                   /transl_table=1
FT                   /translation="MSSTSENIPSDTPTSSTSTGSASQPTEKPPYQSASYFSYPVTHVV
FT                   SGLYRRITDPDLAKEMPSVMPWSRSSSSSEVFTPRRTASPFQPPPLTPLTLEIPTGADL
FT                   LQQRLLTRALAEEIRLLVPPRLQLAETWRLAYSLDRDGASLSTLYENCAQFSHRSPRAG
FT                   YVLVIRDSSPSSSVFGAYMTDAPHPDSQFYGTGECFLWRASVLPPPASFPLVLPGEGPQ
FT                   SEEALERAGLPPPPSADTTTAGRWSTLRNDKSKPPRAESPAHNLNMNIKTNLAAASGGV
FT                   LAPPSPSSIHTPSRSGASTPERIRFKAFPYSGVNDYMIFCETGFLSLGGGDGHYGLWLD
FT                   SSLEKGVSASCQTFGNEPLSDEGVKFDVLGVEVWYVGS"
FT   CDS_pept        join(complement(855209..857125),complement(854456..855142))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000180546" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824641"
FT                   /orf_name="Pc20g03730"
FT                   /product="Pc20g03730 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAP85702.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI0001831201"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT6"
FT                   /transl_table=1
FT                   /translation="MAGSAEFGGPPRQLRPDQVPLLLNTIDKLRSIGVGEHVELPQMII
FT                   CGSKANAKRSVIESISRIRFPVRKDFHNGFVTEITLRRHATTRFQVSVEPGPSSSKSQL
FT                   DIQELKGSMVTAPNAEQSVSLIEKATGFVKPSLEDGFSEDVMRVELSGPDQPNLTLIDI
FT                   PRLYFTEGIDDENKDKCAGHLQIEKYVRNPRTIILAVVSAKIDICAQKINDFADKYDRG
FT                   RSRILGIITHLDTLEESSDEEKLWQMAVKEEISQQPLGLHLVWTRSSESRDVPDEQRDQ
FT                   KEKEFLERGDWKTVPRESVGTDNLRSRLSTLFVNHVQSSLPRLISEINQRTRKIQSNMS
FT                   KLRTPRETIHQQKALLVNLGSDFHRITSQALTGMYIDDFFDTRVDDDQPTTRDPRRLRA
FT                   MIRALNEDFADVMDIAGCRQFIHGVNNQVTSLLNPCNPYANIRQPVHKSRMEFELDVLE
FT                   IMCRDRGLEFPGNINQLVLANLFRDQSEPWADIARAHVKKSWETIREFVSLLMDHLADE
FT                   HMSAVIIRTVIQPQLDRMHASLLGKVLELTAANKRGHALPLSRSFLRGHPLPLDRSFLA
FT                   RMQKSRNDRVLAHLQQSLPSSLPSNFSTTYNMGEIRAATQSMESSSNPFVASDLIDQFQ
FT                   AYYNNALGVFTDNITTLGIENCLLDPLNDLLTTRKITEMEDSQIEDLFAGVQNGVEDQG
FT                   HDPGDELKLLQTAVRVLDQFKIAPSTGAIKSPGLSSAHGRSSLQPYLIPQGIICNGASA
FT                   NPFGVLCVDSRVQGQNNTPRYQISWPYSQAPDMQNSTTPCPSGPFGLNPGTMNPGTVSV
FT                   PSVSAPTVNAAPTSGVPGFAGPTPPLPQTVTSSPFCSLRAGPDLFGTPDTSSHDA"
FT   CDS_pept        <858080..>858541
FT                   /pseudo
FT                   /gene_family="HOG000078714" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(860040..860188,860249..860510)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948890"
FT                   /orf_name="Pc20g03750"
FT                   /product="Putative uncharacterized protein Pc20g03750 "
FT                   /protein_id="CAP85704.1"
FT                   /db_xref="UniParc:UPI0001831202"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT8"
FT                   /transl_table=1
FT                   /translation="MDFVDDNDKVLGKAEVVSNYFGLSSLNALPKHLMGRIVSIATSST
FT                   SLVKRSPRVSRETAMSFLRTFRGLVNFVHLVFSSCPLSIAIHPSTLPGSIEAHLVGNLK
FT                   AKLLIGMDVMGHEAFRLDLDAKKTTELLMYGH"
FT   CDS_pept        join(complement(862786..863698),complement(862307..862733),
FT                   complement(861967..862255),complement(861458..861907))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234989" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128993"
FT                   /orf_name="Pc20g03760"
FT                   /product="Pc20g03760 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85705.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831203"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT9"
FT                   /transl_table=1
FT                   /translation="MSAPTTRRNRALASCEPCRERKSRCDHGKPICASCQRRGLDSRCY
FT                   YHPAPLSKNRSARRPTMLTLPRSTLATPSWSRNNTKGCQAHPGRSAAGPPKFHTWPFMS
FT                   TVSDTLPQTPTPGSHDSKAYEAHLATMKEIVSQLRYLPVIEKCLHQYYSFKHNALVPKP
FT                   VVLQILDTLRTDLVSSGHILGEKGEQVELGDISEISETVLLSSSTEVIITPSLDLHGFC
FT                   ALFCGANLRVETIGLLYTMAARASVFFVDRDEDKDGAFVQDMVWYSTLALRLARDLAPQ
FT                   STDVIIWLANENAELRSFLEGDASLGVWRLVGDLTTDLLALGLNREATYSPERTPFFLA
FT                   ECRRRCFVTEYYLEKMFGLVFNLPPRITSRYVDVKLPLDLSDDEIFAQTPEELEEAKDR
FT                   LTEDGWNTDGKLRAATYARLRYILSQFREGIVEYHFQASQAADPAQLRDLSSQCRQTWD
FT                   NLLPHLRYTQDCWESDMPFTTCYMHAKIHLAYLQIHFQIYHLLGEDSSSPLPELLDVSA
FT                   NILETVVQMGISRRKGAFTFNDLPLILLSCGLPSAAVLSTALENITQDPSRVLPPGIKT
FT                   PAVIRNLSVLASQLDSVASSRERNQAFCLQAAKAITEKLDKILDKFATSKFQATPDVAT
FT                   STDVSPMSVLATDVDSPLDDGAGEIGAINLDDYDNFDLMSWAIDFDLGNTASDWTMM"
FT   CDS_pept        join(complement(865022..865032),complement(864279..864903))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824642"
FT                   /orf_name="Pc20g03770"
FT                   /product="Pc20g03770 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP85706.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001831204"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGU0"
FT                   /transl_table=1
FT                   /translation="MASNTINNEVHDMTIVRGTVDTVPAVLHLLDTAVQWLVSHDRTGQ
FT                   WGAAPFSENPQRTEQLREFATTGHGLWLAIKVANNTPILCQNRISNIKPQTMNGEAPGV
FT                   IVGALALGERTPYVTPVSEPELYVRLLVTDRQCAGNQIGKRLLDHARDLASKAGVSLLR
FT                   VDCYAGGDGKLVQYYESQGFKRFESLDVEGKWPCQVLAQWLDEIEGES"
FT   CDS_pept        865620..868388
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076742" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948891"
FT                   /orf_name="Pc20g03780"
FT                   /product="Pc20g03780 protein"
FT                   /protein_id="CAP85707.1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniParc:UPI0001831205"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGU1"
FT                   /transl_table=1
FT                   /translation="MEHDLLFIVDASTYRSCYLRSLTASLPEIISFSTQTRCFTRIGVL
FT                   ACYGYNCDNVLEWSGWLNKGEQRHSQEKQPDLVAFAKRLRANRNTESKSAIKTALAKAC
FT                   EVMRSNTKTLILLYTDKCPIPNVHYPGKFCSGSMEKAALLAPESYSRYGFACIDWVSAC
FT                   NTLRDGPKQAQVFTILHKFVEEANAAWYIYLSTRTDGACVQLRSDLKGDIAKVIVDLLL
FT                   SWMEVEKGPSSVKEAQEDCLADLLRYISVTEIDSIENEQDKSTFPYFDTGKWIYLYGNE
FT                   NISKVRLTTDVMKEYVPKKTAPMPDLAEEITSIINSVPDTEMYPCAFLDPTLDFSHKWH
FT                   DYAHDGTNRPVSHMTRSELLQIGRSCNPGVLRRFGAILTRMTVISSAREIPDHISSADP
FT                   DPVVKIPLVLIKEKYNRQFWKVLLHTVEPGTKLPARSAALLAALSLRMGIVPLMKVAEQ
FT                   EMLAFKDKWNDPSIPQTWTLGCLTLLIGSDEAHQKQQEMSLTDNRSRILHPTDRTLFDR
FT                   LVTFKRLEQRTCVQLRARVRRIADKTIAPVGPLVTCRECQYPQSVTLMGSNGKCGLCLD
FT                   SYVDKERKNMYTDATSTAIWVECSSRSCRAQYVVHNPNGLRMSRPAKCYYCRSQGSQDN
FT                   SPDHVKQDESPAPTVQCTLCLNRIIWPEEYRASFKEWDFICPLCTSGYELTTTLEVTPQ
FT                   ELFTENKFSWFIQDANGLEVCLQNGSNFYRSESIFQIITRLGSEGFLSRIRLFPSPEPE
FT                   LRYHGKPIHNSKQLVSTLQKLVADDKTSDNKCSLCFDQCGKVYPACGRDGCPQRMCFTC
FT                   VERWHKCNSAGCVINTEMLGCPFCRRYPTPRLLAKYGMLIHSVKDIGKAVRDKRKFIYA
FT                   WCLECATAKVVMERSCMPEKPLELTGWICDECLLEIFRKSSVDVSTVIEDT"
FT   CDS_pept        join(complement(871291..871309),complement(869626..871178),
FT                   complement(868750..869577))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195804" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824643"
FT                   /orf_name="Pc20g03790"
FT                   /product="Pc20g03790 protein"
FT                   /protein_id="CAP85708.1"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR013863"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00018312D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGU2"
FT                   /transl_table=1
FT                   /translation="MFMLRNVSKFLFGDASKESIIEIPQGELYLVRPQSPKGYSELIFK
FT                   DAAATIRRTGQDFQYQLVIQRAYEEGEEELADDDGEQGAGDGLDKDEKVFLLDQTLHFR
FT                   SEVRDGGAKILAWDDLSGDAGDLFEFICDSSVPSDKVATFELAALQCQYERKHRRSAQK
FT                   ATEAELEEFSYNEEKPIPSASPVSSPTRNSLTAEDSAAAMAKDVEYAQSKGKVKTATLE
FT                   EEPTTAPPSAAHPEAKEILCKENAELHLFDFSTGTFVLQESDIVATVSEVGTWQYWLQI
FT                   SGKDKEWLGQAVVADINPVFNFEYLSFIFNHYGEDGSAYSWLLRFKDQASEERFQEGLM
FT                   QALWEQLNEVKWTKVKENDRDYVLDAFQDLTMEDADEPQEEVEEEEEETYDGDQDDAQR
FT                   SEHYDSDEEEEDVVTRDADGNVNSQLAVGYKHDRSFVVRGSKIGVFKHTAHNNLEFSTT
FT                   ISKVETPKGNLFSPKKVMLHAEDQNMILQNGDDPNSLYKMDLEYGKIVDEWKVHDDIPV
FT                   ETFAPENNSQKFAQMTAAQPFVGVSKNALYRIDPRLSGNKLVDSDLKQYASKNDFSAMA
FT                   TTEKGYLAVASNKGDIRMFDRLGINAKTHIPALGEPIIGLDVSADGRWVLATCRTYLLL
FT                   IDSLQKEGKNEGKLGFERAFAKDSKPQPRRLGLQPAHVAQFQHETKQPLSFTTARFNTG
FT                   IDSTETSIVTSTGPFIITWSMKKVIANRKDPYTIKRYGENVMADNFRFGSDKNVIVALP
FT                   NEVNMVAKRTFQKPTRESIAGPATPKRARSGWSSRLGKDDIVNSPY"
FT   CDS_pept        complement(871924..873156)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195825" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671930"
FT                   /orf_name="Pc20g03800"
FT                   /product="Pc20g03800 protein"
FT                   /protein_id="CAP85709.1"
FT                   /db_xref="InterPro:IPR007356"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="UniParc:UPI00018312D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGU3"
FT                   /transl_table=1
FT                   /translation="MEEQERPRKLAKLDHDEDTTNEVLGPAMTGAGDVAGKEPEPASAQ
FT                   IGNEPLDLTEFTVQKDTKTDNEPTTQDGAEAAAPVMSKNQMKKLRRAEAHQQKRALQKA
FT                   QKKEKIIEKRERRKAMIEEARAKGDEEAVNKLRALWRGKKAKHIKSTLIPLTFVMDCGY
FT                   DELMSDRERISLAGQLTRSYSDNSRAPYSGHMMFSSFDKLLKERFDTILTSHKNWKRVR
FT                   FLQEDFVRAGELAKEDMAAPRGGQLAGPFAEQTDAKPEDGEIIYLSSDSENTLTELKPY
FT                   STYIVGALVDKNRYKAVCYKQAVAKGIKTAKLPIGQYIQMAHRPVLATNHVIEIMLQWL
FT                   ELRDWGKAFMKVIPTRKGGALKGTQGEDEDDAENGDEDVNEEDMEAEQMEQLEEIAALE
FT                   EGSEDENAEKR"
FT   CDS_pept        join(873379..873429,873525..873604,873760..873912,
FT                   873986..874034)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195836" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948892"
FT                   /orf_name="Pc20g03810"
FT                   /product="Pc20g03810 protein"
FT                   /protein_id="CAP85710.1"
FT                   /db_xref="InterPro:IPR009346"
FT                   /db_xref="UniParc:UPI00018312DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGU4"
FT                   /transl_table=1
FT                   /translation="MPQDMPPTGGYAQVQYKRNIPARGFKPAYYMIGMHVIMAYGFYNE
FT                   LAREKMWSRLHLTPLLQAEEDRDQVRRHYADKAREKELLGTDAKVYNSDRFIRPTFAYT
FT                   PANLTQ"
FT   CDS_pept        join(complement(877307..878795),complement(877128..877252),
FT                   complement(877006..877077),complement(876726..876950),
FT                   complement(876566..876669),complement(876248..876506),
FT                   complement(876048..876190),complement(875396..875991),
FT                   complement(874638..875323))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195837" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948893"
FT                   /orf_name="Pc20g03820"
FT                   /product="Pc20g03820 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85711.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018312DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGU5"
FT                   /transl_table=1
FT                   /translation="MAAEELSEGGMADIIRALQLIHNPASSNDIRKEASQFVENLKESD
FT                   AAARNGFLLASRMEHEPVVRYFGLTLLDHVLRQYNFTNPEEAKNLRMMILQLAENVRPE
FT                   DPAYFRNKISQLWTEAAKKTWGLDWMDMDANLVQFWGASLVHKELVLAVLETLSEDVFF
FT                   REDTASSLRGGELNRSLVEIFTPAGIVEQITGDKTTATIPRCGQEGWLVRICEFLDNCV
FT                   QNVSSSEQARDAATKALATLRSALSWSVYKGVIASQVVPSIFRALPCQDDQVLLSAVEA
FT                   LHALYGRNTIGSEDSQELVCLIFQPVYLVVLQRLYEWSIVGPDDVDEPKYLISKKLSEM
FT                   ISYIAGCLEDDKFLVSTMDRLNLPPFLQFMVNIMQHQSLTVSIPCLHLWSRLLQNSKIS
FT                   NLDFVVEQTPQFLNICTQRLLRWESLPTESEDPTVQFLVEDIDTVPERHAFVGNYRRYC
FT                   SSIIETITFKRPQEAVREILARVDTNLDNLYNGVQPFSMATFSKSSIPLMRADAQFAVV
FT                   EAVIKGYNKWISAHGKAPQRDESKRMELEHAVENWASTLMQKSFEDPVLKQRVIKLVVD
FT                   ISSKALDNHQGFALKVLEHILMSRLPDRSEYPLYSEAVKELHGLASSELRRLAMRYADY
FT                   FYTFYDLLEPKIKEITLANRIDDKLQMELTSILLIIMQRAINADPYLRQNRLASFLQPI
FT                   QEAWQDDQFRHSSSTFPGFCNMLGLENVGPYMQSKEAQKLADWSEVALDNEGRLVQEEM
FT                   TRKFQLLPLRGTKTMLAVSTDRVKKSSPAYATACQMWHELIPIILPTLLQLVRNAHAFH
FT                   NPANWNMVEGMQPVVERILTDRFWQAGISIGSRDEFYARITSSKSTLEGFASSVRGKVR
FT                   AVREACYSMLFSMSRMREHFYGFAELPGPLSEALFVDSPHLSSHQFSVLLNISRCLIDD
FT                   CPVQFRSQFLPPMLSTLFTNIDRKVTTEWEIIEQRRNGISDGDLTTEMKSESVLRQLTY
FT                   SAVIMVASLFDPQRGDPDGTESDPTAPQPTPNLSDSIRHFVLSSPQIFEPVMLFCTHAL
FT                   RMRDTRSGSIITRVIRSILQDFAPTNDTPDTPTIATIREFICTDVLTACISSVHESYFV
FT                   DMQKDLAQLIASIWCLYGFCSETPRAVFLSLPGISAEKVASTESALHQTTSPRQQRALV
FT                   LELLEPLRGISVAEQGKILGSREERRKARSALQERYMTNEMDTQQQNHRVDINDGPDLG
FT                   GVADLFG"
FT   CDS_pept        complement(878843..879157)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824644"
FT                   /orf_name="Pc20g03830"
FT                   /product="Putative uncharacterized protein Pc20g03830 "
FT                   /protein_id="CAP85712.1"
FT                   /db_xref="UniParc:UPI00018312DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH53"
FT                   /transl_table=1
FT                   /translation="MGERCALVDLWGKFSARQVTNCLLQVFPFEILLRQLPSLQKYRFI
FT                   TPSPLLNLEPPSPRKERVARADGRCGVRLLNYHRTSSTAIESYLPFPDYATRPTTVIRD
FT                   "
FT   CDS_pept        join(complement(881595..881978),complement(880284..881534),
FT                   complement(879583..880221))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948894"
FT                   /orf_name="Pc20g03840"
FT                   /product="Pc20g03840 protein"
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85713.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00018312DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH54"
FT                   /transl_table=1
FT                   /translation="MAPLHLKVEGQTFRDPHNREITLRGINVAADAKYPKTPDVPSYIA
FT                   ENFFDADNVSFVERPFSLEDAHIHFKRLRKWGYNTIRYIFTWEAIEHAGPGVYDHEWVA
FT                   YTIEVLRIAKQYDFWVFMDPHQDVWSRLSGGSGAPMWTLYAAGLNPRTFKDTEAALVQN
FT                   TYDIPAEFPKMIWSTNYTRLVCQTMFTLFWAGRDFAPKAIIDGMNIQDYLQDHFINACA
FT                   FLARRIHEAGDLGEVIIGWESMNEPHRGLVGVQDISVIPPEQQLQLGTSPTAFQAMLTG
FT                   SGKACEQTTWAFGNFGPYKTGTNLVDPAGVIAWLPADQSFNDNQYGWQRDPGWKLGECI
FT                   WAQHGVWDPSTDVLLQKDYFSKKPTGEPLDYEKFTNSYFLDHYRAYKNAIRRIWPDAIM
FT                   FCQPPVMEVPPDIKGTTDDDPNMVHAVHFYDGLTLLTKHWNRLYNVDVIGVLRGKYLTP
FT                   AFALKVGETAIRNCLRDQLKFLRDESRNYMGSHPVVFTEIGIPYDMDDKYAYKTGDYSS
FT                   QTSAMDANHFALEGSTSNGFTLWVYVTQNDHEWGDQWNGEDLSIYSRDDLDLPAGSSTR
FT                   PLDPNSPAFSESQSSGAEAEPNVGPRNLKGVLSTPSISSERSQIPLRQQQGYRAAEAYL
FT                   RPSPTYVSGKLDSHVFDLKNCVFTLSLTAKGATTATAPTEIYLPDFHFPESNIVVTVSG
FT                   GKWDIDVQDIQGAKLQRLRWWHAEGEQDIKIEGLKRKPGEFGNPGGQDVGYLEQCQKGE
FT                   CVMM"
FT   CDS_pept        join(882494..882609,882666..882866,882916..886891)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195859" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948895"
FT                   /orf_name="Pc20g03850"
FT                   /product="Pc20g03850 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85714.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00018312DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH55"
FT                   /transl_table=1
FT                   /translation="MSGKAALKAVRAALESKDFQVAAEKAKELVKNEPNNYHANVFLGL
FT                   ASDRLNKNNDAENAYFAATAINPNDKTAWQGLVSLYEKQGGCQHDGYHNAVIALGMIFA
FT                   ENDEKERCQDLINKYTKSMKSKGTPTQHKHALELQIPGSPLYDFLEGRLPRPSQTYQRL
FT                   IEITERQEREFINREIGERRTRLGARIEQVTQEVRKEAASKSGLDQYYQGMIDWTNDDA
FT                   VRRHYEEKLFQRAYEELGFLPNAAKEEKRAAVFKAAHDMVIIKHPFEPAWKVYLGWLDV
FT                   KDLSQYDVGHLREYIEFFPESGLSQVLKGFLLSDLSPFPRDPSDETQGKDAKDSKETAA
FT                   TQADNEVDDDAPAPQDPFALMVEGLNSARDSILAHRIMAYVYLSFEEYGSVVTVARKGL
FT                   LYVETLVKYSGVEIPNTIDALNNALANALIYYQSPRHHTDAKQIFEGILERNPTSSNCL
FT                   LGIGLILEEDQDYAEAVDFLRRSLERDPSNLKIRGELAWCEALNGDLEGGLASLQATLD
FT                   DLLEAQPDNREFKSELFYRIGYCQWELDPSPTARKDRSGAYASLLASIQTNMNFAPAYT
FT                   ILGFYYADYKKDKARARRCFHKAFELSTSEIEAAERLARDFADSKEWDLVEAIAQRVVD
FT                   SGKARPSPGSKRRGFSWPYAALGSVQVNKQQYSKSIVSFQAALRLAATDYHSWVGLAES
FT                   YHHSGRYNAATKAFEQAKLLEPELSAKDKEHIWFARYMLANVRRELGQYDEAIAAYEDV
FT                   LKSRPDDIGVTLALLQTLTESSTKSLGLGLFNDAADLACQAISVATSLAQNRSDIFNLW
FT                   KAVGDVFSNFSYMKAKAVKLSASSCKTLLAIDLDPMALDVMTDIDGVGTDCLAGNESEE
FT                   SMPSELHVHLPIIAFKRALHVTMHDAHSQAIAWHNLGWAEYLAHRTAQPDLTKKGKKSR
FT                   KFLKAAMRCFKRAIELEAGNPDFWNSLGVVTATMSPKVSQHAFVRSLHLNERNGQVWAN
FT                   LGALYLLHGESYQSYKIFMRAQATDPDYSLAWVGQGFVSLSVGETQEAKGYFEHAFDIS
FT                   NSSDILTKRQFSLAYFDHLTEASSDMSELIQPSFALHQLCIQEPSNLPFVHLSALLAER
FT                   MGETADAESSLQVVCSDMEDEFEKTESPDSLSRYAQANADMARVLLARQSYEEAAEKSE
FT                   LALTLSGEEDAEKFDPEACKKLRLSAHLTAGLAFYNLKSMDKAIDMFRDALEEAGNAPD
FT                   VVCLLAQVLWAKGGEENRSVAREQLLDCVMSNPTHVGAVTLLGAIALLDVDRDAIEAVE
FT                   SDLNSMVSRDDISLHDRAKIIKLLSAISAMGLKDNAALPESIRRMGDATAAVMLTPGQP
FT                   ASWMELSAASQNPYPSAMTIKRALRSVPPYGKLGAEDLSRAYSHTGKVGDALRAIMIAP
FT                   WKRNGWEELTHNVPTPNMWTRSTGHGPE"
FT   CDS_pept        complement(887144..887878)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948896"
FT                   /orf_name="Pc20g03860"
FT                   /product="Pc20g03860 protein"
FT                   /protein_id="CAP85715.1"
FT                   /db_xref="InterPro:IPR013894"
FT                   /db_xref="UniParc:UPI00018312DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH56"
FT                   /transl_table=1
FT                   /translation="MTSPDQIAAQILSTKSLPVSQTWLNAFLSSSSTAQRNIPASALAK
FT                   SAIFRLLASDIRESLSKHRSYVLPVDIHNPAVQERRLQGSIPVQVLDIEDIGTSLWSQI
FT                   EAIERVERGEAIRGREIVRTIAIGEDPEASENNRANNNPANGAASASGNSGYGPHRLIL
FT                   QDAAGTMVMGIEMQRIDGIALEKLAIGAKLLLRNPSVARGMLLLSPESVTLLGGKIEAL
FT                   DKPWREGRKARLLEKTAGVERE"
FT   CDS_pept        888053..888934
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195881" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824645"
FT                   /orf_name="Pc20g03870"
FT                   /product="Pc20g03870 protein"
FT                   /protein_id="CAP85716.1"
FT                   /db_xref="InterPro:IPR014812"
FT                   /db_xref="UniParc:UPI00018312E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH57"
FT                   /transl_table=1
FT                   /translation="MSTISSPRPSIASSRAHSPGPTSSRPSLDVLNTNVSGGLSAASTP
