(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE1

PENCW_16.PE1         Location/Qualifiers
FT   CDS_pept        join(complement(2138..2641),complement(1273..2107),
FT                   complement(1054..1224),complement(967..1004))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076626" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946670"
FT                   /orf_name="Pc20g00010"
FT                   /product="Pc20g00010 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85330.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831828"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER0"
FT                   /transl_table=1
FT                   /translation="MSLRPCQPCRHSRIRCSREVPHCQTCVKRGRYSLCVYETKVSDQK
FT                   PALPEPRSKQQKQKQERASDEYHFRWRAFEPQSEQFPRYETSTNEKMQHAMEPANEEHI
FT                   KHMSQRYSEQGSLSPHETPPKSIAAAKAEKASIFQPKHVEDTSERPRSTPVPQPTELYA
FT                   QMIPPTTTLTVNKASLPPRPNFDLTISGRHICGPHTAHQLLLVLNYLFISSMLPADIGA
FT                   LWKVICRRHHDWEESFVLQHEQLQRWLISVRNILTNSDGLHTVTLEDIERQTRYILFIL
FT                   GENTSPHSSFIFECFRSEEPPYRPFGVRASIALICHAFGGIQADELEGYEAKEIWTRDQ
FT                   NFLSTMAFRLKESPLFGAEVSVNHLQSMILGLQKAFQCEEIRVSGMEFQTLRIESELEV
FT                   LGYYRRAFLAFNPILLPKILASLREANDLTTLLWHYQLINMERNLDRTNLALRLANIFM
FT                   SLAPERLDAAFQNTREIQLSKAXRVVAMEMMHVKSFEEAYKLNPTKPTTVRVFHVSP"
     atgtctcttc gcccctgtca gccatgccga cattcgagaa ttcgatgcag ccgtgaagtt        60
     cctcactgtc aaacttgcgt caagcgtggt aggtactctt tgtgcgtcta tgaaacgaaa       120
     gtgtcagacc agaaacctgc tcttccagag cctcggtcaa agcagcaaaa gcaaaagcag       180
     gaacgagcat ctgacgagta tcactttcga tggagagctt tcgagccaca atccgaacag       240
     tttccccggt acgaaacgag tacaaatgaa aagatgcaac acgcaatgga gcctgcaaac       300
     gaagaacata tcaagcacat gagtcaaaga tattctgagc agggcagttt atcacctcat       360
     gagaccccac caaagagtat tgcggctgcg aaagcggaga aagcttcgat tttccaaccg       420
     aaacatgttg aagatacttc tgaacggccg cggagcacac cagtgcctca accaacagag       480
     ctctatgcgc aaatgatccc tccgactacg acgctaactg tcaacaaggc ttctttgcct       540
     ccacgcccaa attttgatct gaccatatct gggagacata tttgcggccc acatacggcc       600
     caccagctct tgttggtatt aaattatctt ttcatctctt caatgcttcc tgcagacata       660
     ggagctctgt ggaaagtcat atgtcgccgc caccatgact gggaagagag ctttgtcctg       720
     caacacgagc agcttcaacg gtggctcatc agcgtccgca atatcttgac caattctgat       780
     gggcttcaca cagtaacctt ggaagacata gagcgccaaa caagatatat tctgttcatt       840
     cttggggaga atacgtcccc tcactcgagc tttatatttg aatgtttcag aagcgaggaa       900
     cccccatacc ggccgtttgg ggtgagggca agtattgctt tgatttgtca tgcctttggt       960
     ggaatccagg ccgatgagct tgaaggatat gaagcaaagg aaatttggac ccgcgatcaa      1020
     aactttctgt cgaccatggc tttccggctc aaagaatcgc cactgtttgg cgccgaagtt      1080
     tcagtgaacc atttacagtc tatgatacta ggtctccaga aggcttttca gtgcgaagaa      1140
     atccgtgttt ccgggatgga gttccaaaca ttgagaatcg aaagcgaatt agaagtgctg      1200
     ggatattacc gacgggcatt tctagctttc aacccaattc tattaccaaa gattctagcc      1260
     tctttgagag aagcgaatga tcttactacc ctactatggc actatcagct tatcaatatg      1320
     gagagaaact tggacagaac caatttggcc ttgcgtctcg ccaacatatt catgtcactg      1380
     gcaccagaac gcttggacgc tgcgttccag aatactcgcg agattcagct atcaaaagcg      1440
     ganagagtcg tcgctatgga gatgatgcac gtcaagtcat tcgaagaagc atacaagttg      1500
     aaccctacta aacctaccac tgtccgtgtt ttccatgttt cgccgtga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page