FT                   STARALSPSLHPRRNRSALRDYYNLKPPGADSSASRDVSRSRSVPRNTDAGDISDPTAL
FT                   TAGTELDSADFDPQRYVEHLLSTSSLATVLKAENTLVGDIRTLDGERKALVYDNYSKLI
FT                   RAVETIGKMRRSMDDRSAPLTMTKTLGPAIAFVAETAGGLIKEGEEQRRQMKEAKAEDE
FT                   ASSQKNEKDTVRWVLATPQRLEKLVAEDKQEDAEKDWKEIQHLLDVWGDVKGVAEIREA
FT                   CEKVMNRASHDD"
FT   CDS_pept        complement(889336..890294)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671931"
FT                   /orf_name="Pc20g03880"
FT                   /product="Pc20g03880 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP85717.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniParc:UPI00018312E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH58"
FT                   /transl_table=1
FT                   /translation="MPPIRSRSSKESTKXEGRILLAIKAFKNKEIFLIRETTRRFKIPR
FT                   STLSSRLTRIXHRANYRVNSCKLIEIEEESLXKXILSIDSXGLAPRLSIVREIANLLLK
FT                   KRGTTPVLSVGENXVTKYIKRHPLLSSRFSKRYNYERAKYKDLKVIKDXFDLIXKTILQ
FT                   FRIYPDNVYNFNKTGFTIGLIATTKVITRSEYYSRRALLXPRNREXVIAIECTNTASXA
FT                   LLLYLIFKGKVFIKSXFDSLPSDXRFEVSPNSXTTNEIRLRXLKKLFIPTTFIRIKGVY
FT                   RLLILDSYRSYLIPRFNKIYKKNRVILIYIPPYLSYLLQPLDIGYFIVLKRTYRRLVKF
FT                   RIRYGSNYIDKLDFLDSYPTARIEAFKLEIVKNSFXSTGLVPFALERVISKLNIRLTTL
FT                   TPPPSRGSDWDLKIPLNYRQLEKXASSIKALLRTRLGSPLSPLNSAINQVLKAYXITMQ
FT                   SATLLEREVSDLRSETEKKKQKRARSRKYLYAESGLSVXEASALIIQPVEVAEPGPGXH
FT                   SESGLQPRIKPPRGCGVCRKPGHRREICPDR"
FT   CDS_pept        join(complement(892561..892781),complement(892374..892507),
FT                   complement(892023..892295),complement(891715..891925),
FT                   complement(891535..891655),complement(891321..891476),
FT                   complement(891164..891262))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000132894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671932"
FT                   /orf_name="Pc20g03890"
FT                   /product="Pc20g03890 protein"
FT                   /function="epoxide hydrolase activity"
FT                   /biological_process="response to toxin"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85718.1"
FT                   /db_xref="GO:0004301"
FT                   /db_xref="GO:0009636"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="UniParc:UPI00018312E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH59"
FT                   /transl_table=1
FT                   /translation="MSLPFSTPPSKATASLTPFKATIPQAKLDELETLIKIAKIAPRTY
FT                   ENSQTDHRYGVSTDWLVTMRDRWLKSYNWKSSEDRINSFPQYTTEIEGLTIHFVGLFSK
FT                   RKDAIPLLLLHGWPGSFLEFLPILQRFRDEYTPETLPYHLIVPSLPGYAFSSGPPLDRD
FT                   FGTGDVARVLDQLMKDIGFESGYVVQRGDIGSRIARHLGVDHESCKGQECQYKPVNVVF
FT                   MRKPDGMTDDHLNAFEIEGIERMTKFMTTGAGYAMEHGTRPSTIGHVLSSSPIALLAWI
FT                   GEKFLEWADDPIAPDDILESVTLYWLTETFPRAIYAYRQNYPPPPIPASNDPSWYIHKP
FT                   FGFSSFPMELARLPRSWIETTGDLVFWEQHQKGGHFAALERPDELKADLVKFVDQVWPG
FT                   IAGAK"
FT   CDS_pept        join(complement(894704..894788),complement(894379..894624),
FT                   complement(893484..894323),complement(893240..893413),
FT                   complement(893075..893169))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948897"
FT                   /orf_name="Pc20g03900"
FT                   /product="Pc20g03900 protein"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85719.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018313B2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH60"
FT                   /transl_table=1
FT                   /translation="MNDTKPWGYRWRSSRLLVVSSITVALFAETFLYGFLTPILSYMLE
FT                   ERLHLAPSQTQSYTTALLATHGFIGLVSAPIVAHLAERTPSQKKPLLIALAGCFIGTLM
FT                   IALAPSLWLLFLGRILQSMAGAATWVVGFALLANNVDKKHLGQSMGTAMSFVTAGIVGG
FT                   PTVSGALLQLFGYWAAWSLPLIVLVLDIIARLVMIEPGPGYSNIDALSKPAATSVPSNG
FT                   SPEESTALLSDTLSMVNPDESGVESKHNLKQEYYRAMLSEPRVLTALANVVVVSSLMSG
FT                   INNTLPVHLRQAFGWKSLLISTMFFCLQVPNIVLSGPSGWLRDRIGIRGPTVFGWLAMI
FT                   PLLLLLGMPGDAHFPWAGGHAAGKSIFTSSLIALGSILPLVRGVGAVQLAYVVKDMEAK
FT                   DPHIFEANKSNLRVFSMTEVGYSLGMMLGPLLTGSLFEGVGFFYMTVALGSDFLALAGY
FT                   LALTRSPRSLSLNIQAVDTYA"
FT   mat_peptide     join(complement(894379..894607),complement(893484..894323),
FT                   complement(893240..893413),complement(893078..893169))
FT                   /db_xref="UniProtKB/TrEMBL:B6HH60 "
FT   sig_peptide     join(complement(894704..894788),complement(894608..894624))
FT                   /db_xref="UniProtKB/TrEMBL:B6HH60 "
FT   CDS_pept        join(896139..896344,896431..897475)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196009" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948898"
FT                   /orf_name="Pc20g03910"
FT                   /product="Pc20g03910 protein"
FT                   /protein_id="CAP85720.1"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00018313B3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH61"
FT                   /transl_table=1
FT                   /translation="MAGIHHPQSATTVFLDQPPSCLEFCPETPDHFIVGTYLLSENKTE
FT                   DGEVEQSKTGSLQLWNLDPVSKTLSQIQRIAVPYAVFDLHFHPRHKNLFAIASSVGSVA
FT                   LFQVSTNSTTGDASATPSITQLWTKQVHEDPSIPALFLAWAPQNWFPKPADGFAVTFSD
FT                   SRTAVFGTEGDIRQEESIAEWGTYEAKQMIEVWFVALSTSTGNPDPETQNPSAIPFMFT
FT                   GNDFGSLHTRRFDNSTELDDPDEHISPMLLEHDDRARHHTAGVTAILPLDVPLVDDAPV
FT                   LLTGCYDEGLRVYRATRRGEVLAEQGLDGGVWRLQLLNTTRIPGSDDPSNVAEYRFLVL
FT                   ASCMHAGTRLVRVTCKHEDGAPTWGIEVLAKFTEHESMNYASGVWKGGQEMTRSSEVLC
FT                   VSSSFYDRRLCVWTVDL"
FT   CDS_pept        join(complement(898060..898626),complement(897709..897987))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196008" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948899"
FT                   /orf_name="Pc20g03920"
FT                   /product="Pc20g03920 protein"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="proteasome regulatory particle "
FT                   /protein_id="CAP85721.1"
FT                   /db_xref="GO:0005838"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="InterPro:IPR006746"
FT                   /db_xref="UniParc:UPI00018313B4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH62"
FT                   /transl_table=1
FT                   /translation="MSDLQSLVSELHGAIERKQFDAANDLLSRAKRALLMQNALIPTPS
FT                   TPPQLVVLARQVLELGALASIRQTDAQLFTRYYQQLQPFYDLERHAGLPGQGSSEVDFS
FT                   TSQRSKITGLYLLLLLSMGDSANFHTVLEGLVEEASLKGGRVEDDACIKYPVELERNLM
FT                   EGSYDKVWRETKSERVPSEDFGLFSNVLIGTIRNEIAGCSEKAYPSLPISNAKNLLFLE
FT                   SEGAVIEFAKQRGWILRDGRIYFPVEPEAAARSEKDILMASGTVIENALGYARELETIV
FT                   "
FT   CDS_pept        join(complement(899809..901304),complement(899476..899761))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171253" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128994"
FT                   /orf_name="Pc20g03930"
FT                   /product="Pc20g03930 protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP85722.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="UniParc:UPI00018313B5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH63"
FT                   /transl_table=1
FT                   /translation="MRLQFLLLRALGLFLCYTQLVFAVDASYELVEQLDKAPDGWSRGD
FT                   KPPASKFIKFRLAIAQHNAREFEQKVIELSTPEHPSYGQHMSRDEVKQFLTPHPAISDR
FT                   IIAWLRSENVPANSINLYGHWVSFIVPIFQAERMLKTQFFYFHQQGQENPAIRTLGYSV
FT                   PRALRSHIQLIQPTTLFGNLVPQKSPVFKQKIATPEKLAAGCDVTITPDCLRDLYKIDN
FT                   TTTRPDWRNRLGISGFLEQYARHDDFNEFLRRYAQSHTDANFSVVSINGGQDGQHSMSD
FT                   SVEANLDVQYSIPLADEVLATFYSTGGRGPVVPEITHPDPTESSNEPYLEQLHYLLDLP
FT                   DEELPAVLSNSYGENEQSLPPSYLNATCSLFAQLGARGVSILFGSGDSGPGSSCVKNDG
FT                   TNQTRFLPGYPASCPFVTAVGGTYGTNPEKAVPFSGGGFSEVFSRPQYQDQAVKGYLGH
FT                   LGNQWNGLYNATGRGYPDISAQAANFIVRDQGDWISVGGTSASTPVLAGVISRLNAARI
FT                   AQGKPRMGFLNPWLYSHGQTGFTDIVLGSSSGCKWTSDARVRNASWDATEGWDPATGLG
FT                   TPLFPALVKLVLSDGQA"
FT   mat_peptide     join(complement(899809..901235),complement(899479..899761))
FT                   /db_xref="UniProtKB/TrEMBL:B6HH63 "
FT   sig_peptide     complement(901236..901304)
FT                   /db_xref="UniProtKB/TrEMBL:B6HH63 "
FT   CDS_pept        join(902849..902966,903056..903216,903268..903981,
FT                   904044..904250)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195976" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948900"
FT                   /orf_name="Pc20g03940"
FT                   /product="Pc20g03940 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85723.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR006599"
FT                   /db_xref="InterPro:IPR012945"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="UniParc:UPI00018313B6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH64"
FT                   /transl_table=1
FT                   /translation="MADAEIQQLRRPSADNQTVSKADIPLKERFFRYFQHEITDLQQEM
FT                   DRLADTSLVGGERADATDHCLAGIVRLSNEVKDAASYIPTYDQRVYAEAIKALQDRLSE
FT                   TRAAFEPRSKFSFKNKKNTSAVSLSDAAVLGVEGRLSIPGYHSPGGSSVDSSANNTPNY
FT                   PSTPLNEPDRQQQERPELAPTSFPGVSVGDFGGAKSPAGAFAATGISSVSVDDHQGLHI
FT                   MLPASGSTSTVPVSITSLDRCIVDMSIPTANGKPYASLTAKGVQESLLICGQVNGPAHI
FT                   TGVERSVIVVSCRQFRMHNCSNVDVYLSCSSNPIIEDCSNIRFGRIPKAYALNHDRPDH
FT                   EDRWSQVEDFKWIKPEPSPNWSLLDHNDAVPEEVWAEIVPGGPGWSLEDILHAIKVVPS
FT                   "
FT   CDS_pept        join(complement(905825..906717),complement(905552..905766),
FT                   complement(905406..905497))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195954" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128995"
FT                   /orf_name="Pc20g03950"
FT                   /product="Pc20g03950 protein"
FT                   /protein_id="CAP85724.1"
FT                   /db_xref="UniParc:UPI00018313B7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH65"
FT                   /transl_table=1
FT                   /translation="MVARTSSRNAAQKAKEAISTSPEPTGKTSKGTKRKASTEKAPQPK
FT                   KEKTEDTKPDEEKAEHVPDGPAAKREEEPVKAEEPSEAQPPKEKPVEAPSEKPQEVEGG
FT                   LRKSEERENVVSSNILEKGFIYFFFRPRVNIEEPQDIGDVSRSFFVLRPTVLGAEFDKG
FT                   QGPVDKDAKCRLMILPKKKYPTSPKERDMGFVEKAGQTMQELHEKFITGRTFETSTRGE
FT                   RHAEEARPYAEGVYAITSTPRASHLAYILTIPTELGDVQEDFGLQERGSWIVQSKSPKF
FT                   AGPPVGQLPKGPEYPPEVLEKFSDLRWVPLQPEFLDYPNSQFLMIGEAQNDLGKAAFAM
FT                   GGKQQHEEEPGQELEKLEDENENRVDSLKGDETVYEDLGYHAKNYPKVLTTWYTGESET
FT                   "
FT   CDS_pept        complement(906921..907589)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128996"
FT                   /orf_name="Pc20g03960"
FT                   /product="Pc20g03960 protein"
FT                   /protein_id="CAP85725.1"
FT                   /db_xref="UniParc:UPI00018313B8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH66"
FT                   /transl_table=1
FT                   /translation="MGNVPMDDTGPAKPDQPFEYFTGFTSSDAAADHQPEDTEQSMNGS
FT                   GPSTPTQDTDPFEESDNIRTIKPYDIEEPDDDLETSVPRVDILCLPDPFEQWQRELTDS
FT                   LNGLDYEHVGFDSNAMPLVRKRGKKRKPTHNALATQQCYPHLAQEHALAGTQPEEHGHS
FT                   PKRRKFSELQWHAQDIDSFGTFREANANESSGSETASIDLGGGIDGTNNSPMTDEMDID
FT                   "
FT   CDS_pept        join(908260..908271,908354..908403,908466..908785,
FT                   908845..910743,910795..911879,911944..912198)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195913" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948901"
FT                   /orf_name="Pc20g03970"
FT                   /product="Pc20g03970 protein"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="COPI vesicle coat"
FT                   /protein_id="CAP85726.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030126"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR010714"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016391"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00018313B9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH67"
FT                   /transl_table=1
FT                   /translation="MLTKFESKSSRAKGIAFHPKRPWILVSLHSSTIQLWDYRMGTLID
FT                   RFEEHDGPVRGVDFHPTQPLFVSGGDDYKIKVWNYQTRRCLFTLNGHLDYVRTVFFHPE
FT                   LPWILSASDDQTIRIWNWQNRSLICTMTGHNHYVMCAQFHPTEDLIASASLDQSVRIWD
FT                   ISGLRKKHSAPTSISFEDQMARANPNQADMFGNTDAVVKFVLEGHDRGVNWVSFHPTLP
FT                   LLVSAGDDRLVKLWRMSDTKAWEVDTCRGHFQNASAALFHPHQDLILSVGEDKTIRAWD
FT                   LNKRTSVQSFKRDLDRFWVIAAHPEMNLFAAGHDTGVMVFKLERERPASAIYQNQLFYI
FT                   TKDKHVKSYDFAKNVESPPMLSLRKLGSPWVPPRTLSYNPAERAILVTSPADNGTYELI
FT                   HLPRDATGAVEPTDVKRGQATSAVFVARNRFAVFNPSSQQVDIKDLSNSTTKTIKPPAG
FT                   TTDIYFGGTGCLLFITPTHVALFDIQQKKQLAELAVSGVKYVVWSNDGLYCALLSKHNV
FT                   TIVTKTLEQVSTLHETIRIKSATWDDAGVLLYSTLNHVKYSLLNGDNGIIRTLDQTVYL
FT                   VRVKGRSVYALDRNAQPRILEIDPTEYRFKLALVKRNYDEMLQIIKTSSLVGQSIISYL
FT                   QKKGYPEIALQFVQDPQTRFDLALECGNLEVANEMARELERPKIWSRLGAEALAHGNHQ
FT                   IVEMTYQKQRNFDKLSFLYLSTGDEEKLARMAKIAEHRGDFTSRFQNAIYRGDVEDRIQ
FT                   MFKEVDLYPLAYLTAKSHGLIEEAESILEAVGLTEDQIVLPTLEQPLKVPHPIVPTFQS
FT                   NWPVKAAGHSSFEKALLGEVGVDEEAGADGFDIEEEEQEAAVARETLDEDEEEVSGWDM
FT                   GDDVNVEEEVDFVNVESAEAGAGSSEADLWARNSPLAADHVAAGSFDTAMQLLNRQVGA
FT                   VQFAPLKARFLEVYKASKTYLPATAGLPPLVNYVRRTVDETELRKMLPIIPRDLETVAS
FT                   VDLQEGYAAMRSNKLEDGVATFKRILHTVLVNTVSSEAEVEEAKKIIATAREYILAMSI
FT                   ELERRSLTTDSPDNLKRSLELSAYFTIPKLEVAHRQLALMAAMKLAFANKNYGSALSFA
FT                   NRMLANGGSAKLLEQAKKIKAQCERNPQDQIDIDFDPFAEFDICAASYTPIYSGSPSVS
FT                   DPFTGAKYHPQYKGSVDRISDVTEIGAPASGLRLFVPSQF"
FT   CDS_pept        join(complement(913249..913412),complement(912644..913166))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195924" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671933"
FT                   /orf_name="Pc20g03980"
FT                   /product="Pc20g03980 protein"
FT                   /function="thiol oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85727.1"
FT                   /db_xref="GO:0016972"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006863"
FT                   /db_xref="InterPro:IPR017905"
FT                   /db_xref="UniParc:UPI00018313BA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH68"
FT                   /transl_table=1
FT                   /translation="MSSVPPEQVNSQYKDMSSMFNQQNPAASASSSKPAGDDSKPPLPK
FT                   GVVLDKDGKPCRTCTSVASWRALTKQADLKSANSNSTSTPTSSTSKMTTPTAGLAAAAT
FT                   PSPSETPSDCPPDVEELGRSTWTLLHSMAATYPEKADAEHQANMSGFLKFFSKLYPCWV
FT                   CADDFRAWMAHPSGRNQPKLGSRKEFGWWMCEAHNEVNRKLGKKEFDCRLWEERWRTGW
FT                   KDGRCD"
FT   CDS_pept        join(913917..914180,914387..915223)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195925" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948902"
FT                   /orf_name="Pc20g03990"
FT                   /product="Pc20g03990 protein"
FT                   /protein_id="CAP85728.1"
FT                   /db_xref="UniParc:UPI00018313BB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH69"
FT                   /transl_table=1
FT                   /translation="MPPKYTMFTMSDSESEAEREVSNIPSDQVLEKTLRDQVATIFKSG
FT                   NMEELTVKRVRLAAEDTLGLTAGYFKSTGDWKARSENIIKDEVRQKTRTPVSDEEEELS
FT                   VPPSDESDRVTKPKKRSKAPVNKSPVKASVQKPKKDTSDASDFSGDESEEVTMPKKRSK
FT                   APVKKSPTKKPSVHKPMKDISDASDVPHDTSDVAKETRDTKDDSESEMSVVLDEEPQPK
FT                   APRKRQKSAGGTATKTKKKAPKAKDEDISPDQAEIRRLQGWLVKCGIRKLWGKELAPYD
FT                   TPKAKIKHLKKMLEDAGMTGRPSQEKANQIREERELKADLEQIQEGAKQWGAKSDEEDE
FT                   DAKPRRRLARGRQSLAFLESDGEETD"
FT   CDS_pept        join(915969..916045,916120..916140,916217..916348,
FT                   916411..917048,917101..917669,917722..918083,9
FT                   18136..918565)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948903"
FT                   /orf_name="Pc20g04000"
FT                   /product="Pc20g04000 protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="CAP85729.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="UniParc:UPI00018313BC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH70"
FT                   /transl_table=1
FT                   /translation="MAMNKIRGAFTVPRKGETFELRAGLVSQYAYERKESIQKTIMAMT
FT                   LGKDVSALFPDVLKNIATGDLEQKKLVYLYLMNYAKSHPDLCILAVNTFVQDSEDPNPL
FT                   IRALAIRTMGCIRVDKMVDYMEEPLRKTLRDESPYVRKTAAICVAKLFDLNPAMALENG
FT                   FLEMLQEMIGDPNPMVVANSVTALQEIHHTAPETQALQITSNTLRKMLMALNECTEWGR
FT                   VTILTTLAEYKTSDVKESEHICERVAPQFQHVNSGVVLAAVKAVFLHMKNVNPDLSKNY
FT                   LKKMAPPLVTLVSSAPEVQYVALRNIDLLLQKEPDILNKELRVFFCKYNDPPYVKFQKL
FT                   EIMVRIANDRNVDQLLAELKEYALEVDMDFVRRAVRAIGQVAIKIESASERCVNTLLDL
FT                   INTKVNYVVQEAIVVIKDIFRKYPGYEGIIPTLCQCIDELDEPNARAALIWIVGEYAEK
FT                   ISNAGDILGGFVDGFNEEFSSTQLQILTAVVKLFLKRPEKAQGLVQRVLQAATSENDNP
FT                   DVRDRAYIYWRLLSNTSDSNATKNIVLSDKPPIVTTIHSLPPSLLDQLLSELSTLSSVY
FT                   HKPPEQFVGHGRFGADAVMRAAIEEQLQNARENPLAAAAAAAAGGTTAPAQAQNNVENL
FT                   LDIDFDGGAPASAQTEPSSGMSGLEGLAGTPVRVASPAAGTTTGQASNNLDDLLGVFGD
FT                   SGAAQPSSSGANSGDLMNGFSGLDLSGNAGPSQNTQTKKSNDDILSLF"
FT   CDS_pept        join(919345..919521,919620..920522)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948904"
FT                   /orf_name="Pc20g04010"
FT                   /product="Pc20g04010 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85730.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018313BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD86"
FT                   /transl_table=1
FT                   /translation="MAQTDYKFEGWMGLDPSAAEGKMVWQEFQPKEWEETDVDIKVTHC
FT                   GICGSDIHTLRSGWRPTAYPCCVGHEIVGTAVRVGSKVSGGIQIGDRVGVGAQSESCLG
FT                   RLGDCEECASGQENYCSKKVVGTYNSIHYDGSKSYGGYARYHRVPGHFAIKIPSAIPSA
FT                   DAAPMLCGGATLYSPLKHNGCGPGKRVGIIGVGGLGHFGLLFAKAMGADKVVAISRKMG
FT                   KKEDSLKMGADLYIATDDEPDWATVNARSLDLIVSTVSSTKMPFNDYLGLLKTGGSFVQ
FT                   VGLPEDGGLFAPVRSLMRRLKLQSSLVGSPNEIREMFQLVSEKGIRPWVQEIPMKDANK
FT                   AIVDMEDGKARYRYVLVNE"
FT   CDS_pept        join(920780..920833,920898..922457)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671934"
FT                   /orf_name="Pc20g04020"
FT                   /product="Pc20g04020 protein"
FT                   /EC_number="4.2.3.1"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="threonine synthase activity"
FT                   /biological_process="threonine biosynthetic process "
FT                   /protein_id="CAP85731.1"
FT                   /db_xref="GO:0004795"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="UniParc:UPI00018313BE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD87"
FT                   /transl_table=1
FT                   /translation="MSPTLSQQYLSTRGAEYGRTFEDVVLQGLASDGGLFIPEEMPTLP
FT                   KSWETEWRDLSFEDLALEIMSLYISTDEIPREDLKNIIYKSYSTFRHPERTPSVLLEKN
FT                   LYLLELFHGPTFAFKDVALSFLGNLFEYFLVRKNAGKTGKDRHHLTVVGATSGDTGSAA
FT                   IYGLRGKKDVSVFILFPDGGRVSPIQEKQMTTILDPNVHNLTVAGSFDHCQDIVKSLFA
FT                   DEDLNSTHNIAAVNSINMARILAQITYFIYSYFALTKTPSFNKDSKVRVVVPSGNFGDI
FT                   LAGWFAKSMGLPIEKLVIATNANDILDRFFRSGGHYTKKALDAPTDHGVKETHSPAMDI
FT                   LVSSNFERLLWFLSYQTTSGTEADRRKHACESVSGWLNELKTNGGFQVPSEVLEAAKVD
FT                   FESERVSNEETIAMIRDIYKTSFPKGLGPGSAKSSKTGGYILDPHTAVGVAATRRSMAR
FT                   NPDATHISLSTAHPAKFAGAVDLALRGEDGYDFTEILPQEFIGLEQRESRVTPVGESAG
FT                   WQGVKEIVKAELEQELQGLR"
FT   CDS_pept        join(complement(924407..924678),complement(924086..924331),
FT                   complement(923956..924025),complement(922839..923894))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000200122" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948905"
FT                   /orf_name="Pc20g04030"
FT                   /product="Pc20g04030 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85732.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831497"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD88"
FT                   /transl_table=1
FT                   /translation="MAGGAAINVFKFNTGGLPKETLNFKLWFAVFAFGLMGAARGVDEG
FT                   LITGVFNSHAFKRSVGIDDLDKDDLASVKGTISSMVQLGSVAGALLAFIVCDRIGRVWA
FT                   TRQLCVLWILGIAIFIGNNGNMAAVYAGRFIAGLGIGQTCVVGPIYLSEISPAPIRGLC
FT                   TCMFTGAVYLGIMIAYFANWGTQIHMADTFNRWAVPTSLHLMFAGIILLLTFFQLESPR
FT                   FYIKQGKREKALEVLCKLRGLPAHHPYVLNEISEMDVAYQEEMEATLGMGWKGLFKEIL
FT                   GIKRNAYRLFLTNLAQNMACWSGGSAITVYAPDLFTLVGITGQEQSLFSTVVFGVVKFV
FT                   AAIICALFLVDMAGRKRSLIIGIVIQTVAMFYIAIFLNLVPIAENPDFVPSETQNRAST
FT                   AAIAFIYISGVGWALGWNSGQYLLSSELFPLRIRGICSSITMAMHFICQYAVNRVLPEM
FT                   LLEDTGLGPHGTFYFFGVISIVGGIWVWLFVPEAAGRSLETIDKMFDLPWYKIGLYGRK
FT                   FAEEYDREQEAIYRDEKRDAGIVVSHNETA"
FT   mat_peptide     join(complement(924407..924555),complement(924086..924331),
FT                   complement(923956..924025),complement(922842..923894))
FT                   /db_xref="UniProtKB/TrEMBL:B6HD88 "
FT   sig_peptide     complement(924556..924678)
FT                   /db_xref="UniProtKB/TrEMBL:B6HD88 "
FT   CDS_pept        complement(926969..927454)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977863"
FT                   /orf_name="Pc20g04040"
FT                   /product="Putative uncharacterized protein Pc20g04040 "
FT                   /protein_id="CAP85733.1"
FT                   /db_xref="UniParc:UPI0001831498"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD89"
FT                   /transl_table=1
FT                   /translation="MADDVFEIKLFCASRFAPPSMTKMIDRGSIWTRAVSTVELLTETF
FT                   QLSPQFHPCSANIDLLSFTTIIYGDELRHKRGDSSNTQFSRCIVGSLINIVKYLFPSFV
FT                   GPRDVPDSSTLEWASMLRLRQESLTELAEELYNHLRGGGEQSLRLAPNTIMELEDIE"
FT   gap             928075..928174
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(928782..928794),complement(928631..928731),
FT                   complement(928437..928571),complement(928245..928379))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171591" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948906"
FT                   /orf_name="Pc20g04050"
FT                   /product="Pc20g04050 protein"
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /cellular_component="actin cytoskeleton"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85734.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015629"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="InterPro:IPR002097"
FT                   /db_xref="InterPro:IPR005455"
FT                   /db_xref="UniParc:UPI0001831499"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD90"
FT                   /transl_table=1
FT                   /translation="MSWQGWVDQTLVGSKKVDKAAIFSAGGDALLATSAGFNVQLEEVQ
FT                   YMLRGFEDSIPLYSGGLYVAGERLMVTKADDQSIYAEKGKEGVCVVRSSQSIIVAHYPE
FT                   TVQSREAASIVGQLANYLTSIGY"
FT   CDS_pept        join(complement(930605..931091),complement(929509..930542))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128997"
FT                   /orf_name="Pc20g04060"
FT                   /product="Pc20g04060 protein"
FT                   /protein_id="CAP85735.1"
FT                   /db_xref="UniParc:UPI000183149A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD91"
FT                   /transl_table=1
FT                   /translation="MVNSVAILALASPAFAGIMQARGEQFVRPAAQSSAAVAAPAHAEG
FT                   WGESWSKPAEHVSTHDSWSKSTESWTTPCTTSTTTPVHHHTTTTPVHSDTTTPVHSNTT
FT                   TPCTTSTTPVHTTTPVQSNSTTPCTTSTTPVHEHTTKPHVPVKPGTTKTLTYVTTTCPV
FT                   TSSTVTSGSKTWTVPVTGTSTITITKTTVCTMCENEKPVTFHNATQPAPHPTAGPTAPV
FT                   LKPTGDVVIPEKPHHSKPVEPKPVETKPVEPKPVETKPVEPKPVETKPAVPAHSEPAVP
FT                   AHSQPAVPAHSEPAVPAHSEPAVPAHSQPAVPAHSEPAVPAHSQPAVPAHSEPAVPAHS
FT                   EPAVPAHSQPAVPAHSEPAVPAHSQPAVPAHSEPAVPAHSEPAVPAHSQPAVPAHSQPA
FT                   VPAHSQPAVPAHSQPAVPAHSQPAASQPAASKPAASQPAASKPAQSKPAAPKETQPAAN
FT                   PSVPETPETPSKPEEPVSPSSNEFTGAASNVKPVAGLLAGVVGLMALL"
FT   mat_peptide     join(complement(930605..931043),complement(929512..930542))
FT                   /db_xref="UniProtKB/TrEMBL:B6HD91 "
FT   sig_peptide     complement(931044..931091)
FT                   /db_xref="UniProtKB/TrEMBL:B6HD91 "
FT   CDS_pept        join(932608..932789,932847..933044,933103..934237)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196041" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948907"
FT                   /orf_name="Pc20g04070"
FT                   /product="Pc20g04070 protein"
FT                   /function="DNA primase activity"
FT                   /biological_process="DNA replication, synthesis of RNA
FT                   primer"
FT                   /protein_id="CAP85736.1"
FT                   /db_xref="GO:0003896"
FT                   /db_xref="GO:0006269"
FT                   /db_xref="InterPro:IPR002755"
FT                   /db_xref="InterPro:IPR014052"
FT                   /db_xref="UniParc:UPI000183149B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD92"
FT                   /transl_table=1
FT                   /translation="MPHSVSPGSAQNDDEMPDAPPVETSTETNVRLEDMFNDDDDDDEE
FT                   FPASGDVKMESPSKEEPPAPTPSGVDPDIMLAFYQRLFPFRYLFQWLNHGIVPTKDFGN
FT                   REFALTLQNDAYLRYQSYPTADLFRKDILKMNPSRFEIGPVYSTNPRDRKTLRGGQMKP
FT                   VSKELVFDIDLTDYDDIRTCCVKANICAKCWAFVTMSIKVIDTALREDFGFEHILWVYS
FT                   GRRGAHAWVCDPRARNLPDERRRAIAGYLEIVRGGSQSGKKVNIKRPLHPHIVRSLELL
FT                   KHDFARTTLGDQDTFESAEQAERLLSLLPDKTLNESLRRKWDSSPDRASTSKWADIDSL
FT                   AKTGKSSTLNPATLRDAKQDIVLEYTYPRLDAEVSKKMIHLLKSPFVIHPGTGRICVPI
FT                   DPRNAENFDPLSVPTVMSLLAEIDEYDAKHPAGTAEADIPDVEGSAMNGSDIKGGRKVQ
FT                   DYEKTSLKPYIDFFRSFIAALIKEERAGKRERDDNGPAVKADPMEF"
FT   CDS_pept        join(complement(935619..935799),complement(935329..935509),
FT                   complement(934791..935260),complement(934703..934728))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196042" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948908"
FT                   /orf_name="Pc20g04080"
FT                   /product="Pc20g04080 protein"
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAP85737.1"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="InterPro:IPR003428"
FT                   /db_xref="UniParc:UPI000183149C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD93"
FT                   /transl_table=1
FT                   /translation="MLSLRTITRSIPRTFSRSIATSALRPALPKPAVFQSWNQATKPAY
FT                   AAFSTSSIFKAPSSEVDVELLAKLEDELRHEKSSEIPEFEEQLEAIEETIKVGEWQVKD
FT                   VAGEQEVILTKKFGTENIRVSFTVADIQNISEQEDFDDASLTDEMDFQNQSRDDASAEG
FT                   LEQPEPSFPARVTITVEKPNNGALLIQTVVQDGVFQIEEVSHFANAELAQSLTAEKDWT
FT                   RQSLYAGPPFENLDEDLQALWDRYLEDRGLNAEFANMVPDYISVKEQKEYLRWLETVKK
FT                   FIGA"
FT   CDS_pept        join(complement(936712..936880),complement(936576..936660),
FT                   complement(936242..936524))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196054" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948909"
FT                   /orf_name="Pc20g04090"
FT                   /product="Pc20g04090 protein"
FT                   /protein_id="CAP85738.1"
FT                   /db_xref="InterPro:IPR021346"
FT                   /db_xref="UniParc:UPI000183149D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD94"
FT                   /transl_table=1
FT                   /translation="MPVTLEKVHKQISKKRSSTNALHENSRDAHRLRKAGARDDRLSRH
FT                   NATVNRARQPYLDRIDYIHEAIQECTEALSTEEISEFVAKYIARDAEEIKQLESERRKG
FT                   RPPSKREEALKQRVQTEDREFATGLWMPDLSDQYAMTAMKNWNGHWSGLSAIKFMRFTK
FT                   DGEKLTSTFPPKSMS"
FT   CDS_pept        join(937195..937207,937270..937417,937477..939530)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948910"
FT                   /orf_name="Pc20g04100"
FT                   /product="Pc20g04100 protein"
FT                   /protein_id="CAP85739.1"
FT                   /db_xref="UniParc:UPI000183149E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD95"
FT                   /transl_table=1
FT                   /translation="MSPESDLIEKKTTPTGSFVNTPPTPPPSEEKKLSTSAQSVLNCFK
FT                   LHREGRRLESWRXHRLTPDQYTEVLRVLDGDESLRGYVEDKIRRSRLTIRMPSPLYDIF
FT                   YTKVVSTISSQLTELQKSDKAFGDFARKIEHISTSRIRLPNNANNREQTYSQQCPDTSF
FT                   MHEDAKYPGVILEVCYSTKIRATTDLADNYILDTNGSVNAIIALNIEYRGSKEATISVW
FT                   RPHXVTVDRVNALEAKAVIEIIPFRTKSRLRVDEPEQPALQLSLRDFAPKSISQKYPDL
FT                   DQGILISSREFYDFLTSTEPLLPGTQKRRRVQTPPKQLSSEEEFPKNAMKRGRLTRGSS
FT                   GLFTRGSGS"
FT   CDS_pept        join(complement(940279..940478),complement(939931..940128),
FT                   complement(939783..939843))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824646"
FT                   /orf_name="Pc20g04110"
FT                   /product="Putative uncharacterized protein Pc20g04110 "
FT                   /protein_id="CAP85740.1"
FT                   /db_xref="UniParc:UPI000183149F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD96"
FT                   /transl_table=1
FT                   /translation="MTTSGSNSCTFLLTRFSVSEKELPELNAITQLNWTPVAHLLLVRV
FT                   IGTTGESKSRSLEWNVDEECGCTGGKYMKDRECVEGMEQKEGISAGTKLNVKLIDRFSE
FT                   SLWRLGMRQEYTKSRRLGQPLLFTVPLPRADLDNLRPTAISHAIHPAS"
FT   CDS_pept        join(940490..940520,940581..940649,940706..941033,
FT                   941084..941462)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948911"
FT                   /orf_name="Pc20g04120"
FT                   /product="Pc20g04120 protein"
FT                   /protein_id="CAP85741.1"
FT                   /db_xref="InterPro:IPR016509"
FT                   /db_xref="UniParc:UPI00018314A0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD97"
FT                   /transl_table=1
FT                   /translation="MAVPFAQRWARFVPVVGYHHVLMIIVAVAIILLSLLLAGCSSSSP
FT                   QIPDIFLISLYYERYNPIMDLAQVQPDVASPISHIVGGAEMEVRVGYFGICVQPDKGSF
FT                   ICNANATALAEIVTVDQDPMNLIWVASTFKDAVVFPYLLIVAVILAFFCFILLATFPGW
FT                   HEELNEDGSDHEVKPFPSRAVSQAALALIFVASVFVLVSVLWQHTASVAASTIAQDMGN
FT                   GSVKSGVGASAMVLGWFGFVLLVIVTVGLLFMILSIRLITKMTDDE"
FT   sig_peptide     join(940490..940520,940581..940649,940706..940731)
FT                   /db_xref="UniProtKB/TrEMBL:B6HD97 "
FT   mat_peptide     join(940732..941033,941084..941459)
FT                   /db_xref="UniProtKB/TrEMBL:B6HD97 "
FT   CDS_pept        join(complement(943836..944136),complement(943551..943735))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128998"
FT                   /orf_name="Pc20g04130"
FT                   /product="Putative uncharacterized protein Pc20g04130 "
FT                   /protein_id="CAP85742.1"
FT                   /db_xref="UniParc:UPI00018314A1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD98"
FT                   /transl_table=1
FT                   /translation="MALPSIDHSSSHPGVYLSCFAQISDQRLQGPADHLISTTNQDYGV
FT                   SSGLYAGSSVKSVSGRCIDHAKGTRPEVVQKFVWFWPKSKFPKSSRTQQAASEERASRQ
FT                   ELPMLDINMESTQLHARPSSELMKIVRTVSASREALLGDGARSLLHSMGRSQDPSHD"
FT   CDS_pept        join(complement(947302..947383),complement(947192..947239),
FT                   complement(946956..947137),complement(946630..946898),
FT                   complement(945492..946566))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196098" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824903"
FT                   /orf_name="Pc20g04140"
FT                   /product="Pc20g04140 protein"
FT                   /protein_id="CAP85743.1"
FT                   /db_xref="InterPro:IPR018812"
FT                   /db_xref="UniParc:UPI00018314A2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD99"
FT                   /transl_table=1
FT                   /translation="MSYSAGGIRPHTITSLRRWSVVNKELPAVSSIRAIHVYDFDNTLF
FT                   LSPLPNPQLWHGSSIGFLQTNDCFATGGWWHDPNILSATGKGMEIEEPRKWEGWWNEQI
FT                   LGLVRNSMEQKDALTVLLTGRSEAGFAEIIKRMAASQNLEFDLIGLKPEVGPNGQRFAS
FT                   TMNFKQNFLEDLVFTYEQAAEIRVYEDRVRHVKGFRDFFENVNRDLQSGPSTARMPILA
FT                   EVIQVTEGCTYLDPVTETAEVQRMVNAHNLALRNPALNLTKSHCGRMYIKRVVFYTGYL
FT                   VSPQVSNDMMQNLLAPMLPAGLAESNDLKYMANSILITPRPAPRSVLDKVGGLGKKLKW
FT                   QVTGTGTLDNKIWAARVAPIPATEAYYTENPLPIVVLAVRKGARLIDAGQIQNWHPIPA
FT                   DRAMTFDTVVGEKVVLRVEDSGEHRQGERPLNRSQKRRFQQEDENIVWPPGSNADAPSP
FT                   GRGNYQSSQRGGGEGRRQYDDSPRGRGAHRGRGRGSGRGRGNNNRGRGRGRGRGEYYQY
FT                   RSLDDHSNGYDGQYDGKNGHNGGGSGRGGYSMDY"
FT   CDS_pept        join(947624..947825,947880..948706)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196109" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978095"
FT                   /orf_name="Pc20g04150"
FT                   /product="Pc20g04150 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP85744.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00018314A3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDA0"
FT                   /transl_table=1
FT                   /translation="MDDVELRQEILQRTLKEVADEEKEAANPCVICLDTIAEPCVAQPC
FT                   HHTNFDFLCLVSWIEQQPKCPLCKIELTAVQYDLNATQGPKLYKLPPPSAAIPAAPASA
FT                   RLRPGNRYGPRGRRPPPLPPPQPDDPLERRRNVYRNQTYSMRVGSNRLSQYRELTPELF
FT                   ARDEGLVSRARKWIRRELRVFSFLNPEPEDVERTSHQVSRPGPQRLENRRANNAEFLLE
FT                   YVIAILRTVDLKGSAGQAEDLLRDFIGRENACLFLHELQAWLRSPYNSLEDWDRHVQYS
FT                   NTPRSTSHGSYRDSDDLGRRSTPVHTRGRPQRFRRPYRSRSQENIDRSRRLQQAQQRYN
FT                   PY"
FT   CDS_pept        join(complement(949467..949740),complement(949231..949292))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978096"
FT                   /orf_name="Pc20g04160"
FT                   /product="Putative uncharacterized protein Pc20g04160 "
FT                   /protein_id="CAP85745.1"
FT                   /db_xref="UniParc:UPI00018314A4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDA1"
FT                   /transl_table=1
FT                   /translation="MAQPLVPLLGSRGHREECMSLPISTPACLPARLEVIPTPQSQDDR
FT                   AAAPSQLHQAGSEEKTLRKFVGAYKSIIENLDRIEPDIDDLKRLHEHISRKKIGGTRLN
FT                   LTVRGLD"
FT   CDS_pept        join(complement(951859..952142),complement(951476..951794),
FT                   complement(951196..951324),complement(950855..950990),
FT                   complement(950581..950723))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(<952257..>952432)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(955143..955293),complement(953556..955066))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196120" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672204"
FT                   /orf_name="Pc20g04190"
FT                   /product="Pc20g04190 protein"
FT                   /protein_id="CAP85748.1"
FT                   /db_xref="InterPro:IPR021110"
FT                   /db_xref="UniParc:UPI00018314A5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDA3"
FT                   /transl_table=1
FT                   /translation="MADNVLNSSAEIGAQAINVRAELKTWEKAFASANGGRKAGRDDIK
FT                   QNADIAAKYKEYSRLKALEASLSRRENSRQEPYDSHSKKRKHASPPDQDSAYLQVTPRK
FT                   SSRGLFATPSNNRTKHHPAQLDPYDSPSTLRRLFSPSTHRQGLPAPSPLKAAIGPTPQR
FT                   DGKALGLFDMLSESGGSGGTPSATRQSNNLAATFRTPSKRRPVDTIPEVPEVEAQQETP
FT                   RLARTPASETKQFYLANLFATPTTMRYAAMVEADDNPDEQTTNSLNPAPEISAQEAQSG
FT                   TPSFLRRSNSGRYPPPSEKHDGPGLSPIDSRKPQRFASKGLTHLVQGLRDMEEDRMEED
FT                   WEIMREMEEEAEAEEAAKVQVEDSQGPDVNRKYKKKGQKRTTRRVIMRPVIHQPKPKPK
FT                   APPAMNEDPKHEDDVTAVPGTQQQPAANDGWDDVPSDIERADEAASLHTMSEPELDTEA
FT                   EFEPDSDDDPEFGEQPKPVARPKTFSERIKEAVSSSAAKQQEQEPMGKPPKKPSETAEA
FT                   KKPRARKVNPQAHANYRSLSINRGGSSRGRGRFRRK"
FT   ncRNA           955512..955612
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="U6"
FT                   /db_xref="Rfam:RF00026"
FT   CDS_pept        956092..957474
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076720" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978097"
FT                   /orf_name="Pc20g04200"
FT                   /product="Pc20g04200 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85749.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI00018314A6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDA4"
FT                   /transl_table=1
FT                   /translation="MPPKRERTVQGSCWPCKQRRVKCDLGKPLCQRCISSGAKCCYDKL
FT                   LIRWKKTPSKTQSLTMSESPIMSLNIHLKDNNLAAGDLKALEYFQFALWPLFTTSAHPC
FT                   PPPIPLAMECQPVLLAVCELAEAHRTLRDEAGSSTVSAPFDKRMSCLASVREQLRNNPN
FT                   HTSLSPLLVAVFLLYFLDGFIECDRQSASTASHHVGVQAIVDHLGGFSALIKIGQKDIT
FT                   MLLSEFASTDLTKALLDDRPPCFPAEIWTQIEHGTVWWDQETYNGTTLASVFRIMSEMS
FT                   LYRQKIRGDPETLSMEVVRGFERCLQPSYQILDFDHLENPSTYTAHESTLERRMQADSF
FT                   TRAFQHSALVYLYRAICGLPPRHSLVQQHVQSCVECIRNISPLSKAHNCIIFPLYIMGA
FT                   HTFLQDQQAFVLERLDSIYKYLRFNCVLLVRAALVDLWESPRHDGDWWGMFTSLDEHVL
FT                   VI"
FT   CDS_pept        join(complement(960428..960517),complement(960234..960367),
FT                   complement(960076..960179),complement(959924..960027),
FT                   complement(959660..959867),complement(959526..959613),
FT                   complement(959349..959479),complement(959195..959301),
FT                   complement(959111..959129),complement(959012..959057),
FT                   complement(958789..958962),complement(958635..958736),
FT                   complement(958550..958591),complement(958337..958486),
FT                   complement(958191..958260),complement(957941..958126))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824904"
FT                   /orf_name="Pc20g04210"
FT                   /product="Pc20g04210 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85750.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00018314A7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDA5"
FT                   /transl_table=1
FT                   /translation="MENTAISNSDTQQSKKEQTMSRPDSIDIGQEPGNPEDPSKSNETE
FT                   LSAAIREAVNHRRLNPRQIQLTAIAGSIGAALFVGIGSGVMSGPLCLFLAFIFWATIVF
FT                   SIAQCQVEVVTLFPLDGAFIRLAGRMVDPALGVAVGYNHFFAQTSFVIFEATVINTLVE
FT                   YWGYNQSPAVLISSRLFQHGLVLTLLTASVSLVLYLAINVYRADLFGEAEFWLALGKVL
FT                   LATGLIVYTIVVMLGGNPLNDRFGFRYWKDPGPWAGADPSNRLMSFVNAVNVAAFCMGG
FT                   PEYISMIAGESRDPRRTVPRAFNTIMTRLIVFFIGGCLCVGFHTMIRFLQTDRTATPAD
FT                   PHSNVISMQRLQIPVLPSIVNAALLTTIVSAGNAYTFNASRSLHALALDGRAPKFLKRL
FT                   NKRGVPYMAVIVVMLLSCLAYLALGSSSAEVLNWILKFAHLVSALLLLCCTNWTVMSFT
FT                   WIRFNAALNAQGIDRKSFLPRVSRYQPYAGYWAFFWAFIFLWVQGYAVFIHGNWKVSTF
FT                   IFNYGIIALASIIGISWKIFKHTPFHKSKDVDLFSGLDFFDALTEHYRQEREAAPVTVK
FT                   DKIMAKIF"
FT   CDS_pept        join(961036..961168,961217..961314,961360..>961443)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949941"
FT                   /orf_name="Pc20g04220"
FT                   /product="Pc20g04220 protein"
FT                   /protein_id="CAP85751.1"
FT                   /db_xref="UniParc:UPI00018314A8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH1"
FT                   /transl_table=1
FT                   /translation="MAPSLVTIDSSEPLEKIIKVIERDGGVIVSNFLSPELLKECMDAI
FT                   EPFFQGRNTYDSRATHEELGPDFFPEGSQRVYALLAKIPDQLTKIVRLPVWQGIMAQFL
FT                   K"
FT   gap             961476..961575
FT                   /estimated_length="unknown"
FT   CDS_pept        join(<961660..961758,961850..961933,962055..962124,
FT                   962215..962293,962381..>962508)
FT                   /pseudo
FT                   /gene_family="HOG000213036" [ FAMILY / ALN / TREE ]
FT   CDS_pept        963405..963842
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949942"
FT                   /orf_name="Pc20g04240"
FT                   /product="Pc20g04240 protein"
FT                   /protein_id="CAP85753.1"
FT                   /db_xref="UniParc:UPI00018314A9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH2"
FT                   /transl_table=1
FT                   /translation="MTSDSRPCLEAWTCGGEIEDALSHRSSMSEHNWTLALFQKKDSKP
FT                   GSIVRAMRYMPLATPPRPNTTTAIICTSLFHMRWSSRLLFVLQDKLRHGSQVSRMRTRR
FT                   TRSEGCSLLCLILRFHVSCIRVCLDILEHTDTPRERLLPSK"
FT   CDS_pept        join(complement(964884..965174),complement(964239..964832))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196131" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672205"
FT                   /orf_name="Pc20g04250"
FT                   /product="Pc20g04250 protein"
FT                   /protein_id="CAP85754.1"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0001831585"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH3"
FT                   /transl_table=1
FT                   /translation="MLRSLLSFGRTGTNDYLFPKVDPKEDGPECLKDCADCTVKFPSKV
FT                   KVETSRPLYGQIKEFHSHVLVATGKSDWKEKHVEKMTGSLMEAFDEAESDHGVIKVSAS
FT                   NLTPPEQPTTDEGSNQATTVLILPSFTYVDSVTQADVPNLVAKFIDHPTNQQNGNETTS
FT                   PASGMSARPCELDYVILLCSHGRRDARCGITAPLIKRELERHLRPLGLNRDADDSRAGG
FT                   VGIFFVSHVGGHKFSANVLIYRKKDQQMIWLARVRPEHCEGIVKYTVLQGKVVHPESQL
FT                   RGGFDRLKELTSW"
FT   CDS_pept        join(966267..966335,966418..966734,966846..967146,
FT                   967218..968496,968555..968967,969026..969100)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196142" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949943"
FT                   /orf_name="Pc20g04260"
FT                   /product="Pc20g04260 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85755.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831586"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH4"
FT                   /transl_table=1
FT                   /translation="MKEKKERKDFGQTFHFGSHERDHLVSNECMDVQGNAQPERVRKRR
FT                   RRTMACTQCRTRKLRCDREYPTCSRCLKSRTPSKCTYEDGFLWQQPTTVPTTAFAADRG
FT                   SALSMPRDTPIETPPDSGIPPVSTRRPHDKERKDCFLETVLGAPKAAVNQEPYVNVGVL
FT                   QRPKRPAPAERETQAPSQTDDEHIDEEEDPLSPTDHLDLAPRIMMRGRETQTRFSGSGI
FT                   FANLVAQFPDIKYFAEEIKLSTPIFAQLQPDLRRVKRGLLKHMVLSRPFPDPTTASLIS
FT                   MLPSRGVVDELVGLYITHIESTHRILHVPSFLRELDQFWAMRDSPASISAGFTVQVLLV
FT                   LACAWNLADFASLQSKSSGELKCQSAVEWTLHAGKWIENLHTKRPEITSMRLSILLILA
FT                   RNAHGMRRSQAWLTTSTLVKQAMMAGYHRDPSRYARISVFNKEMRRRLWTTIVELDLQV
FT                   ALDRGMPPSVQSFDYDAAPGMNIYDDEIHENSTEVPESRPLSEVTDSSFQSILSRSLPL
FT                   RLQACSLMHSPRISCRYEDIQRLDSELNRHLSRIPAWVAPDPNDIVAQRKVMLWKGLIE
FT                   TKLCQSLLSVHTPFAIQARRESLFAPSTRTRLDAATRILSTQRRLHEISRTLSLCMLGE
FT                   WTIQAYISICQVLHTTEFDTSPPSYPTSSTFILHNIPGIPESLISLVETALIALEERSL
FT                   LMTKGAKDYYFLSTIVALVKSRLWPAQAAMYKQQVVERVLSFAQILFSRHMHCDHLGDK
FT                   GMGNFKNNQVAAFMAAPTMAPVMQPEFDPNGMHPPQPGAIPPGEFDPFLEIFDWEDLTS
FT                   MTFPC"
FT   CDS_pept        join(970066..971067,971129..971261,971314..971339)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000292006" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949944"
FT                   /orf_name="Pc20g04270"
FT                   /product="Pc20g04270 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85756.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016840"
FT                   /db_xref="UniParc:UPI0001831587"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH5"
FT                   /transl_table=1
FT                   /translation="MHHLLLLSIIIAIATPLGAIPSQSGAQSAKQVYQTTKKFPLANPG
FT                   NIPVHDPNIILHNEQYYLFKGGVNIPIFKSANVSGPWEKLGTVLAGDSIIPKTNRTRPW
FT                   APTTIEKDGTFYCYYTVSAKGSRDSAIGVATTTSLDGSPWTDHGVLINTGTGAGSGVWP
FT                   YTITNAIDASVVFDRDSGQAYLNYGSFWHDIWQVPLEDDLLSVRDGEAPDAVQLTFIPR
FT                   AKTKPEEGVWVSFRDGFYYAWFSHGNCCNFKNGFPGRGKEYSIRVGRSRSVRGPFEDKT
FT                   GKSLLEGGGTVVYGSNHGAVYAPGGLGVLPGNNDSMDILYYHYLNTSGGFKHGEAQLGW
FT                   NYLKYEDGWPVPVEGTNATANNAFGYGPPGWGYLAIMSGLWLCIWQ"
FT   sig_peptide     970066..970122
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH5 "
FT   mat_peptide     join(970123..971067,971129..971261,971314..971336)
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH5 "
FT   CDS_pept        join(complement(971812..972395),complement(971564..971750))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15949945"
FT                   /orf_name="Pc20g04280"
FT                   /product="Pc20g04280 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85757.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001831588"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH6"
FT                   /transl_table=1
FT                   /translation="MDSVKGKVYAVTGLGGIGLAVARQLHSQGALLSLADLSEKVLSTA
FT                   RQTIEVEFGSATASTITTTVLDISNVSAVQDWIADTVSHFGRLDGAANMAGTIGKKHGT
FT                   GKFVDQDDAEWDMLMRVNVTGLMYCLRAQLRAIMETAPGGKGSIVNASSIQGIKGFALH
FT                   AAYSTTKHAVSGLTKSVSKEVGPEIRVNAVAPGSIQTPLLDMATEIQGGFTMPPVSIPR
FT                   VGTGEEVAQTVVFLLSDASSYTTGQIVSVDGGWE"
FT   CDS_pept        complement(973071..973454)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949946"
FT                   /orf_name="Pc20g04290"
FT                   /product="Putative uncharacterized protein Pc20g04290 "
FT                   /protein_id="CAP85758.1"
FT                   /db_xref="UniParc:UPI0001831589"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH7"
FT                   /transl_table=1
FT                   /translation="MTSPINTNFTQPAECYNSRDAVPASMPSNIQYYNQVPLYQTKSPN
FT                   RDMKAVLQSCCSNGVWIYEDPDPCTAVCDSRSSAEAKKTMYCLNAQMVVYGTKTEKSSA
FT                   TVRRPMGWVSLMVGGLLLSGMFI"
FT   CDS_pept        join(complement(975449..975582),complement(974811..975402),
FT                   complement(974389..974760),complement(974000..974329))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949947"
FT                   /orf_name="Pc20g04300"
FT                   /product="Pc20g04300 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85759.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000183158A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH8"
FT                   /transl_table=1
FT                   /translation="MPQIKSIAIIGAGPAGAIAVDALAQEKTFDVIRVFERQEKAGGCW
FT                   VSRDDEPPQELDFDGLSARTADAPLEIPEHLPCRMPVVSQDRFMDSPVYPALETNVNAA
FT                   AMSFSQEEIPVVRSQWSIERHGEDTPFRHHSVIRKYIEDLFNRRGYQDLVQYNTTVERA
FT                   IKDPNSQKWVLTFRRTEVVDGVKSDYWWSEEYDAVVVASGHYAVPFIPAIPGLKEFAAR
FT                   YPGSVQHTKHYRGPEKYRGKKVITVGASVSAADTAVSLVDSAQTPVVAVVRGRYNAYFG
FT                   DLAFQHPKIQRRPPISHITSNDQGERTVHFEDGTSETGVDHVIFGTGFSWTLPFLPQVP
FT                   TRNNRVPDLYQHVFYRHDPSLVFVGAVGAGLTFKVFEWQAVAAARVLAGKANLPSIAEQ
FT                   EKWETDRIAQKSDGPGFTVLNPEFEPYFESLRQLAGEPRGTGRRLPRFEQKWLSDFDEG
FT                   HERRKKMWRRANQTARL"
FT   mat_peptide     join(complement(975449..975510),complement(974811..975402),
FT                   complement(974389..974760),complement(974003..974329))
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH8 "
FT   sig_peptide     complement(975511..975582)
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH8 "
FT   CDS_pept        join(complement(979669..979789),complement(979342..979587),
FT                   complement(978819..979259),complement(976211..978762))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093545" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129262"
FT                   /orf_name="Pc20g04310"
FT                   /product="Pc20g04310 protein"
FT                   /function="FMN binding"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85760.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR015702"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR023206"
FT                   /db_xref="UniParc:UPI000183158B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH9"
FT                   /transl_table=1
FT                   /translation="MSSTDQVPIPGPKGVPFLGNVYDIEPELPLQSFERMADSYGPIYR
FT                   LTTFGRARVFVSSHELVDEVCDEERFSKMVSAGLAEIRNGVHDGLFTANYPGEENWAIA
FT                   HRILVPAFGPLMIRGMFDEMYDIATQLVMKWARIGPAAPIQVTDDFTRLTLDTIALCAM
FT                   GTRFNSFYHDEMHPFVEAMVGLLSVSGHRALKPALLNNLPTSENNKYWSDIEYLRNLSK
FT                   ELVDSRKENPVDKKDLLNALILGRDPQTGRGMTDDSIVDNMITFLIAGHETTSGMLSFL
FT                   FYHLLKNPSAYRKAQDEVDRVIGKRKITVDDMSKLPYITAVMRETLRLNPTAPMIALHP
FT                   HPTKNKEDPVTLGGGKYVLNGDETIALLLTKMHRDPKVYGPDADEFKPERMLDENFEKL
FT                   PKNAWKPFGNGMRGCIGRPFAWQEALLVVAILLQNFNFQMENPSYDLRLKQTLTIKPKD
FT                   FHMKATLRDGLDPTQLSTTLSGSGAGPTETGAASRDRKPKVAPAGGKLKPMHVFYGSNT
FT                   GTCEAFARRLADDAAAYGYAAQTNSLDSAMQNIPKNDPVVFISASYEGQPPDNAAHFFQ
FT                   WLSELKGSELEGVNYAVFGCGHHDWSSTFYRVPKAIDELAKTNGANKLCDIGLADAANS
FT                   DMFTDFDGWGETLFWPGVMAKFGGTSPEPAAKPKSSLQVEVSSGMRASTLGLQLEEGFV
FT                   IENQLLTPPGAPAKRVVKFKLPSDMTYQCGDYLAVLPVNPSPVVRRAIRRFDLPWDAVL
FT                   KVKKPSGSTSSPSIPIDTPISAFELLSTYIELSQPASKRDLNVLADAAISDAELQAELR
FT                   YLASSPSRFTEEIVKKRVSPLDLLIRYPSIKLLIGDFLAMLPPMRVRQYSISSSPLVDP
FT                   SECSITFTVLSAPALANATPEGSESIEQYLGVASNYLSELQAGERAHITVRPSHSGFKP
FT                   PMDLETPMIMACAGSGLAPFRGFVMDRAEKIRGRRSSPDSDELHESETFKPAKAVLYIG
FT                   CRTKGQDDIHAAELAEWAALGAVDVRWAYSRPADGSKGQHVQDAMLDDREELVKLFDEG
FT                   ANIYVCGSTGVGAGIRDACKQMYLERRRAVHAELREKGETPPGADLEEDQAAEQFFDNL
FT                   RTKERYATDVFT"
FT   CDS_pept        join(complement(981315..982114),complement(980961..981261))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196187" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949948"
FT                   /orf_name="Pc20g04320"
FT                   /product="Pc20g04320 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85761.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI000183158C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDI0"
FT                   /transl_table=1
FT                   /translation="MFFSRIAILAALAGYATAQTSTECDPTKEDCPPDPALGTEHTWNF
FT                   NTTLDEKIWNMTTGTYEYEDDGAKFTLQREGESTLLQSNFYIFFGVVEAHVKMATGKGL
FT                   VSSVVLESDDLDEIDWEWMGYNTSEVQSNFFGKGNDTTFDRGGHHHVANADTEFHNYTT
FT                   YWDQDKLQWWIDGEMVRELPYNDESALFGKNYPQTPCRVQFSLWPAGRKDAPQGTIDWA
FT                   GGLVDWDTAPFTMTLGKLRVKDFHSGKEYSYGDRSGSWESIEILEGNSTALNELNKPEP
FT                   KSLSEKWDDLGEGAHIGVYIGAGVAGAIAIAGFLFFCLRQRRKGRLENALGNNPVPLNR
FT                   AEMENFQKDWRQSEWKHNGGYQQVSN"
FT   mat_peptide     join(complement(981315..982060),complement(980964..981261))
FT                   /db_xref="UniProtKB/TrEMBL:B6HDI0 "
FT   sig_peptide     complement(982061..982114)
FT                   /db_xref="UniProtKB/TrEMBL:B6HDI0 "
FT   CDS_pept        join(complement(984377..984379),complement(983874..984236))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196188" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824905"
FT                   /orf_name="Pc20g04330"
FT                   /product="Pc20g04330 protein"
FT                   /protein_id="CAP85762.1"
FT                   /db_xref="UniParc:UPI000183158D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDI1"
FT                   /transl_table=1
FT                   /translation="MAPINSMLEPRQSSGDTCPSTISGGGIAGIVIGSIAGTLLILWLW
FT                   RIFRLPGAWSGGDTSDVGYRPPITRSSTSSRGKRQRRRPSATYVDYVEKPTTVRSSRRY
FT                   RDHDDLRRPAKVYLSEP"
FT   CDS_pept        join(984866..984949,985136..985413,985631..985641,
FT                   985668..986014)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949949"
FT                   /orf_name="Pc20g04340"
FT                   /product="Pc20g04340 protein"
FT                   /protein_id="CAP85763.1"
FT                   /db_xref="UniParc:UPI000183158E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDI2"
FT                   /transl_table=1
FT                   /translation="MHLPRYACHNTESLVIVTCREEIQRATQPWNTSNPCPTARPVSYA
FT                   SVFSPSSHATVPPFVIRSLWSGRFLSKPIIYLITIHVVPALQTGYRDYCHVVVPLKLYI
FT                   GMSVSKGLDSIKDKYILYIYHWDPRILKNVFFLLTDEARLSYATYGLEFVGHIWAVDPD
FT                   WSLSEADEDGHDGRVEINATRVFWRFYNFMSTGNFSLKDIWLEFHAVNPEKTYPRCFAE
FT                   PTAWHFTKLNKPKWPWA"
FT   CDS_pept        join(complement(987381..990380),complement(986577..987329),
FT                   complement(986447..986524),complement(986298..986393))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184777" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978098"
FT                   /orf_name="Pc20g04350"
FT                   /product="Pc20g04350 protein"
FT                   /function="ATP binding"
FT                   /biological_process="chromosome organization"
FT                   /cellular_component="chromosome"
FT                   /protein_id="CAP85764.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0051276"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010356"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniParc:UPI000183158F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDI3"
FT                   /transl_table=1
FT                   /translation="MAHPRKSHGSITPRPAQGSLPTPEPSQSPEPQERAHRTSVPPLSD
FT                   ITESAVNQSPSKQLEEPKSQISIINPNSTVLERPMDIVAKSRTQAPQAPEEPAAPKPRM
FT                   IIENLILTNFKSYAGQQIVGPFHASFSSVVGPNGSGKSNVIDSLLFVFGFRASKMRQGK
FT                   ISALIHNSAQYPNLAYCEVEVHFSQVLDLPEGGQQVVPDSQLIVSRRAFKNNTSKYYMN
FT                   KKETNFTAVTTFLRDRGIDLDHKRFLILQGEVESIAQMKPKASNEHDEGLLEYLEDIIG
FT                   TSKYKTPIDEAATELESLNDVCVEKNNRVQHVEKEKTALVDKKDKALAYIREENELAQK
FT                   QSALCQIYIDECADNVRVTEEAILQMQELLNMELEKHEGNESGIKELEKAYKKGVRHYE
FT                   SIEKETQSLLKEMAKYDKESVKFEEKKKFLLGKQKKLEKAMQTSRLAASECQSLVEKFT
FT                   YDIEKKTAETNQFEKEMVIEEKELNSIREGLKGKTQGLSDQIAEKQKSLEPWNAKINEK
FT                   QSAVAVAQSELDILRERGNAGTVLLEEAQAKVVSIEESLQAKENDLEERQAQKETLESE
FT                   VEKLKHDLKKYAGREPEVRSHISSARQKADEARVSLASTQNRGSVLTGLMRLKESGRID
FT                   GFHGRLGNLGTIDEKYDVAISTACPALDNMVVETVEVGQQCIDYLRKNNLGRANFILLD
FT                   RLPRRDMASIYTPESVPRLFDLVKPKDPKFAPAFYSVMQNTLVAKDLEQANRIAYGARR
FT                   WRVVTEDGQLIDVSGTMSGGGTRVARGGMSSKQVADTTKEQVSRLESDLEDLEKKFQAF
FT                   QDKQRNVEAQMKERSEEIPRLETKIQKIMIEIDSTKRSLADAQRRVKELGAQHQPSDSD
FT                   EAQVAALEKQIAKAQKEIAKLNDEKSGIEEEIQTLQSKIMEVGGVRLRGQKAKVDGLKE
FT                   QIGMLAEEISNAEGQLSKNEKLIKKHTKARDVSEQEISQIAEELEKLEEDVANQSNESA
FT                   DWRQKADEAQEALESKKGELKAMKDELDAKVAELNETRAAEIEMRNKLEENQKALAENQ
FT                   KRSRYWEEKLSKLTVQNISDIGEEQEPTELQMYTKDELEAMNKDSLKAVIAALEEKVQN
FT                   ASIDLSVIEEYRRRAAEHESRSADLTAALASRDAAKARLDGLRSSRLNGFMEGFGIISL
FT                   RLKEMYQMITMGGNAELELVDSLDPFSEGILFSVMPPKKSWKNIGNLSGGEKTLSSLAL
FT                   VFALHHYKPTPLYVMDEIDAALDFRNVSIVASYIKERTKNAQFIVISLRNNMFELAARL
FT                   VGVYKVNHMTKSVTIENRDYITGR"
FT   CDS_pept        join(991059..991209,991269..991498,991557..992096)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184785" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949950"
FT                   /orf_name="Pc20g04360"
FT                   /product="Pc20g04360 protein"
FT                   /protein_id="CAP85765.1"
FT                   /db_xref="UniParc:UPI0001831590"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDI4"
FT                   /transl_table=1
FT                   /translation="MAPWESFDQVFSFNKKYSYEPKVFDQILSSRRSLDQLFADRLLGL
FT                   LGIQGVTKIYPPKSNTDLRTLFDHIVSSELDIHHKQSLIYYILKDCRTAPEASSQFAQQ
FT                   CHLPEKYRLFIEGLWHLDRLDFRRAVEYLAEPSLIPTFPDEILYVLTLTKLPKHDDSLA
FT                   IAYYLTAAPPLASAKIRKAFFDTLARSNVTEAFYFTRKYDDTFRQSFFEQLVEFVHRVT
FT                   PGQTRSRRAMELVGLPLDEDEEQWFEHVLLHGNASTLPGAKDTVMMRRLATGRTGELNP
FT                   ELESLGGKKVDGLNWDDLRGSIRHT"
FT   CDS_pept        join(992643..992688,992738..992821,993109..993136,
FT                   993188..994640)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184796" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949951"
FT                   /orf_name="Pc20g04370"
FT                   /product="Pc20g04370 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP85766.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI0001831591"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR4"
FT                   /transl_table=1
FT                   /translation="MVVCSFFQQGRCKFGDRCKFEHPGKPTAGASGNRFGALSGGFGGQ
FT                   NQTQEAVDPVVKATEIKQDLTAGQGRPEWIFSAYAPHRDVARQLFGGAHRERSMEEMRL
FT                   RHYELAASGNLNQAVQEASALWQECVQQMEISLNDLNGAVKYVIDGKDEHPNRHDIIEG
FT                   KTQTSMNQAPAPFGQQSPFGQQTAAPAPGAFGAPSSAFGQPSGLGQSVGFGRASAPAQP
FT                   TGMGQSTAFGQTSALGGSAFGQTSTLGGQPAFGKPAFGQPAVNPSPFGKPSVPGSGAPF
FT                   GAPSAASPFTQVAQNQPTAGGFGQPAAPSPFGQTAAQAAPSPFGQSAANPSPFGQPSAP
FT                   VGASPFGQPSAPAAPAAPAAPAASAPFGAPSAASPFAQVSQTQPAAGGFGQPAAQPAPS
FT                   PFGQPAVQGVPVQTANAGPRAYIKIENPQDLNPLPQLEGETRRNPSTKQLVMWKGRPVK
FT                   YINEHPCYLHPQDNKTFVRINFPNGPPDAASLKDAHGKPEEYTPEIVEAYEFFLQYGYF
FT                   KDGNIPAVPPKQEWLSFDF"
FT   CDS_pept        join(complement(995591..995632),complement(995232..995455),
FT                   complement(995067..995151))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000270245" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949952"
FT                   /orf_name="Pc20g04380"
FT                   /product="Pc20g04380 protein"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAP85767.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="UniParc:UPI0001831592"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR5"
FT                   /transl_table=1
FT                   /translation="MSFQKPEKDFGEGPKVHKIRITLTSRKVASLEKVCQELIDRARSK
FT                   SLQVKGPVRLPTKTLQISTRKTPNGEGSKTWDKYEMRIHKRLIDLLAPTETVKQIIINI
FT                   EAGVEVEVTIAA"
FT   CDS_pept        996038..998125
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672206"
FT                   /orf_name="Pc20g04390"
FT                   /product="Pc20g04390 protein"
FT                   /protein_id="CAP85768.1"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniParc:UPI000183167C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR6"
FT                   /transl_table=1
FT                   /translation="MAEFPPLAPVPSPAVRRTIPSNDWEACLDAWMALLGIRLNASDQQ
FT                   FKVAASEDASIPLFLGSYYQYTAAGDSSLQSGPKARQLRKLCFLAIRRYILDLTNPPDG
FT                   IMDWRLLGNLCCCHPASAALKTSLSSAWDMHQSKITSSLERAKATVIKNLSSANSSSNP
FT                   EVISDIRRLTILASVLPACGQELMAGSDFLDTISEAYQSKGARDEFRRILVANVYVGLI
FT                   SLLKEPVNLSSLLDQLFSLKAAARVGAPKMKKEPTLLSDLICSSDVLVRLEKYLSIHPQ
FT                   KRGQDLLASLRTYQVESKPLHHRYQRRKKVDKGKGVSSDPIVSGELHAHKMSLVTQVQD
FT                   LFPDLGSGFVVRLLDFYNDNPETIVTHLLDDSLPLELQSLDRSEQLPPPAEPHHSHLPP
FT                   QPTPPAMPSPTFAPLPTRKNIFDKDVDIAELSRSSEAQGKLHFGRADADQTADTLLAGH
FT                   GKHAANKAAILSALATFDSDDDERDDTYDAADVGGAIDGAAGGTDGEADAAQRDRRAAD
FT                   IETVLFRAYKSNPGLFARDSATRRSQPRASLKRETEMTDEAIEGWALMLTRDPKRIAKL
FT                   EDRLAMDAGGSAGAGPLNQPELRPTSYRRPQPREDGDEGSDEGDSSGHAGPRGGRGGGG
FT                   RGRGRGGGRGRGGRGGSGGQGQPDTAASRQRKEENKGSRANHNRRQQHAKKMARGGGLP
FT                   G"
FT   CDS_pept        join(complement(999922..1000124),c
FT                   omplement(998393..999857))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184828" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672207"
FT                   /orf_name="Pc20g04400"
FT                   /product="Pc20g04400 protein"
FT                   /EC_number="1.14.19.3"
FT                   /function="heme binding"
FT                   /function="linoleoyl-CoA desaturase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85769.1"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016213"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI000183167D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR7"
FT                   /transl_table=1
FT                   /translation="MEKTASRPSRKDTLLTRRYIEGLIAEGKHVIIFEGRVLRVDPFIR
FT                   YHPGGEKPIKHMVGRDATDEINALHSEEARQRMHSYQIGRIEGTWINFLPPIQGGKFRA
FT                   YTEDTCSSDEDSTTPEIFSGSSQDGSIPPSPVFDAVDSKSTVRQRKPTGTTSTEQSQAK
FT                   PAFLDARTREEIVLDTAKYPSLDPASQEEIKRKYRELNERIKAEGLYDCNYSCYFVECC
FT                   RYTLFAGLSYTFLRMGWWATSAFFLGCFWHQLVFTAHDAGHMGITHNFHVDTVIGMFIA
FT                   DYLGGLSLGWWKRSHNVHHIVTNEPEHDPDIEHIPFFAISHRFLTSLRSTYYDRIMTFD
FT                   APARFLLKFQNYSYYPIMMLARFNLYVLSWEYLLKGQAPKRGPAWWHVWFELVGQVFFW
FT                   TWFGYGVMYKTLPDASSRIIFLLVSHIVSSPLHVQITLSHFAMSTADLGVGESFAQKML
FT                   RTTMDVDCPTWLDFFHGGLQFQAIHHLYPRIPRHNLRRTQKFVIEFCRDTGIPYAIFTF
FT                   YDGNKEVISRLGDVAKQVRLMEECRKSIAEDGVFSHHH"
FT   CDS_pept        join(1000393..1000398,1000452..1000496,1000551..1000629,
FT                   1000683..1001002,1001054..1001072,1001123..1001132,
FT                   1001184..1001364,1001414..1001703,1001759..1002435,
FT                   1002488..1002648)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268676" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949953"
FT                   /orf_name="Pc20g04410"
FT                   /product="Pc20g04410 protein"
FT                   /function="intramolecular transferase activity,
FT                   phosphotransferases"
FT                   /function="magnesium ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85770.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016868"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniParc:UPI000183167E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR8"
FT                   /transl_table=1
FT                   /translation="MAQSITSLTEQWLQWDQDPTTRVEIEQLRDSKATEELEKRLRNRI
FT                   EFGTAGLRGRMAAGFSCMNSLIVIQASQGLAKFIRDKRSEIASNGVVIGHDARHNSAKL
FT                   AALAANAFIAQRIPVWFFNEEGPTPMVAFGVNYFGAAAGIMVTASHNPPQDNGYKVYSN
FT                   NGAQINRPEDGEIAQSIQENLEPWPTAWAELQPGEFLRADSYQKLLPHYSSQVAKYTKS
FT                   TVTDWQPPRPFVYTPLHGVGGLVLPNLCRSLGINEFSSVAAQEKPDPDFPTVKFPNPEE
FT                   AGALDLAIETADQEGKTLIVANDPDADRFAVAEKVDGKWHTLTGNHLGVLLASHVLDSF
FT                   DASKNWSHIAVLTTTVSSGMLGKMAAAKGIHFVETLTGFKWMANVARDLEKEGKTVPFA
FT                   YEEALGYMFPSVCYDKDGITAAAVFLAAEAKWRAQGMTAYAKLQQLFSEFGHHETLNNY
FT                   FRSPNPQLTSTLFQGIRGSPGLANMQFGRFKILRWRDLTEGYDSGTPDNKPDLPQDPTS
FT                   QMITMWLDGGVRFTFRGSGTEPKVKFYIESCGDSREDAVKAVCDAFLTIREEWVQRFTP
FT                   SMTYSKQLSTSSGDVLNVE"
FT   CDS_pept        1004819..1006013
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(1006244..1007050)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824906"
FT                   /orf_name="Pc20g04430"
FT                   /product="Pc20g04430 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85772.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000183167F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR9"
FT                   /transl_table=1
FT                   /translation="MYILEYSEDFGGPEDDFAFQKTIIVYEMSGSIYRAYSRKRYATKE
FT                   DIQFGDMYSTNKIQGALVFPEFSDKFTKAEKSPDCSTWYLKKPSLSPYSPQYPALIRET
FT                   WIEEVKTCELLKKNPHPNIAEYHGCAVVDGGSIRGIYFTKYDETLMARVNTARRNKIDF
FT                   AYERQEADREEIDRWVEGVARGLKHLHGLGIVHNDINPCNIMFQGDTPVIIDFDSARPR
FT                   GHDLSLVKRTHGWHDGKTKVALPMNDIAALLEIQSWLLGEVDQFQF"
FT   CDS_pept        join(1007315..1007544,1007604..1008128,1008385..1008475)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949954"
FT                   /orf_name="Pc20g04440"
FT                   /product="Putative uncharacterized protein Pc20g04440 "
FT                   /protein_id="CAP85773.1"
FT                   /db_xref="UniParc:UPI0001831680"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS0"
FT                   /transl_table=1
FT                   /translation="MHRIYREPKAKRDILLPHHHTSRQEADRYGHRNMCHVQQDTPCLS
FT                   ASPHLRQPQSTKETVHCFFCPHFKGHEQGLNMNSESDTRAHHKTFYHHRHERQPIHLPP
FT                   RSRSPDSSEDTQCRHNAGHYPAQEIHSNERRNNQFPVKHFYPETSNDPFDRIHRHAASP
FT                   ERSDSSRATDSSRATDSSRATGYKSHEEGCGSSIKAVRFKEDDKMPEHAKTHHPNCPLY
FT                   HAPSPLEDRHDSHCNPRPNQSQSRELRIFRWVIPQLHKNECTPYGYTRLKLPLDPRALV
FT                   "
FT   CDS_pept        1009315..1010277
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202734" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129263"
FT                   /orf_name="Pc20g04450"
FT                   /product="Pc20g04450 protein"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="CAP85774.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="UniParc:UPI0001831681"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS1"
FT                   /transl_table=1
FT                   /translation="MVPHRNWAFTPYSRKVIAIVTCLALFLWVATPLGCYGSTDDSKPP
FT                   RYAFATVLMTENDTEFPDIEAPYFQAARLLTFQLLRNPRTRNRIDNVPFLILVTPDIPQ
FT                   RHRDALSREGATVVPMDNLNLDDGSSQRWNAVLTKLNLWKLVEYDKIVFLNVNSVIFRP
FT                   IYDIFEDPATNMRATVTPTAKMPKNYMIAAPHDSRTNSNAQLVLGQESYQKDHMNDGFF
FT                   ILHPSKDLYNYYVSLHHIRDKDESVHPEQDVLDYAHRADGPMPWQNLGPGWNLKDASRS
FT                   DYERGLESINHKWWRPIADDFVGGRIAMAMDEMTAYLNH"
FT   sig_peptide     1009315..1009425
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS1 "
FT   mat_peptide     1009426..1010274
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS1 "
FT   CDS_pept        join(1011222..1011621,1011659..1012026)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189036" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978099"
FT                   /orf_name="Pc20g04460"
FT                   /product="Pc20g04460 protein"
FT                   /protein_id="CAP85775.1"
FT                   /db_xref="UniParc:UPI0001831682"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS2"
FT                   /transl_table=1
FT                   /translation="MSDTGGYALRRNGSCLSTETDCGGTTAPFHACCPGNMFCPGRQYN
FT                   VVCCPSNAGCRDIMSDSCADKKADLYSSNTSDLANEGFCCERDSYAFAMKANSGVGCAD
FT                   GLSDLQTSMDQLMAISSASGTYLRIAFVRSIPTPSSTPSTFVTSSPTTTSTTPSSTTST
FT                   GEAKPASSTNTAAIAGGTVGGVAGVAILIALVWFLLRRRNKQRQENGVQDMPPPPTNQT
FT                   QQHFPQSNSGHQATLSELDAQKQQPVVELPSHQ"
FT   CDS_pept        complement(1012205..1013151)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(1014098..1014377,1014425..1014564,1014612..1014801,
FT                   1014854..1015491)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949955"
FT                   /orf_name="Pc20g04480"
FT                   /product="Pc20g04480 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP85777.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="UniParc:UPI0001831683"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS3"
FT                   /transl_table=1
FT                   /translation="MADSKNVALVFGASGISGWAVTKCALSYPTPTTFDRVIGLTNRPL
FT                   PLERSGLPHDPRLELHCGVNLRGNLDEVLCQLQEKVPSLEDVTHVYYLAYSNATAYSID
FT                   VMAIRDINEGMTYNAVHAVDRLCKNMKFFVLQTGTNNYGVAVFRFQEHIEINPPLHEDN
FT                   PRIPSPWGDEIFYYAQVDIIKEANKGKSWKWCEVRPDQIIGHVPTPTSMTYVEPLALYL
FT                   TLYRHVNGLGASVVFPGSYPNYTHTFTASSQDIIARSELYLSVEKPDRGHGEAFNTADN
FT                   DIPASWALVWPKMCEYFGLRGEGPSPEDKGWKDIDKWWFAHQDDYKKMCKKYGLRPREI
FT                   PETTWTFLSVGLSFLCRNRELSLDKIRSVGFTEEYPVAYGYFQVFERLTQEKIIPAKED
FT                   LYRYRVAEKGNLGMSL"
FT   sig_peptide     1014098..1014178
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS3 "
FT   mat_peptide     join(1014179..1014377,1014425..1014564,1014612..1014801,
FT                   1014854..1015488)
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS3 "
FT   CDS_pept        join(1015617..1015881,1015944..1016749)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949956"
FT                   /orf_name="Pc20g04490"
FT                   /product="Putative uncharacterized protein Pc20g04490 "
FT                   /protein_id="CAP85778.1"
FT                   /db_xref="UniParc:UPI0001831684"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS4"
FT                   /transl_table=1
FT                   /translation="MVRRTMVHPHASTSGVLPEPACLLCGMLIPNTRRSEFPDSGKSHP
FT                   LLQESQWKSLWKPGLEHLLVPSREVENTFTTNFPRLWSCLCRAIIKESDTKYRLTGINL
FT                   IQDRHLNGSYYVPNDPTKARISGKKDFPYDGRVFTRFYAASIKRQPREYKDKTIGYVVH
FT                   AHCWALFGQVEGLKLRDAGLAKFVQVCRKYWKDHELWQIYSDFDRLLYTSTMDIYRNPF
FT                   VLPAIREAIDCAKIEHFRQSSCFNNLPLELAISICQWVCPITDYTEDDIKNTRNLLLVF
FT                   GWELPEWFWRARLNSHLHLFFELDKASKIGSPADWQLWLNLMSLVADRSRFVSTGLANR
FT                   ERVLGVMLALEKIYAD"
FT   CDS_pept        complement(1017212..1018379)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(1018886..1019254,1019314..1020365,1020453..1020531)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201423" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949957"
FT                   /orf_name="Pc20g04510"
FT                   /product="Pc20g04510 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP85780.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831685"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS5"
FT                   /transl_table=1
FT                   /translation="MNDKKSKVFRKEGGDYEQGSIGDVVEGVPGTRILIEDTDAEIILL
FT                   PRPTSSPDDPLNWSWRRKYIAQAIVFIWAFMLGAATLSPAVTYASVMAELGASTSYLNI
FT                   GAALALLMLGLGNLVFNPLALRFGRRPVYLFSTLISAAAQVVAARAQTKATFIGSRILL
FT                   GFGAAPFEQLPALTVDDQFFIHQRGLGLSIYTLALTTGSFLGPIATGFVIDSMGWRCPS
FT                   SFPLQSSPAQLTVQIGVYWFYAIFLFSVAALVFFALEETGFPRRTYQQTDPNETRSSDP
FT                   PKTYLQKLQLITILPVPTSLYRTATTPILLLTSPIIWWCGIMYGFAVAWLTIMAYESTT
FT                   IFMTYNFSSSALGLTNIAPLIGACLVIYLGGAGTDRFMVFKARRNAGIMEPETRLYSVF
FT                   FAGPIMAAGLILYGVGAANEIHWAGPIIGMGMIGSALPISAEVALGYVSECYPSLAGEA
FT                   TAAVIVIRNVIGCGMTGILLVWKGKACRRLGARRYATLVLG"
FT   CDS_pept        join(complement(1022614..1022654),
FT                   complement(1022465..1022557),complement(1021675..1022410))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824907"
FT                   /orf_name="Pc20g04520"
FT                   /product="Putative uncharacterized protein Pc20g04520 "
FT                   /protein_id="CAP85781.1"
FT                   /db_xref="UniParc:UPI0001831686"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS6"
FT                   /transl_table=1
FT                   /translation="MSVTYHVYHPSHDRYMDPSGNSTSSQHIPSKFLGPVMFHHPSDDL
FT                   QLDHMLLRLPFYMFVSFFPSALIPAHCVLRLGQHEKGLTIHRHVARPPPHKTLHSNWVV
FT                   QPCRDTRKRKKQKQKQKACTFRRFNQAPTFKHQNPNIHFDQPHSVNHIQSTTSTVNHIQ
FT                   STTSRVNHIHSQPHPQSTTSTVNHIHSQPHPQSTTSTVNHPLQSTFQSTFQSTFQSTFQ
FT                   STFQSTFQSASSINHFNQPLQPTIRLSTTLQLCKRRKETKQSWSTRVSAGVSLKETSRR
FT                   EEVQRVPI"
FT   CDS_pept        join(1022850..1022905,1023007..1023126,1023392..1023470,
FT                   1023555..1023659,1024020..1024157,1024244..1024290,
FT                   1024374..1024437,1024525..1024742,1024846..1024956,
FT                   1025032..1025151,1025242..1025553,1025773..1026115)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129264"
FT                   /orf_name="Pc20g04530"
FT                   /product="Putative uncharacterized protein Pc20g04530 "
FT                   /protein_id="CAP85782.1"
FT                   /db_xref="UniParc:UPI0001831687"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS7"
FT                   /transl_table=1
FT                   /translation="MEEVMRLKLMMEDLMEDKGGYLYPGGLERVWRVRKYPCTWGVLQG
FT                   TPHFSTSPLQLSAPLHAKLYLVWRICTVLVSRRTTFEGPKSWLASICEWAPVHIMSEVA
FT                   LSPHGHFRWRQNAETPGNKRGLGYEVDTIWDFRGPRRYCRLELHRDRGVMNCSLQGDRM
FT                   YEAMRGADREGNRTSEKHWFVGGIEKGAGENSVLGLPEGVGSAMYSVNKDQLKLAKVKE
FT                   KLRGVYRRRDPVRTHDSRRGRKEGVRCALWMKLADENIPVSCWFRRGIVMETARTRKGI
FT                   KKQSVLSEWKLYKRARESARDQAIGEAFMPNNPQGHCSKYSRPVKGRMDDNGSIGMEEG
FT                   YTPIDSPGSWATSEDNARQCERTGHLSPPLSIFTDESECNRRIGATAVRYTVSFERRCQ
FT                   MGDEDMSTVYQPSSKTSKWPCSRFKKPGTGQWGGRVDGDGGEESEESEGIGKPDRITSR
FT                   GISGWLRKMVTVTKASSILFVAGFMMKPALLAQFQCVDSMATGIRLPRLLVRAVHNHST
FT                   TITITLAGISASSVTTITSCPAPAGGLRHRSTSCYARKRTTLLGTGPANPHNH"
FT   CDS_pept        join(complement(1027241..1027376),
FT                   complement(1026818..1027160),complement(1026578..1026711),
FT                   complement(1026400..1026489),complement(1026142..1026323))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949958"
FT                   /orf_name="Pc20g04540"
FT                   /product="Putative uncharacterized protein Pc20g04540 "
FT                   /protein_id="CAP85783.1"
FT                   /db_xref="UniParc:UPI0001831688"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS8"
FT                   /transl_table=1
FT                   /translation="MVHYCKTAKYSNVALAESTKIPPDKPHNAVLGLFISSLVSGLRLT
FT                   VFRLSHLAPVSSLPPSMARAVRYIGIAAHSLHSPHLAYIAQLPGSLYLHFSIRSLPASS
FT                   PPSTSYYQSSPSPRVPTSLLKPTNAVAFVNSMACPFILDPVVDIVDFARGISRLDGFKV
FT                   VVVVVVIVVLIKVYRRAGVAHTPATSLGVLGRAELWNYVHEYECSYLQSQGIPVVSFVS
FT                   WCSVAGDVAPVYLSVGGMVLDEGSGEVRVGQPAFLGSPAALVSARGLSPCADCGVEAGD
FT                   TEEFAELGRADPA"
FT   CDS_pept        join(1027580..1028247,1028301..1029002,1029050..1029926)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206405" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672208"
FT                   /orf_name="Pc20g04550"
FT                   /product="Pc20g04550 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85784.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001831689"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE27"
FT                   /transl_table=1
FT                   /translation="MDTHDVSDVPEYFRYLQAQKQNLKNAQAVKGRPARSPKSKDEILM
FT                   QFMFRQMMRKEAPASPMNIRSSFLPPAYPPCVSPFSKLKKVMIESLRLETHHRERYLLL
FT                   RTVTSTDTMTAVMAIVEDEDGSVLMLQLYNQEEQLSGAQSLREGTVLVVKEPYVKVMAD
FT                   GDYGIRVDHLSDVSFIPEFDDLVPLPWRKRVTQADGNASSWKEKGSEHFEKGDYHSAIQ
FT                   CYSKALETHPSPEVLVIAQLNRALSLLKSYSFDAALGDVEDVLQVSEMSEKALFRKAQA
FT                   LYQLRRLNESCQTHEILAEKYPDNTLAAHEYARASARLVEQDSGKYEFRKMILEAKKRQ
FT                   PPRLDRGTYIGPVTVKQTQSHGRGLFTTQAVKAGDLLFCEKAFAHAFHDENGSKDLRLL
FT                   LNVDMDEATIGTQGELIGLIVQKLSKNPSLLPGFVDLHHGTYKSLDVLEVDGIPIVDTF
FT                   LVERIILLNSFGCPLLSRESHIRTVKGDDDKDKESNKQFHSSGVWPMASYINHSCLSNA
FT                   RRSFIGDMMIVRASRDLPPNTEITFWYKSPMTRDPKESPVNLQHWGFKCDCIFCQDTRS
FT                   VSGSVLSNRNRISSDLRRLFKTSKMNLRKIEDKISTLASTYCRPASEVPRLALDSPYLS
FT                   LAAIYASSRNHKKAVEFGLMCLESLGFVVKGGKIPHVSEVPLVVQKWGLMTDGVVGCWM
FT                   ILCSAYQELAPILASQAEEYARVSYRICVGEDETFDRTYSRLSNRVDGFLMTAK"
FT   CDS_pept        join(1030473..1030614,1030661..1030848)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185320" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129265"
FT                   /orf_name="Pc20g04560"
FT                   /product="Pc20g04560 protein"
FT                   /protein_id="CAP85785.1"
FT                   /db_xref="InterPro:IPR011058"
FT                   /db_xref="UniParc:UPI000183168A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE28"
FT                   /transl_table=1
FT                   /translation="MSFHRSACDIRLRADSGCTFLSAICNNEEGSGLADNIPLDECLGN
FT                   ENGHFSWGGRNFSHDARNITLTRGPDRSPVLHSDLRNSSGDFVPSEIDLATHIANIDGK
FT                   LVYLY"
FT   CDS_pept        join(complement(1031777..1032176),
FT                   complement(1031567..1031711),complement(1031370..1031499))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(1032658..1032835),
FT                   complement(1032329..1032606))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949959"
FT                   /orf_name="Pc20g04580"
FT                   /product="Pc20g04580 protein"
FT                   /function="RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAP85787.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="UniParc:UPI000183168B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE29"
FT                   /transl_table=1
FT                   /translation="MGAELESLIGYQFHDRSLLEEALEEAGPQTEGNERLALLGDKVLS
FT                   LMLLHRWYMEGNTTEQGTNLLQIYAGNKHLISRARALDFPKFVIQRLDIKRSVPDHTLA
FT                   TTVKAILGAVWLDSEESVRNVKNSMERIGLYPPEISLYPPKFGNQKQ"
FT   CDS_pept        1034337..1034975
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129266"
FT                   /orf_name="Pc20g04590"
FT                   /product="Pc20g04590 protein"
FT                   /function="signal transducer activity"
FT                   /protein_id="CAP85788.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI000183175E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE30"
FT                   /transl_table=1
FT                   /translation="MSYASRSNSKELVKRPTLSEVLSDATAPPYTLKAFMTYLSESHCL
FT                   ETLQFTLAAKEYCETYNSFVDQAGEPNVTTDPSAGRHLRMLYQLLLTTYIIPGAPREVN
FT                   LSSDMRDSLLRYKDQLTPPLPEVLEPGVRYIQELMENSIFLLFLNSCATPSCQDLAPEA
FT                   SDMIGVSVDSSVRRSGDESTQSVRVNSKRPFLSHHMRSWSWPPWGRQPD"
FT   CDS_pept        join(1036195..1036286,1036346..1036658)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187032" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129267"
FT                   /orf_name="Pc20g04600"
FT                   /product="Pc20g04600 protein"
FT                   /biological_process="fruiting body development "
FT                   /biological_process="hemolysis by symbiont of host
FT                   erythrocytes"
FT                   /protein_id="CAP85789.1"
FT                   /db_xref="GO:0019836"
FT                   /db_xref="GO:0030582"
FT                   /db_xref="InterPro:IPR009413"
FT                   /db_xref="UniParc:UPI000183175F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE31"
FT                   /transl_table=1
FT                   /translation="MASSLSQKSLQIQIQDDLKYDIRIENAKLESGKFYNEDDQSDILT
FT                   SEDVDDMVIRHNGGIRSVCSMDGSEGSIDLVDDVRDAKICNLTWRASPEGGERNEIKKL
FT                   NEDTRYMVDIGSWNESGTVGSVLVTVKDQE"
FT   CDS_pept        complement(1037206..1040700)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200201" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672209"
FT                   /orf_name="Pc20g04610"
FT                   /product="Pc20g04610 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /function="phosphomevalonate kinase activity"
FT                   /biological_process="cholesterol biosynthetic process "
FT                   /biological_process="nucleoside metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85790.1"
FT                   /db_xref="GO:0004631"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006695"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005919"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0001831760"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE32"
FT                   /transl_table=1
FT                   /translation="MATLESLKLALRQKATEKASTSKQPLSDAQYSAGFDTFVQGSGWM
FT                   TYRDFILPQICQLLTQLLGSRSCISVLEIGPGPKSILGHLPSDLRRKVKRYSAFEPNNL
FT                   FATKVQKWLSFESDIESPFPCLERTPDIHRTPFIVNSPTGGDTGSVTRDSDEKFDVIIF
FT                   CHSMYGLNPKAKFIEQALQMLVEQPKSGIVVVFHRDGTLNLDGLVCNETAPFPTGTISV
FT                   PNNDAVLDLFAPFVAGFAMQDKEADKVLLAEWREVCRVLSRREETHPGHLFFSSPNLMA
FT                   TFTRQSTALPELTAQVPLLEGDLKVKNREARLHYPASIFRPTEIRHVQDCIRWALKHGV
FT                   GLTVVGGGHSGHCLWDNVVAVDMGAFDQVHVLQARNGGAESGFDCTPLVVAEAGCKTGD
FT                   IIRNAMAMGITVPLGARPSVGAGLWLQGGIGHLARMYGLACDAIVGAVIVSVDSSQVFC
FT                   IGHVPSQHQPVGAVRPGNETDLLWGIKGAGTNFGIVVSVTFKAFPSPTYSVRNWIAPLN
FT                   DSLEAQVKLSEFDEYVARRLPRNCSADAYLYWDIGQLRLGVTMFESFETRPSSETPIPF
FT                   PLPTSSGTILGPEDNFKFVDGVGLFEAEMYMSGMHGGHGGSRTSSFKRCLFLKDIGAPE
FT                   VTNSLVTAIKTRPSPLCYLHLLQGGGAVVDVAADAAAFGCRDWDFACVVTGVWSRDQDG
FT                   TEVARTAVRWVYSIAMDLLPLSSGVYGADLGPDPRDAALAVEAFGPNRPRLARLKQSSD
FT                   PRNVLAYTCPLEQVPIKPKLIILVTGDSCAGKDYCANIWVSAFLECTQKSLVARAVSIS
FT                   DTTKREYAAATGADLNRLLCDRAYKEQHRPALTTFFQSQVRHRPRLPEEHFLKAVYGAV
FT                   DTDVLLITGMRDDAPVATFSHLVPDSRLLEVCVEASKPTRCTRRGCQDGDGADHHADNN
FT                   NSWSKPKPLDYRPSLIFNNDLTGSEAAQRFAELNLLPFFHKDLQRLADMVRPVSNFPRP
FT                   GVEFRHVLNISQQRGGLTLCTYLLQTHFAGAWGEVDVLACCEAGGFVYASALALQVNVP
FT                   LALIREAGKLPTPTVSIFKPTSHISSSTSDDLEGSRIEMERDLIPKGASVVVVDDVLAT
FT                   GKTLCAVLDLLNKANICAKDVSIMVVAEFPVHRGRELLRQRGFGGVNIQSLLVFGGA"
FT   CDS_pept        join(1041080..1041300,1041354..1041735,1041789..1042091)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000221222" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949960"
FT                   /orf_name="Pc20g04620"
FT                   /product="Pc20g04620 protein"
FT                   /function="GTP cyclohydrolase I activity"
FT                   /biological_process="one-carbon metabolic process "
FT                   /biological_process="tetrahydrofolate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85791.1"
FT                   /db_xref="GO:0003934"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="GO:0046654"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniParc:UPI0001831761"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE33"
FT                   /transl_table=1
FT                   /translation="MNSSPLLYSGATPSAGERGQDSFERQNIDSPVNASFACRVPIELR
FT                   SIEEGPAVALASGLASQATGAGHTTVTLSSQTTFHEPTREPWDGKESFSSGPYPLGAEI
FT                   IQKLESPQGENRGVQKLARAVCTILECIGEEPTREGLRATPERYANAMLYFTKGYAESV
FT                   HDLVNGAVFHEGHDELVILRDIDVFSLCEHHLVPFTGKVHIGYIPDNRILGLSKLAHLV
FT                   EMFARRLQVQERLTKQVALAISEALNPRGVAVVMECSHLCMVMRGVQKVGSTTTTSCML
FT                   GCMRSNAIAREEFLALLSRR"
FT   CDS_pept        1043777..1044265
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201849" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824908"
FT                   /orf_name="Pc20g04630"
FT                   /product="Pc20g04630 protein"
FT                   /protein_id="CAP85792.1"
FT                   /db_xref="UniParc:UPI0001831762"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE34"
FT                   /transl_table=1
FT                   /translation="MYRALHGDVSTLLDETELHFEFHEDDDDTGYIKMHDTSIMGRFVC
FT                   RNRACGSGGWSSKKIAVTIRLYPGQKYNARVYHQRCESCTSVSRPKLDQSYAERVVYWI
FT                   KRWNGVQVERPPSSGNSRRPHNRELCEGCRAGHCSQSREDFIPQFERFVDFQSTNIIQ"
FT   CDS_pept        <1045246..>1046301
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(1046873..1046915,1046951..1047099,1047347..1047367,
FT                   1047421..1047479,1047538..1047616)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949961"
FT                   /orf_name="Pc20g04650"
FT                   /product="Putative uncharacterized protein Pc20g04650 "
FT                   /protein_id="CAP85794.1"
FT                   /db_xref="UniParc:UPI0001831763"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE35"
FT                   /transl_table=1
FT                   /translation="MSSSGYLTAKAVSVNKKCCTPLPYAAEQGSHKTVKFPAEDKKADI
FT                   DSKDYGHAIYSTTIGDRYTILDMHGMFAIPLLVQASYTACISIDSYIVALNSDTAHEAS
FT                   RSLRLSSLRSIR"
FT   CDS_pept        join(1048023..1048552,1048617..1048694,1048757..1048907)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129268"
FT                   /orf_name="Pc20g04660"
FT                   /product="Pc20g04660 protein"
FT                   /protein_id="CAP85795.1"
FT                   /db_xref="UniParc:UPI0001831764"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE36"
FT                   /transl_table=1
FT                   /translation="MTSQHSRFVGAELYSISFDAPTPSTWIVIERVNEHEHRKDPDHSA
FT                   VSYASVKYRCKKDGDASKNAFVRIYKQLPHLGTEFGDHATRANQARAWTPPELVAYKTL
FT                   TDKQSKVTPSLLGYKEEKQDSSAIVPAGFLVSFAWEQVPGVQLGDSLGGKVFWGMSDHQ
FT                   RHIIREAFKNKTIPETETIGIHPLFYGPSHLVWDSVSGNLFMVGFRQWIEVKPTPWSEA
FT                   KSYWFDLAKPPKKVNWSEFVKNPDTSNWEF"
FT   CDS_pept        join(complement(1050224..1050307),
FT                   complement(1049925..1050119),complement(1049677..1049730))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949962"
FT                   /orf_name="Pc20g04670"
FT                   /product="Putative uncharacterized protein Pc20g04670 "
FT                   /protein_id="CAP85796.1"
FT                   /db_xref="UniParc:UPI0001831765"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE37"
FT                   /transl_table=1
FT                   /translation="MAVAAGDLMGTQMKRAPEKWWDRTEVSLNQPGLFIEKKSWKCMKS
FT                   DDKEKEQSPMAFPFAALWFFSSLYEAKGTLMIVFLQLLVKNLGATKEADFVAIGVSEAE
FT                   GVCDCR"
FT   CDS_pept        join(complement(1051581..1051824),
FT                   complement(1051478..1051534),complement(1051149..1051429),
FT                   complement(1050636..1050980))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978100"
FT                   /orf_name="Pc20g04680"
FT                   /product="Putative uncharacterized protein Pc20g04680 "
FT                   /protein_id="CAP85797.1"
FT                   /db_xref="UniParc:UPI0001831766"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE38"
FT                   /transl_table=1
FT                   /translation="MFRTATTLSQAINKPHAARGNISSPQFYQLMHEQDGDDARLPSVR
FT                   LSLLNASEVEHILCLEPAKTNQGLDSFPTIPPPELLLKNLAMIDGALKNEKSAEATMDS
FT                   YSEKEELLEIHREPKWSFGPVRYKDQAVKLSGYPSYALWYGDEDEAALKVIVTQSKRLK
FT                   RYDKGIPEVLGYIGEYNVPLLVMQCLLTDLVFVTATLDSEVDLEKVFSLLVHILKEALI
FT                   VQSTQPKEPSMQSNQGEGSAEPLVPAGSSLRRKVAKKTQYKKLKAAVALDEDLDYYDID
FT                   ERDLEAEFPADETSEDEYCEDDYAEDE"
FT   CDS_pept        join(1052849..1052878,1053110..1054150)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000201478" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824909"
FT                   /orf_name="Pc20g04690"
FT                   /product="Pc20g04690 protein"
FT                   /protein_id="CAP85798.1"
FT                   /db_xref="UniParc:UPI0001831767"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE39"
FT                   /transl_table=1
FT                   /translation="MLRPRCCSAPFSTLLLDPPPATPAVTDGFPACFRIRSNRVMLPAN
FT                   SIDEFISSELSLRRLEVLERHLWFAGEERSAWPLHHHILVGRKILITEQMDLHLLWAND
FT                   GRLFIKPLSRFLLNPEFWSKKLSCEEPTKCKDHRPTPNTSGSPRTTNSTEPLCDRRSLR
FT                   SCAMGFLYTYACLISYESDFRIANENNLLPCRSNGSTFSWEDWKKFVSEILAHYNKDDI
FT                   HPRFHRAELRLARLNTIHRFTQLPLLEPYFRDWRNFGSVFRDNLTWLASATVFVALVLT
FT                   AMQVGLATDQLKGSKSFMAASYGFTVFAILGPLCAFGLIILGVLHHLLKELPWLLRGEP
FT                   TPLKSPPVSARSMSQV"
FT   sig_peptide     join(1052849..1052878,1053110..1053148)
FT                   /db_xref="UniProtKB/TrEMBL:B6HE39 "
FT   mat_peptide     1053149..1054147
FT                   /db_xref="UniProtKB/TrEMBL:B6HE39 "
FT   CDS_pept        join(1054706..1055500,1055550..1058976,1059010..1059254)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201479" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672210"
FT                   /orf_name="Pc20g04700"
FT                   /product="Pc20g04700 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85799.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001831768"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE40"
FT                   /transl_table=1
FT                   /translation="MPTFNSSGFKSSNPDEPLETSQNVRGVKLDQVYPPPESTAETDID
FT                   IIAIHGLDTKSPDTWTWKKDGISVNWLKDSNMLPEKVPMARIFTCDWPSDLFERRDFVQ
FT                   KTIEEFARLMLAGIKGRRSSMNQSQLQGSERPIIFVASCLGGVILMKMLVMATHEYDCV
FT                   KKATRGFVFLATPFRGTSFEEVVFWAKPGLITRGLFRGKKPSNLMNYVMPARDLEILVG
FT                   QFSTVCEDENLTNDLFTFYETGVTSLPRKAIPYIPKALAKLKPLVNSSSATLDFAKHPL
FT                   PIEQPHVLVNKFQGPGDPGYCHVSDAVQGLVCKARSGRPIERAKAWIRDNRYSLRKLEI
FT                   ERLSGKKLPMDQCYINLAIVEQQRSISQSDKTKTAFEYSPFSLQTRLNLMAPGEETEAN
FT                   LPNIFEPREKRNGQRMTPNRILIRGRAGVGKTTLCKKIVYEFTYGKMWHSLFEHVLWVP
FT                   LRKLKLKERKKIAGYNFGHMFCHEFFSQIPSTAEMEELSNALWRTLGDGDNTKTLFLLD
FT                   GLDEVSQDVNGDMRDFLEELLNQPNVIVTSRPNAISTAFLRQPFDLELETIGFYPKQVT
FT                   SYIETAFTEIETGQMDSQAVNNIESFLETRQLMQDLVRIPIQLDALCYTWHEFQRKTDA
FT                   VPETMTGVYTAMELSLWKKDVVNLGRRTEVEIEFASDGTIRKLVKLEAEALQLVAFTGM
FT                   YNDIIDFAPQHRDTIFEHVDSNCLDDQWLGRVSFLRTSDSSSDNRNRDYHFLHLTFQEY
FT                   FAALHFVRKWKADEDLEFSNLATGEKIRISPAEFLGINKYSARYDIVWRFVAGLLDLNG
FT                   GPKEPERFFRALDQKPLDLLGIAHQRIVMNCLSEIQSEFSLRSKIESHLSKWLAFQCKT
FT                   ILEQDQRLLKESIITLASEIEFPENALTGLLKENDEKVMTVALLSVKKRHQIQSQIMEI
FT                   ATSLLQRTKSSDVAISMFTFLRRQRENLSEESLDLMVLHLQNPDRGVRLSAADTIRGFA
FT                   LPDRTCRKVIETGVIQRRRDNRFEGFEGMALSDQSMSKETLTDLIASLESPDKNIRRVA
FT                   SDVLSHRSDFLPEEVTSIMAKIEHQDSDVRWCSFNALRGQSHSSGMFTGLLWPEVNGSS
FT                   KKISNCALEVLYQLSNSSEDLLERIIVELLPHRSCWHILKSYCNRSRLSKKALNALETH
FT                   LGSPDYGLRCAAINILAGQPDLSFSILNRIVEQLEDGTSKVRTAAVYAIRRQPRLPIET
FT                   ALEIARRFKNDKLPSKIVLQIFEHQSNSPKEVLVQIARCIEDQDVSIRSAAIRALSGQS
FT                   NLSDLPEIHEKVIAYIEDSDAEVREAAIQAVSVGRPSMSDTTFDTIATRMDDTNEKVRL
FT                   AVVQVLGQKETLCFDIVNTLADLMNDTDEKVRWATLKVLADQSTWPGAIRHKIASKVYC
FT                   PLAFRVKREEFHLNFLLGGLAKQILRLLLLRTSRMHLAWYIHNDMSYVERSDGSKAPLP
FT                   CAGADIELGMMSAREEAGIPPVAVLYS"
FT   CDS_pept        join(1062362..1062527,1062593..1063293,1063357..1063629)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000044165" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672211"
FT                   /orf_name="Pc20g04710"
FT                   /product="Pc20g04710 protein"
FT                   /function="asparaginase activity"
FT                   /biological_process="asparagine metabolic process "
FT                   /protein_id="CAP85800.1"
FT                   /db_xref="GO:0004067"
FT                   /db_xref="GO:0006528"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="UniParc:UPI0001831769"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE41"
FT                   /transl_table=1
FT                   /translation="MGFSLQALTVSALAITSYASPLIHSRATNTSYTNSNGLTFNHFNG
FT                   SLPNVTILATGGTIAGTSDDKTATAGYESGALGINTLLSKIPEIFNVANIAAVQAHNVN
FT                   SGDISSSLLLNLTHTLQATVCDDPTMSGAVITHGTDTLEESAFFIDATVNCGKPIVFVG
FT                   SMRPATAISADGPMNLVQGVTVAADNDSRDRGALVVLNDRIVSALFATKTHANTMDTFK
FT                   AYEQGNLGFIVSNKPYFYYPAVQANVKHVVDVSNVDSVPRVDILYAYEDMQVDSLYSAM
FT                   KNGAKGIVVAGEGAGGVATDFGSAINDIVKKHNIPVVLSHRTVNGEVPTADFTGEDAQT
FT                   KIASGLFNPQQARILLGLLLAEKKGLKEIREVFLKATVA"
FT   sig_peptide     1062362..1062418
FT                   /db_xref="UniProtKB/TrEMBL:B6HE41 "
FT   mat_peptide     join(1062419..1062527,1062593..1063293,1063357..1063626)
FT                   /db_xref="UniProtKB/TrEMBL:B6HE41 "
FT   CDS_pept        join(complement(1065671..1065806),
FT                   complement(1065497..1065576),complement(1064925..1065407),
FT                   complement(1064020..1064859))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000276708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978101"
FT                   /orf_name="Pc20g04720"
FT                   /product="Pc20g04720 protein"
FT                   /function="dihydrolipoyl dehydrogenase activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85801.1"
FT                   /db_xref="GO:0004148"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="UniParc:UPI000183176A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE42"
FT                   /transl_table=1
FT                   /translation="MFRAVLPRATPRSALRHAGPRAIPNNFATSMIFIGQSKRGFASEA
FT                   GDHDLVIIGGGVAGYVAAIKAGQEGLKTACIEKRGKLGGTCLNVGCIPSKSLLNNSHLY
FT                   HQVLHDTKKRGIEVGDVKLNLTQMMKAKDTSVDGLTKGIEFLLKKNGVDYVKGAGSFVD
FT                   ANTIKVALNEGGEQTLRAKNIIIATGSEATGFPGLNIDEKRIITSTGALALTEVPKKMT
FT                   VIGGGIIGLEMASVWSRLGAEVTVVEFLGQIGGPGMDAEIAKQAQKILGKQGIKFKTGT
FT                   KVVSGDDSGSTISLNIEAAKGGKEEVLDADVVLVAIGRRPYTEGLNLEQVGIEKDDRGR
FT                   LVIDQEYRTKLPHIRVVGDCTFGPMLAHKAEEEAVAAIEYIKTGYGHVNYAAIPSVMYT
FT                   HPEVAWVGQNEAEIKASGVKYRVGSFPFSANSRAKTNLDTEGVVKFIADAETDRVLGVH
FT                   IIGPGAGEMIAEATLAIEYGASSEDIARTCHAHPTLSEAFKEAAMATYSKPIHF"
FT   CDS_pept        join(complement(1068248..1068496),
FT                   complement(1066897..1068177))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167003" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129269"
FT                   /orf_name="Pc20g04730"
FT                   /product="Pc20g04730 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP85802.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183176B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE43"
FT                   /transl_table=1
FT                   /translation="MAEERGNEVDTKTPDLPSQHGDTRQQGYSQFTVAQKRAIVAMGSL
FT                   ASFFSPLSSSIYLPALTSIANSLHISISQVNLTVTTYLIMQGVAPMLIAGFSDTAGRRP
FT                   AYTICFAIYLAANLGLGLQNSYAALLVLRCLQSAGSSGTVALANGLVGDMITSAERGSY
FT                   IAFASVGSMLGPSLSPIIGGLISQYTDWHWIFWFLLIFGGVFFLVLGLFLPETCRKVVG
FT                   DGSIPPPPLNNSVADIIRHRTRKQKGLVPDPYKEAEVRKNYSLRFPSPVPTMKVLLDLE
FT                   TSVILLTTGLLFAGFYAVMTGASTSFHKIYQFNDLHAALMYLPIGGGGVLSAFTTGRLV
FT                   DWNYRRHAKRAGLTVVKNVRADIRNFNIERARLEVALPLYYISNLAMLTYGWVLGHKVN
FT                   LAAPVILLFIIGWSIIGTSQVLNALMVDLWPGKSAAATAANNLFRCELGAAASAAISPM
FT                   RSAMGEGWAYTTLALIPIAVSPCLWMVALNGIKWRQKRNRKEEEKSSCEQD"
FT   CDS_pept        join(1070317..1071148,1071198..1071340)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949963"
FT                   /orf_name="Pc20g04740"
FT                   /product="Pc20g04740 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85803.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI000183176C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE44"
FT                   /transl_table=1
FT                   /translation="MIFSAKAIGIGALLSAVPVYAASYSQTKVYDSTNFFEGFNFTSDP
FT                   DPSGGFVKYMDAETAKSAGMAKISNGAVYLGANYVDKSPNGRPSTRVRSKDVFTTGLFV
FT                   ADIAHMPAGTGKGGSCGIWPAYWTSGPNWPNSGEIDIIEGVNGQKSNAVTLHTAKGCNM
FT                   DVSGSESTANQTSADCEDSDAGCSQGTTSANNYGAAFNANGGGVYVTEWASLSISVWFF
FT                   PRGSAAANAVINAGPGDLDVAKFGAPLARFEGNTCDIAERFKSNYIIFNTNFCGGWASR
FT                   EFLKDETCASLADTCDAWVANNPAAFKDAYWLVNSVKIYARND"
FT   sig_peptide     1070317..1070379
FT                   /db_xref="UniProtKB/TrEMBL:B6HE44 "
FT   mat_peptide     join(1070380..1071148,1071198..1071337)
FT                   /db_xref="UniProtKB/TrEMBL:B6HE44 "
FT   CDS_pept        join(complement(1072920..1073193),
FT                   complement(1072712..1072821))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129270"
FT                   /orf_name="Pc20g04750"
FT                   /product="Putative uncharacterized protein Pc20g04750 "
FT                   /protein_id="CAP85804.1"
FT                   /db_xref="UniParc:UPI000183176D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE45"
FT                   /transl_table=1
FT                   /translation="MAWLSVQDDLRISPAWSVPDVLQVSRRFYPLRVFLSPGRSFPKFE
FT                   GRVTVAHVIGCYVISAPSRYGLTFLPWFHPWITLFKTTLKNGIGVLSNYTRIITEPVYS
FT                   NGLALTRALWATTTVACAHRSVV"
FT   CDS_pept        join(1073807..1074203,1074258..1074411,1074463..1074937,
FT                   1074992..1075227,1075281..1075371,1075428..1075778)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949964"
FT                   /orf_name="Pc20g04760"
FT                   /product="Pc20g04760 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85805.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831840"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE46"
FT                   /transl_table=1
FT                   /translation="MSDKISSWNVVHKLEKRQLLIGINCVAGLSILFFGYDQGMMAGVN
FT                   NSKDYIDLMKFGYTKVVDGEVTPVVTNSLLQGGIVSVYYLGTLFGALLGGWLGDWTGRI
FT                   KTIAAGSLWAILGAALQCSAQNHNWMICARFVNGIGTGILNAIVPVWATETAEHTSRGQ
FT                   FIAIEFTLNIFGVVLAYWLEFGLSFIDNGESAFRWRFPIAFQIVFLIVLFAVVWFFPES
FT                   PRWLVKVGREEEARYILQRLRGSSGEDLLRAEAEFQDILSIAELERTVNHGDSYLSMLV
FT                   GYKSGDLHIGRRVQLVIWLQIMQEWVGIAGVTVYAPTIFGIAGFDSMKSQWISGLNNIF
FT                   YMFATLVCVFTLDRIGRRWTLYWGATVQGIAMFLGGGFSRLAIDSKAAGDMAKASSYGA
FT                   AAASMIFIFTSAFGASWLTVPWVYPAEIFPLAVRARGNAFGVVGWSIGNGWLTLLCPVM
FT                   FSAIGEKTLYVFAASNVIAIPMVWALYPESNQRTLEDMDLLFAAKTPWTWDAEKTFARL
FT                   KAENPGMVQSLGPKGSLVDPETGKPLSAAAAVAASKAGDNAVGAEHVDHA"
FT   CDS_pept        <1076295..>1076777
FT                   /pseudo
FT                   /gene_family="HOG000048347" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(1079873..1080252),
FT                   complement(1079574..1079817))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978102"
FT                   /orf_name="Pc20g04780"
FT                   /product="Pc20g04780 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85807.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831841"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE86"
FT                   /transl_table=1
FT                   /translation="MQSPFSYPDSYSSSYSSSPGTMDFFFYGGQPVYDTLCDLDTTTSF
FT                   PMQEVTPEVYGITSSPYTYQRPQDFPVFERPVMPQSAPSSCGSSYSSSYSSSFNFPSED
FT                   VSLPSYPISEYEPSADSPAPASKPVKPFGCDHCGRAFTRFADLKRHQSSVHYPVFRNCP
FT                   VEHCSRKGSNGFPRQDHLVEHLRSYHHLDVPKRGSCKRSAKQMS"
FT   CDS_pept        join(complement(1084013..1084267),
FT                   complement(1082455..1083932),complement(1082319..1082379))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949965"
FT                   /orf_name="Pc20g04790"
FT                   /product="Pc20g04790 protein"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85808.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR007207"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR012270"
FT                   /db_xref="UniParc:UPI0001831842"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE87"
FT                   /transl_table=1
FT                   /translation="MAARKTQQEIEKTFKKVSEGIQTFEGIYEKIRQATNPTQRDKLED
FT                   HLKREIKKLQRFRDQIKSWAAGNEVKDKAPLMEQRKAIEVCMEQFKAVEKEMKTKAYSK
FT                   EGLSAASRLDPKEKERVECSEFLSNMVDELQLKIEALEAEEETLHAQMKKGKKDTKKAD
FT                   RMADISHVTERHKWHVNKLEFLNRSLQNGNLDVGAVQDLKESIKYYVEEGGSPDYSGED
FT                   ETLYDDLNIGDDVEAQFGMGGDGDRVSSQDAQSVQDEEPEAKPKAKQEGPAARRPSTQM
FT                   KSPLPVLATLHPSASSSATPGMKPAPLPTRPPGETLKYASAAAAAAASDKSGVGILPLP
FT                   PPPGFSPALSVSLPVPKSSTASPSVASAQPVTKSIIPPTVAAVTEELSGPARSKAPVSG
FT                   NVSSPAPAKMETSTNGKPETEGTESEESVYHLPPGLQDLLQSFEVTKSRASANPSPSVQ
FT                   RLLATSLTTCPEAGDAEKPRHYKPQNPYSTALYYPQEPLSIFDDPRLYDTGRIDTDTLF
FT                   YLFYYRQGTYQQYLAAKALRNQSWRFHKQYQTWFQRHEEPKNITEEFEQGTYRFFDYES
FT                   TWMNRRKADFKFVYKYLEDEL"
FT   CDS_pept        join(1084791..1084797,1084850..1085028,1085080..1085122,
FT                   1085184..1085410,1085478..1085609)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949966"
FT                   /orf_name="Pc20g04800"
FT                   /product="Pc20g04800 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="D-amino acid catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85809.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="GO:0019478"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="UniParc:UPI0001831843"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE88"
FT                   /transl_table=1
FT                   /translation="MKLVIQRVKSASVTVDSELISSIGKGLLVFAGVGKEDTEKDAENL
FT                   VNKVLKAKFWPDENGVQWKKNVKDIEGEVLCVSQFTLYAKMKKGNKPDFHDAAAPEPAR
FT                   KLYDFFYAKMGEGYTPDRVKNGVFQAMMDVELKNDGPVGVNYCSEDAAVTIEINTNLPK
FT                   KEPKEQQNGDKKTDEQEIKGSFEFQIPPELLQ"
FT   CDS_pept        join(1085871..1085886,1085956..1086020,1086083..1086092,
FT                   1086147..1086233,1086297..1087237)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065980" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949967"
FT                   /orf_name="Pc20g04810"
FT                   /product="Pc20g04810 protein"
FT                   /function="binding"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP85810.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI0001831844"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE89"
FT                   /transl_table=1
FT                   /translation="MATAQRSRVFFDIKIGDSKPSRVAFELFNDVVPKTADNFRALCTG
FT                   EKGIGTQGKELTYKGSIFHRVIKQFMIQGGDFTAFNGTGGESIYGEKFPDENFDLKHDR
FT                   PFLLSMANSGPGTNGSQFFVTTVPTPHLDGKHVVFGEVINGKSVIRKIENVKTQSDKPF
FT                   QDVTIVDCGELSGEDYENATKRQQDATGDPYEDFTEDHQGEELTAPLCFKIASDLKGFG
FT                   NTAFKSGDLDLGLDKYQKGLRYLNEFPDPGENDPKELGEQMKALRFTLHSNSSLLANKL
FT                   QKYRQAQNWATYALQVADSANAKDADKAKAYYRRAVAHGGLKEEEEALKDLQEAEKLAP
FT                   GDAGILNEIAKVKKTVKDREAKDKAAAKKFFS"
FT   CDS_pept        join(complement(1089126..1089200),
FT                   complement(1089057..1089075),complement(1088696..1088984),
FT                   complement(1088360..1088636),complement(1087727..1088305))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000080362" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949968"
FT                   /orf_name="Pc20g04820"
FT                   /product="Pc20g04820 protein"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /protein_id="CAP85811.1"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniParc:UPI0001831845"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE90"
FT                   /transl_table=1
FT                   /translation="MGIKGIRTALKVDLNKLAREQPGLHNRWHPDVPSYGKIVNNEVVK
FT                   IECLDWTGGQIGNNDSADDIKNVDLTQIHYLSGPFDIETAEPGDVLLVEIQDVQPFEEQ
FT                   PWGFSGVFHKENGGGFLDHLYPEAAKAIWDFEGIFCSSRHIPHVRFAGLIHPGILGCAP
FT                   SAEVLAEWNRREGELIATNTVADRIVAQPPNPRNAHSGHATDEVKNKIANEGARTIPGR
FT                   PEHGGNCDIKNLSRGSKVYLPVHVPGAKFSVGDLHFSQGDGEISFCGAIEMAGVITLKF
FT                   TVIKNGMAKLDMKSPIFHAGPVEPQFGPGRYLTFEGFSVDENGKQHFLDATVAYRQTCL
FT                   RVIEYLRRYGYSDYQIYLLLSCAPVQGHIAGIVDIPNACTTLSVPMDIFDFDIRPEADV
FT                   VKKDMGACAFVTK"
FT   CDS_pept        join(complement(1091115..1091172),
FT                   complement(1090755..1090861),complement(1090527..1090699),
FT                   complement(1090079..1090472),complement(1089672..1090028))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949969"
FT                   /orf_name="Pc20g04830"
FT                   /product="Pc20g04830 protein"
FT                   /biological_process="cysteine biosynthetic process "
FT                   /cellular_component="Gram-negative-bacterium-type cell wall"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85812.1"
FT                   /db_xref="GO:0009276"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0019344"
FT                   /db_xref="InterPro:IPR007496"
FT                   /db_xref="UniParc:UPI0001831846"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE91"
FT                   /transl_table=1
FT                   /translation="MSNFEPNAVIRGFQLTVVGTVRALANPELFKYDHFRQAALAIAIG
FT                   TVIQLIIQIPIFSVKFSIYILSWVVNLEQAVWDDKLLNGLEFMSKSVLQVPFLLMTLMR
FT                   YVTPTLDEIFMQSIQWVDTTYIQKHKSEDPRQLRSLYYPNLVQYSTKGGSSVSRSIPEA
FT                   LRSFFNRYAKKIGMMLGLYLLSMVVIIGRFVMPAASFYTFRSHVGSTPAAVIFGVGLFL
FT                   PKKYIVTFLHTYFASRSLMRELLEPYFWRIKFTPEQKRRWFRDREGVLFGFAFAFTVLL
FT                   RIPYIGVLMYGVAEASTAYLVTKITDPPPPPAESTNFAESQVTWRNKHDFLRLSLDNLD
FT                   KLNVDTVERDDKDSGSPGKKFS"
FT   CDS_pept        1091509..1093689
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129271"
FT                   /orf_name="Pc20g04840"
FT                   /product="Pc20g04840 protein"
FT                   /protein_id="CAP85813.1"
FT                   /db_xref="UniParc:UPI0001831847"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE92"
FT                   /transl_table=1
FT                   /translation="MPESPSELGQIQSLRRSLTLPTKLNPLAQRRSSVPNTPEHVIFYH
FT                   PSAKIVHFSPRALAPIPSSSAPSDFDYPVDTIETLPWRSATERTVATAPLRLEKVHGST
FT                   AFLKCGNVVHAILKNSQCWCVDGVSKFVLRIRPLTYYRIEIPYETEDERSLVRDLKIAL
FT                   PTVLRYEVTPCPFKRAFSVELPSDAMAPRRKKAWQPKDRRERVPTVLEPRRETPSPSSI
FT                   RSDCIDSASTGDDTDGNLTDDSCFTSNKANSTVLETIPDDRESSPVEALSPSPYLGPPR
FT                   RSVSETPQTFTSLLAKFEATSVAENDQDSELVLKPEYASRADVVPEIDHELKVAEQLEP
FT                   EFLADGVEAGPGSETVLDAESKTAAQPGDKPEHDPEAILHAGRSSEAAVKEEPIISAET
FT                   DAALAAETSEEAVFRAEPTTAVEAEAVPEGNVMNVEGVQIIQPAAEPTLDIDHDASFAS
FT                   NPESFHSAEPHSPDSVSTHPTSVGGHELPESEEKFNISSTNHIISGYESAPADPCKTSQ
FT                   PPTLNIPQSDHASNQTSLPGPPLVHGTSSNNLPRRFADAFSDTSPSMAPTSNENPPSRS
FT                   TDASSDTHMRPSVHAKAAPLNTDFDHMSAEFRRRSKATRERDVSPMPHSSALYQPSGDD
FT                   GTSFISKAITLVLIPPAYLFVILLHIAARVVISPAIHPTISSTSSEPHSQPQQTRKDPA
FT                   AEDDFSFPLEPQTSSEYEDAQLFKKLDPWDLD"
FT   CDS_pept        join(complement(1094814..1094840),
FT                   complement(1094364..1094723))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978103"
FT                   /orf_name="Pc20g04850"
FT                   /product="Pc20g04850 protein"
FT                   /function="7S RNA binding"
FT                   /function="endoplasmic reticulum signal peptide binding "
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /biological_process="negative regulation of translational
FT                   elongation"
FT                   /cellular_component="signal recognition particle,
FT                   endoplasmic reticulum targeting"
FT                   /protein_id="CAP85814.1"
FT                   /db_xref="GO:0005786"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="GO:0030942"
FT                   /db_xref="GO:0045900"
FT                   /db_xref="InterPro:IPR003210"
FT                   /db_xref="InterPro:IPR009018"
FT                   /db_xref="UniParc:UPI0001831848"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE93"
FT                   /transl_table=1
FT                   /translation="MAPHLGQDEFFKSLGELLSKTSQQHQGSVYLTQKPLIDVPGATTT
FT                   NSQPSILIRATDGNTNTPNLKKEGKDKKSQKVKLSTIVNPDEIEAFYVRYAEVCKAGMT
FT                   GLKKRDRRGRKAKTKGGAAKVTKA"
FT   CDS_pept        join(1095157..1095225,1095291..1096605,1096662..1097848)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949970"
FT                   /orf_name="Pc20g04860"
FT                   /product="Pc20g04860 protein"
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="CAP85815.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001831849"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE94"
FT                   /transl_table=1
FT                   /translation="MSTVTRSVASTDLPRAKNAAKMSRSQQKPQKRARGDSDEDSADED
FT                   LDLNSDDMDLDEGLSEPQTKSKSAKEAAKKPKSILKKAAVPQDSESDSEPESGFGSEID
FT                   LDEDEDEDEDEDEDEDEVDESDDESEDDTYEGEPKETEAHIPGSVKAKLAQDDAEIAEL
FT                   EKRLGLKKGGKLPKAFEEDGLDELLGDLAGGADASEDESKKRKREADDWLRNKRLKAKS
FT                   LQAQQVEKDESEMDSAEDFDLDEEIFGGDDSDEAAEGSDFDGFDEEEPKEPKKKENPYI
FT                   APVTKPEATAQKYIPPSLRARSDPESESLTRLKRQAQGHLNKLSEANMLSIVAEFEKLY
FT                   RDYPRQHVTSTLVSLLMGLICERAALQDTFLILHAGFIAALYKLMGMDIGAEIIQTVVE
FT                   TLDAGGDERGSFQGKEATNLVSLLSQLYNFHVVGSSLMFDYVRLYVQDITESNTELLLK
FT                   VIRNSGPQLRLDDPSALKDIVLLIQPAVAKAGEDRLSVRTKFMIDLITDLKNNRSKASA
FT                   AAGAGITTEHITKMRKILGSLNSSRVIRASEPINISRDDIHNSSKKGKWWLVGASWKED
FT                   PLVTAQREMAGVQVTQPEARDDESDGEPDFGVLARAHRMNTDVRRSIFVAIMSANDFQD
FT                   AHVRLMKLRLKRAQEFEIPRVLLHCAMEEEAHNPYYSLIARRICGEQGRRIKMSFMFAL
FT                   WNVFKKMGERGDIDDDEETNFDPDDEENGVSMKSVVNLAKMFSTLIVDGTLTLSILKNL
FT                   NFAYLQPKTKTFVEVLVISIIQQSQKSKKKKKSKSSMPDESEKNEGPLMQIFLRVKETP
FT                   HIAKGLIYFVRKVVAKSDIVSSEELKLVRWGCNVAADALKAVAE"
FT   CDS_pept        join(complement(1100009..1100012),
FT                   complement(1098540..1099972))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949971"
FT                   /orf_name="Pc20g04870"
FT                   /product="Pc20g04870 protein"
FT                   /protein_id="CAP85816.1"
FT                   /db_xref="UniParc:UPI000183184A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE95"
FT                   /transl_table=1
FT                   /translation="MYWPQAPSPFRLPRRNPSARRSGPQFAPTPRFLLSQNTTQKEDDD
FT                   LDVIDDDGPSSTREAVRNPPATQNATRARRQRDVIEDSDDAADIDDVRIGGRDVDELPD
FT                   DAIDSTPPEEPETPGTLDAEFDALFAPVRDGNKRRRVEGVAPFTRSNQTQIDPILSSPP
FT                   GTANPPADSIDYPDKSRQSTTTWDMGTQRTPAPSARPLVPVTSTPSSIKTPFRSRPRFM
FT                   LSLTAKPPSSQSAPISKPDTPGISPPERRKPAFVLPRSPSPNPDADDIPAPFSPSSRTL
FT                   RRRGRNRAGVSNYIPGGMAAEVRGWILEMGTQRDQLPKPPLPQASDLQTADASLEKLNS
FT                   YLLTARVIDVSQSALSGCGSFTFIQAEVLSGNHVQAKNPDFTLNIMVMGPPRSKSAVRH
FT                   IPSHSDGTIIPYLRKGGVVGIHRGLNWALELGNHFFEHRTPAQASDRVSEYGPSENGGH
FT                   PEAKEGWLIAMEWDILATAP"
FT   CDS_pept        join(complement(1101212..1101606),
FT                   complement(1100540..1101086))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000191043" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978104"
FT                   /orf_name="Pc20g04880"
FT                   /product="Pc20g04880 protein"
FT                   /function="acetyltransferase activity"
FT                   /protein_id="CAP85817.1"
FT                   /db_xref="GO:0016407"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="UniParc:UPI000183184B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE96"
FT                   /transl_table=1
FT                   /translation="MCPDIDWSFRPTYSPDQLNHYFDRINFPQKYRKSDIVKNGATINN
FT                   QPALSFLEVLQRYQLAAVPFENLDLHYSAHRNISIDAQGIFEKIVEGNSDRGGYCMENN
FT                   TLFGTVLRSLGYNTTSVGGRVNEAVQPMNHMINIVAIGEQKYLIDVGFGSNGPHRPIPL
FT                   VHGFGFHNVGEQSGRLLYGPINQQTHRGESLWQYEINRNGRWIPAYCFTELEFLPEDFT
FT                   IINYYMSQSRESWFTFYVVCVRMLLDEKGEAIVGDLTLFNNTLKRRVGATSEVLQCFAS
FT                   EEERVVALQKHFNIHISGADQASICHTVSGIL"
FT   CDS_pept        join(complement(1103527..1103773),
FT                   complement(1102388..1103471),complement(1102167..1102200))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000166536" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129272"
FT                   /orf_name="Pc20g04890"
FT                   /product="Pc20g04890 protein"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85818.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI000183184C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE97"
FT                   /transl_table=1
FT                   /translation="MAKTPQDLQIAILGAGMGGLTSALALAQQGFKNIDVYENARDLGF
FT                   VGAGIQLAPNMARVLDGLGVWKGIEAEAVNIEDTSVRDGATDTEHAYVDLRYIEDTYGY
FT                   KHMVGHRASLANGLYDGCKQHSAIKFHFGINADNVDSFGPRPSFTANPRAEGAAPFKVE
FT                   CDVLLAADGIKSVTRTEMLKRLGIDVGVKDTQQAAYRIMIHKEQIKDDPELLALINSNR
FT                   VTRWIGEKRHIIAYAVSNNTIYNLSTTQPDTNFAAATNATYTTKGSKPAMMGVFSDFCP
FT                   MVQRMLNYVPEGEVCEWKLRVHEPLPTWVHDSVALVGDACHPTLPHLAQGAAQAIEDGA
FT                   VLGVVLSKLPDTTPESINKALRVYEKVRKSRAEALVEMATASGRALHLGEGAAKEERDK
FT                   QFAALRAGKGPVPDKWADADVQREIYGFDCTKVAADNFNEYFSQMDTSPRQYKLA"
FT   mat_peptide     join(complement(1103527..1103692),
FT                   complement(1102388..1103471),complement(1102170..1102200))
FT                   /db_xref="UniProtKB/TrEMBL:B6HE97 "
FT   sig_peptide     complement(1103693..1103773)
FT                   /db_xref="UniProtKB/TrEMBL:B6HE97 "
FT   CDS_pept        join(1107314..1107593,1107650..1110696,1110752..1110826,
FT                   1110875..1113250,1113329..1115417,1115476..1115972,
FT                   1116053..1116754)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234787" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949972"
FT                   /orf_name="Pc20g04900"
FT                   /product="Pc20g04900 protein"
FT                   /protein_id="CAP85819.1"
FT                   /db_xref="InterPro:IPR022099"
FT                   /db_xref="InterPro:IPR022105"
FT                   /db_xref="UniParc:UPI0001831922"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE98"
FT                   /transl_table=1
FT                   /translation="MAVDHDLSSFVFNHIFYPPELPQEAENNLTELENRLTVLVRDVLQ
FT                   DFVQSLGPGSQQRWGIVLSMLDTWIKVHTDQGIVQIALEKGVSNLKYTGAVACHIRAQN
FT                   CGWVASYDVNKDRVLVDAFEVSCQDGPVLSSSGGLLRQFPGVSVAISADKLADPTFCSY
FT                   LAAEISQLTREEVSEMLPKSSKAGTEVDEIRETTHPGLVTEGLMTQLLALGTQHEEGRF
FT                   VKCVRDEVNWDRALLPWRRSPAWLVLRVALQLVLRRCFPETDSRLQYKNFILYLMATLA
FT                   GDQILSVGSHTVVDGCEIMRARLGRRLYKLEDEVFPFVANRAHSTTKVLLGKLMSIQKQ
FT                   IKISNSVEIPLIPPSASEDDVHLSLVHCRDYLQAAMHPSTGKVKPKKFRRTQGFNLNWS
FT                   NGLPVPKFGSIMALSEFEQWIEEHLQSWFVDQPASKYESACCEIESIMAQYISMAQPKY
FT                   YSNPQATSVMILVVLELWVVLDKMAVQLCPLLGKFSTDIPESFLEPLLLPKIGQMERAR
FT                   EVEQHIDVRHKEALETNPSIFCDPMKNCFGAQYFDSSDDHQALEREIQQHATQTRAAKR
FT                   VEWEMLSAEYKRTCQTGENLSHFYDYNRHGEYVHFNHRCEKCSLQRQAASMSIRIHEWP
FT                   LPTDVNERKTAVFELDIPTWFASWRNTTWKILHAVGRRGTVAADNNQVEWLQYRDIETF
FT                   AVRRDSNIILVSNSKSWGNTHYRTHKFPVPYDDIGIPNGLCLKFLDQVSHGWVREQTEK
FT                   PTIKLMCTIQLPSGPYSNLQYTLNSTSHTQNLVIATQNDCDKTLSLHEFEAYGCLRSGE
FT                   RVQWCNIARNLASSTLSLNEEAVSSLFKQAAWELGSRSGSVRRLAHQAFEDTGFGDCLL
FT                   DLLHERLTAIKRNWNEHCTFDLIVTLGLRVLALSSRSPSVEKVIEFLRQCRQVAIDWCD
FT                   ELNGVSDDEGNDGGSQQQLILRIASTCQATYDVDPIHLKTAIETPRDVFCFVRSSILLF
FT                   ANSPPETDSPPPEAKLFLENAERIRSVLRSRIRCMILDCPSGLNDAIQSSITCLEVSGP
FT                   WKICQGSDIWVTAETRNSLRGFKQRLHFNCLTGELLVDGNRPGRLPAEFTCDPLYQRLF
FT                   GTRVLPVVPSSLPGASFVLSRNIEDLEVHFGMQGKKLSIKTRKGSQILQLIPPEVFVND
FT                   FPRVFISDNFHWLDLQTGLLEFRPLKNPWKACSTNWRLSFDPYAPSVMQQDSKSLVDIR
FT                   SAPVKKICRILRVLDASDEIVVTQTATGTLEAELSRLRLKFFVNDNGRVASKEFGALID
FT                   VDQDVGCFYGLRNKLVLVDSSNNRSVIVPYGHPVVNRKHDHVAVTIDLRAGNRVKYMHY
FT                   CLDSHLQLLRGFYPLAILYQAYLHALTSFPVADDLTHRSGTEEAIRILRQGSLRSSFPL
FT                   QNDCIETLKWIASLTPHRCFYPRHLRVMQTVTWSSNLGQLAQHDDFQPLAQDILQFSVQ
FT                   CAHFHDAKSNGNKISYRGNRVLLQRARCRNEQLRSSEFSGPPTSFTKKVYKSRDCDSTS
FT                   ARSSAVYSITGLIRDWPLTVDHSSSIVATMTQFKEVSMLSDDFTRCSYSEILSQSAPSS
FT                   WVSLYKVCQSSSRTRDTYSLISLFSALAFGGNIDQSILRQLLQVAFSEKCKDVAVPRDS
FT                   RTSLNLTLGEDLVLSQVEDAIRESYEPFTEIRKSYLTYGEQVESNRRAKLKWEDQRKQD
FT                   VQLCGEHIREQWPCKAPQLPSSKMIPRVSKTAAYEKCKILCGNWFQNKNFLAFLRQVQS
FT                   QVPPSNSYNSNVDPVPTSHMHSQEIECTSFQPPRLLDLIQMSHASTPQTEVAPVTYHAA
FT                   SSVLRPTPELWALAKHFQDSPNQCQQDYGNGLSHSVQALEDFSSSVPRTGNFDLSGSVD
FT                   WAAKRTALLSHQNQVQSLRDSLWEEIVIILTISENRSRPSTDTVYPSITVWSSISALRR
FT                   YGRLMSCVETRDMDGFLKDADNPGYEGWDPLIYPTWLLLEIENNITIRKRQAEVALRMI
FT                   EPEDGENAVLQLNMGEGKTSVITPMVATILADGRDILRIIVLKPLLRQSDGLLSQRLGG
FT                   LIQRRIYHIPFSRHTQLTSSTVGQLKAIYRQCRRDRSILIALPEQILSFRLIGLDAAER
FT                   SPDIFAPLVALEHWLQIHCRDVIDESDEVMDTKFQMVYTMGTQQSLDGLSGRWETTQHL
FT                   LRLVSTQAKCLQQDDPGCIEVDQSGYRYPILRFIRPYAVERLVSYTLRSISDNGIPGLP
FT                   FTQWTPRVKGSALRFIQQSELTEEDQSIIQQEFNGTIFITKLLVLRGLFAHCILRFSLA
FT                   GKRWLVEYGLHPSRCLMAVPYRAKGVPSESAEFGHPDVAVTLTCLSYYYEGLTKDQLRD
FT                   CFILLAKQNDPSTEFQNWVAPCVQELPVGLQSYSGINLEDNKTFSEILFPLLRYQKEIL
FT                   DFYLSHFVFPGEAKEFPRKLSSSAWDIPARRGLQLTTGFSGTNDNRFLLPLSIRQRDFG
FT                   ELVHTNAMVLALLLREENRKCILAQDEEGRQLDVDALLKLVATLGGGSTTTQPVRVLID
FT                   VGAQILEAGNQSVAQQWLAMTPEADVEAAIFFSHSDEIMVIDREGHVETLFSSSFRQRM
FT                   GGCLVFLDQQHSRGVDLKLPPMTRAAVTLGPRLTKDRLVQACNRLRGLEKSQSLLFLIP
FT                   PEVSHNMRSVLGISSDRDFTSADVLKWSMAQTCQSLDNLRPLWANQGLQYHRRIELWDS
FT                   LVEQPDPSKETAIAIQEPEARTLSQLYAPWDKDEANAKGYMSECGVENGQVQELLKTLQ
FT                   SASGHITTSAYLHEEQEREIACEVEREQQFPGNRPSKAVTLAFHGLANTSAGKADHPRL
FT                   LAPRLYSTLDFNKTAKESQNNLMDDFCKPVNWILSSAHSDILLIVSQYEANELITIVRK
FT                   SKNSRLNIYAPRLTKPMRSFRHLDFFGIGANISTQPNDSMTRCLELFSGSLYFSSFEEY
FT                   KNFRSFLGLITDYLGELPDGSMTNEGFVKFFTRMSLQWPLDSPFTESPLPFLSALIHIR
FT                   TRGSGYQQSHIDTIIKAMPLSAERFD"
FT   CDS_pept        join(1117584..1117919,1118363..1118477,1118542..1118873)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824910"
FT                   /orf_name="Pc20g04910"
FT                   /product="Putative uncharacterized protein Pc20g04910 "
FT                   /protein_id="CAP85820.1"
FT                   /db_xref="UniParc:UPI0001831923"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE99"
FT                   /transl_table=1
FT                   /translation="MVTNAIDASIAISEHRWMQYDIEEQRALECFRLILCRHLKGAQLE
FT                   LRSSISIWRPRYIQGRCYRSVSLIPKAQQYLIASLDIVRESPRLPCRHRVGRQPGAKGN
FT                   GKGKYDSTNSLLAFNKEDDFARYTPHRAPQIARTFQEEDKPSLQETKMASNNIITLPDE
FT                   LELMQLRQLAVRMTERNNTRANIIRARVAIQSAHVQIMAHYEHGQLPDVLVAVTNAIID
FT                   SLVTLEHRWTLCNIEEQGDLECFRLFLWRQLGSAGTRE"
FT   CDS_pept        join(1118907..1119013,1119102..1119210)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949973"
FT                   /orf_name="Pc20g04920"
FT                   /product="Pc20g04920 protein"
FT                   /protein_id="CAP85821.1"
FT                   /db_xref="UniParc:UPI0001831924"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB7"
FT                   /transl_table=1
FT                   /translation="MPRPNCPWRQIAPKGDGSPDDLGNVPVTLDELEIDACSSHEGHGS
FT                   RMGLCYHAAEIYISFCRITLVADFVD"
FT   CDS_pept        <1120007..>1120274
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949974"
FT                   /orf_name="Pc20g04930"
FT                   /product="Pc20g04930 protein"
FT                   /protein_id="CAP85822.1"
FT                   /db_xref="UniParc:UPI0001831925"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB8"
FT                   /transl_table=1
FT                   /translation="MVYVVKGSALVLSDGTDTETTITLRPYTEGTRGSSMIFGMSPCPL
FT                   MDIKTRMDRALYWAVAGLSQPETTGSSVNYLLPTVKTSRPPRNV"
FT   CDS_pept        join(1122310..1122338,1122773..1122801,1122847..1123087,
FT                   1123161..1123173,1123229..1123378,1123504..1123746,
FT                   1123825..1123971)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978105"
FT                   /orf_name="Pc20g04940"
FT                   /product="Putative uncharacterized protein Pc20g04940 "
FT                   /protein_id="CAP85823.1"
FT                   /db_xref="UniParc:UPI0001831926"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB9"
FT                   /transl_table=1
FT                   /translation="MWTTAEYLLVTSDSESKTIKMTDTREVILLDNLDIAQLRILRVKM
FT                   IGRNNTRAEITRANAAIRSSHAQLMRDFDGQPELLMPATIAMNHSLALLAYMSRIKGFV
FT                   FLPTPRYDTPEVRSLVYLTHLITSYWTLPSRIVTIRGQGRILTPIGDCPLVPEGIEGNR
FT                   VELLACLSWAEQFWLNVEGDFGPGEDGESGFLLPRDLIDGIAACVRHLVSSFDNFTKAH
FT                   RRAHSLAGTNLSHVSSRSSLVVPGNLAVNFDSEWAELSVESSHCPHSRAAEEPARSWYI
FT                   LS"
FT   CDS_pept        join(1126130..1126437,1126844..1127212)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(1128059..1128830,1128924..1129735)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216916" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129273"
FT                   /orf_name="Pc20g04960"
FT                   /product="Pc20g04960 protein"
FT                   /protein_id="CAP85825.1"
FT                   /db_xref="UniParc:UPI0001831927"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC0"
FT                   /transl_table=1
FT                   /translation="MRPPSLLPLLGFIGLSCALSTTVDNEPVKNANHIFNVIQDSMRQW
FT                   GSSLHHNGVSFFLAGVPTGTQFYHGTSKASPVNGTEWLAFEPEHAMVFARPRRGPPPHL
FT                   PPDDPNTERHARGHGELRKRDHYNKDEKHHGPPGGRAPKESDENEAGYLHTYAAAKDLR
FT                   LLYLDGMSAAKTSKGTLDSQDAVLFAGSLDDHPSPGGQENERARLACEMAQSEWEGRID
FT                   GVLRMEAGFEIILCDFERDLIPVRITQVKRSSEEHRDDGNIHGPGGPGGPGAPPHGGPG
FT                   NGPDASRWMRAITARYNGIGGNRVSLNFNHFVTAFSHDVELFRDNSTFPRFVGLSAEER
FT                   AAIRAEVTDLVMTYHPAEVGEDWQAITDMIVIRYSKELSYFVSDSIDSIERLQSEIERV
FT                   LSPFIDYSERDDVAEIERCATQFLPSTSFESGGIAARAVYGVTHRICSSLVEAGKGRDL
FT                   MSAIRVIRDLVGYLDWATWKECRGCAANEICVVPIWPMGTVQDYDSPQCKDASNPYDQG
FT                   GESYWGGMRN"
FT   sig_peptide     1128059..1128118
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC0 "
FT   mat_peptide     join(1128119..1128830,1128924..1129732)
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC0 "
FT   CDS_pept        complement(1130025..1131053)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949975"
FT                   /orf_name="Pc20g04970"
FT                   /product="Pc20g04970 protein"
FT                   /protein_id="CAP85826.1"
FT                   /db_xref="UniParc:UPI0001831928"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC1"
FT                   /transl_table=1
FT                   /translation="MKSFAFSAAVLASTAMALPANLANLVNNIPSGTTDALPSGVPSCL
FT                   PSGVIPSGIPLPVVSMIPTCPGAAASSAMSGLPIPTGAASDLTQGAAPNQLLSTLNGAG
FT                   HGQVLSILNQAGTSSIKMTAESELQSLMSKLPVSALQKPVGQVIQTADSVDQLNTSGGS
FT                   GLHQVTAVLDNGNAALIQLTSEVVNLLDGLGLGQVGGLIGSIVGGLESVTGYIKRDTLQ
FT                   NVLSITDVNGIAGGKNLLAQLEPSLLGGLLGGGLDLSTVQGPVGNVVAMAPSVSELKSK
FT                   IPNIPGADFIAVTTEDKASVLLVKVESTVQTLLSSLGLGSVGTTVGSIVSSASSAKGAL
FT                   PL"
FT   mat_peptide     complement(1130028..1131002)
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC1 "
FT   sig_peptide     complement(1131003..1131053)
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC1 "
FT   CDS_pept        join(1131835..1132020,1132107..1132247)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978106"
FT                   /orf_name="Pc20g04980"
FT                   /product="Putative uncharacterized protein Pc20g04980 "
FT                   /protein_id="CAP85827.1"
FT                   /db_xref="UniParc:UPI0001831929"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC2"
FT                   /transl_table=1
FT                   /translation="MVNDSWPSVLRSLEISSLCAKRNCTKEVKLHVDNINADCNFIPPQ
FT                   WVKMSNSSVDPGRPLIAGVGLTGATKTPPASMYVVDISILLLPTLLYSVLSQFQSKLKA
FT                   NQQI"
FT   CDS_pept        join(complement(1132900..1134429),
FT                   complement(1132740..1132844))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234554" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949976"
FT                   /orf_name="Pc20g04990"
FT                   /product="Pc20g04990 protein"
FT                   /EC_number="1.1.99.18"
FT                   /function="cellobiose dehydrogenase (acceptor) activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="alcohol metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85828.1"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="GO:0047735"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniParc:UPI000183192A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC3"
FT                   /transl_table=1
FT                   /translation="MRIFQAGPLAIALSVFTGAASASAFQNHTYDYIVVGGGPSGIISA
FT                   EKFAQAGKKVLLLERGVGPTVATGNNETLTWDHSLTPIDLPGLSANIGALDVWNQYMCT
FT                   DTAGNAACVLGGGVTVNYMVFVHPPARDFDDKWPEGWKWKDVESAADRLYKRNPGTTLP
FT                   SADGKRYDQGLYNVLSKFLSGLGWKSVDMIAEPNEKHQIYSYPSWNVQDQMRAGPVRTY
FT                   LPAAAKLDNFHLALRTKVIRLVRSGSQVTGVEVQTPSGRSQIITVAPHGRVVLAAGALS
FT                   TPRLLWNSGIGGKAQIETAKKSGVAVPPKAQWIDLPVGVGLKDHPIFPITFNTNASFGL
FT                   VDYEGVLNGTDSRDISLYRKHSGVLTQGKHRLIFFTSEEIDGHTQYYQGSCAPTDEGVV
FT                   TMTTYMTHGLTSSGVLGLDASGNTVIEKLPYLQTAADRKAARTFIQKMVKDITAPSTGF
FT                   ELETHTNVSAILKAQTPGTHYVSSAKMGTDDGRKNGTSVVDTNAKVYGVDNLFIVDASI
FT                   HPDLPTGNIQTAVMVVAEAAAVKILSN"
FT   mat_peptide     join(complement(1132900..1134357),
FT                   complement(1132743..1132844))
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC3 "
FT   sig_peptide     complement(1134358..1134429)
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC3 "
FT   CDS_pept        1136437..1137414
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000184929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949977"
FT                   /orf_name="Pc20g05000"
FT                   /product="Pc20g05000 protein"
FT                   /protein_id="CAP85829.1"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000183192B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC4"
FT                   /transl_table=1
FT                   /translation="MSSPAARLIPASSRTLLLTFDAFGTLFHPRLPVPEQYAATAHQFG
FT                   LSRTAVTPDKLATAFKDTFRAQMRQYPNYGRADVLRGQYGGPRQWWEEVIRGSFGRVLS
FT                   TENGETRPETPKEHIPDGMVEALLDRFAGAEGYALYDDVLPFFRRMRKLKSANKWSFDR
FT                   IIVGVVSNSDDRVPVVLKSLGLTVGDMRADQDQSSMDLPGFEVRGMKKDVAGEHGKDHA
FT                   DGNLDLDIDMVITSYEAGEEKPHRLIFDVARRQALKVARPWLTSRTKFKSVHVGDDFKK
FT                   DYQGASDAGWESYLLPRDSHGAEGSEAKQFPDLLGLADKLDLFP"
FT   sig_peptide     1136437..1136532
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC4 "
FT   mat_peptide     1136533..1137411
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC4 "
FT   CDS_pept        join(1138558..1138635,1138691..1138876,1138984..1139095,
FT                   1139223..1139349,1139401..1139692)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141498" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824911"
FT                   /orf_name="Pc20g05010"
FT                   /product="Pc20g05010 protein"
FT                   /function="coenzyme binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid metabolic process "
FT                   /protein_id="CAP85830.1"
FT                   /db_xref="GO:0006631"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="UniParc:UPI000183192C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC5"
FT                   /transl_table=1
FT                   /translation="MEGVQKPQGSVVIIGAGTQGRRLAHMWSSRGGTVRLVDLQEQQLE
FT                   DGLKYVEQLRADATDHEGDWGRIETSQPASLQSTLKDSWLVVELAPESTIIASNSSSYG
FT                   IFEILEGMSLKNNKRVMSAHCSIEIMGHKDSDPKLIALVLEQCKEHGFSPFYVRENSIG
FT                   YIYNRIWAAIKRETLLTLSEGVATPKEIDAIFKDVLKTPKGPCEQMDVVGLDVVLDIEN
FT                   HYAESRSGIPTEPRDYLRRMIQGGSLGVKNGRGFYDYEDQNK"
FT   tRNA            1139820..1139890
FT                   /gene_name="tRNA-Gly (GCC)"
FT   CDS_pept        join(complement(1141313..1144182),
FT                   complement(1140193..1141264))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184940" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978107"
FT                   /orf_name="Pc20g05020"
FT                   /product="Pc20g05020 protein"
FT                   /protein_id="CAP85831.1"
FT                   /db_xref="InterPro:IPR018564"
FT                   /db_xref="UniParc:UPI00018319F6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC6"
FT                   /transl_table=1
FT                   /translation="MSSPSTPRSTRSASPAGDSPNIITPGQKIKSMMAQFDSDSEDDAQ
FT                   IAKSTAAVSKLDLGRGGVPAADARENRPLHDSEDNSDSADEVFRPKGRMAARLQGNSRP
FT                   VEPEDEKSAFSRVSKAFRSEKEQGEKPQRTESQPTPIGESSDDDDLPTAGPRRKHKSTT
FT                   NSPNSNNRTSQTPPRSRADSPLFVSSPGEPHDDPNAEDTEHAAETKPKGNARFLSLVAQ
FT                   KRKEREEREKAEAERKKAIRRVQMEQLSSQVNSGEESGADDPSTASKLSQKARQPRKAS
FT                   KKALDEMRQETQRMSRNMQLAHQAKTKKKITKESLFAKFNFMQPDPPVEQLAANSSSAV
FT                   GSQNSSDGERAKTKDTPHTSPVLGHLDPSKASADFENAQVQAADVDMDADTEDLPAPKD
FT                   LLAPNQHPALSKDTAVQDVSLSIPEPKSEDGKSKRVSRPLTQPPIRVLLSRQDVAAHQK
FT                   DSDDSDSDLEVVTSPGKCRRIAAFENLPTRQSHEDPSMTKLKALAHLTSPTRKMASMNS
FT                   AELSANLLWRARQQAAKERRERIEELRAKGVVIETAEERAAMEDDMENLVDKARKEADE
FT                   IRRLEKAAGKKANGDDDEEEDDDYELSGSDQERDAEVDDEEDEEEEHERVNGGGDFVEH
FT                   EADEDDDSADDESEAEAAPSDAENEVPAPRRRRRTRVVSDNEDEDQPQPPSTPVRASSH
FT                   APQSAERPNFLGMGTSGDTSLGLTQAFASTLDGNGAGTQAESATMPFSLPDPGQPVPQL
FT                   RKEESEVLVPDSQPQPQDKDFMEGYAQSVTRVSESPAPYAFSEFSQSQLPDPTQDEGFV
FT                   FSPFDPAKRFRGTPPMSTVDTVLVGQTQSPIADRKRKMLRRGRATELPQVDENDDEGGF
FT                   EISANAFDVMKKDKALKKKPAPQYNKNNSKAKEIVDEAAEESEDEYAGLGGNSDESDGE
FT                   ENAIDRQMINDNSGEVVDEKQLAALNAVHDRNRDEKDVAKLMRDITTGALRRRKNADDD
FT                   FDLDDSDDEHLARRREKQREFAKMRRALLADEKIGEIAENPKKAAFFKAVEDREVDDDF
FT                   NIDFLEEEDHGSQGEASQDAASGEQSNDTASDGQNRKRPLEPSAEDATNRPPPRLRRTT
FT                   ASAMSKKPATIAEIRETLSFLTETPEYDSFQEDASLDEVEHDQEDEGTPGAEVQGHEDQ
FT                   PHSDNTFAKPSHPRRTRGVVVDRLALLRQASSNSATGTNSGSANSKLAFHSGSGGEGPI
FT                   GFRPPQLLRRVTTGSSSSSSSSASNRVSKAAASGPKKGGAVNSYTAAREREREKELRIK
FT                   QRSGGSNIAKLLGKHTGGGLGALDKGQWD"
FT   CDS_pept        join(complement(1146764..1146972),
FT                   complement(1145955..1146703),complement(1145765..1145904),
FT                   complement(1144985..1145716))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672212"
FT                   /orf_name="Pc20g05030"
FT                   /product="Pc20g05030 protein"
FT                   /function="DNA binding"
FT                   /biological_process="histone modification"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85832.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0016570"
FT                   /db_xref="InterPro:IPR004343"
FT                   /db_xref="UniParc:UPI00018319F7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC7"
FT                   /transl_table=1
FT                   /translation="MADDLDAELLALAGDSEEETSPPPKSPAHSSSSHVQERDTSPAPM
FT                   GRKGTAKPVSRRSRKPVKDESEGEISDDGSRHSLQSAPMSESESEADNSDDNDEDRPIF
FT                   PYEKLYYSAQDKKDIMAMPEIQREETLSERAQQVDRHNQDLALRRLLASRSREEARAAK
FT                   KAKRKAGSAGLDDNQRKSSRQKTTLGGRKVGETSGAIEAYKRQREQKGKRDELRRRDPT
FT                   KSRRRSRSVGSDISEEDADAESDLELDDRVGRAPSIPKDDPPAELREIRRAQIGRNNFA
FT                   KVCFYPGFENAMIGCYARLSIGPHPETGQNEYRLGLITGISQGKPYALEGENGRSFVTD
FT                   QYVKLAHGKAVRDFPFVTFSNSPLTEAEYRRYVQTLAVEDCKMATKSKVESKVADINRL
FT                   LNHTFTREELNEKLRRQGAFDEKKNVLNRLELERNLEFAKVNGNVEEAEKIEAELQKLA
FT                   TPALSWGTSLVKKEADKGLSEAERVHQINLRNQKLNIENGRRAQLEERKAAKKAAQAVA
FT                   RGEAAPNPFMRVRTVAKTHHDVNGVHKAAAAEAASVDSQKDTPAKSDGSPAQKATPGSR
FT                   VTPKKPKNGFMISYRNTDDENIAALDMDIDIEI"
FT   CDS_pept        1147418..1148161
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824912"
FT                   /orf_name="Pc20g05040"
FT                   /product="Pc20g05040 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="transition metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein metabolic process "
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /protein_id="CAP85833.1"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0019538"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniParc:UPI00018319F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC8"
FT                   /transl_table=1
FT                   /translation="MLSSPILRRCALTHCRHSAPAATPIFLDFLAPSTFKHGQCRQAST
FT                   TAGTPGGSKPLYVLSKEQREFMDSALRVNQAGEIAATLIYKAQTPQIVRSYPHLRPLMK
FT                   HMYDQEAGHLKTFNHLIAKHQIRPTAMSPAWEVAATFLGWSTAALGREAAMACTEAVET
FT                   EIGSHYNDQVREILSWEADAERRGEELDEELKEMLATFRRIRDEELEHLDHAVANDSKE
FT                   AKPYDPLVDVIRFGCRAAIKISEKV"
FT   CDS_pept        join(complement(1149022..1149082),
FT                   complement(1148706..1148968),complement(1148412..1148606))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000273094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672213"
FT                   /orf_name="Pc20g05050"
FT                   /product="Pc20g05050 protein"
FT                   /function="acid phosphatase activity"
FT                   /function="non-membrane spanning protein tyrosine
FT                   phosphatase activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85834.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="GO:0004726"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR002115"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="UniParc:UPI00018319F9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC9"
FT                   /transl_table=1
FT                   /translation="MTSNTNEHPTSVLFVCLGNICRSPMAEGVFRNLAATHPSIGEIDS
FT                   AGTAAYHSLEPPDSRTMSTLRRHKITGYDHAARKVTREDFLTFDYLLAMDKSNLRDLED
FT                   VRDSKVAEVRLFGDFGKGGKLHERVGGGEVVKDPYYGGANGFEEVYQQVTRFSQNFMEY
FT                   LEQNRSDSE"
FT   CDS_pept        join(1150368..1150562,1150629..1152251,1152307..1152708,
FT                   1152759..1153268,1153326..1153340)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162144" [ FAMILY / ALN /