(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE101

PENCW_16.PE101       Location/Qualifiers
FT   CDS_pept        join(complement(227954..229540),complement(227526..227884),
FT                   complement(227166..227346),complement(225175..227052))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128440"
FT                   /orf_name="Pc20g01010"
FT                   /product="Pc20g01010 protein"
FT                   /function="ATP binding"
FT                   /function="glycine-tRNA ligase activity"
FT                   /biological_process="glycyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85430.1"
FT                   /db_xref="GO:0004820"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006426"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniParc:UPI0001831D56"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR5"
FT                   /transl_table=1
FT                   /translation="MATVNTKTGQAVDRTVLDSMLRRRMFYTPSFEIYGGVSGLYDYGP
FT                   PGTALIANMTDLWRKHFVLEEDMLEVDTTMLTPHEILKTSGHVDKFADWMCKDPKTGEI
FT                   FRADHLVEEVLEARLKGDKQARGEKIEVDEEKEAKKKRKAKSTEAKKLDDALVKEYEET
FT                   LAQIDNYGGPELEQLIKKHDIRNPVTGGEVLPPVSFNLMFQTSIGPSSNMPGYLRPETA
FT                   QGQFLNFAKLLEFNQQSMPFASASIGKSFRNEISPRAGLLRVREFLMAEIEHYVDPEGG
FT                   KKHSRFDEVKDTELSLLDRNVQLSGSTNLTKMTVGKAVETGLVDNETLGYFLARIQSFL
FT                   LKLGVDPAKLRFRQHMANEMAHYATDCWDAELQTSYGWIECVGCADRSAYDLTVHKDKT
FT                   GAPLVVRQTRAEPLRIEEYQIDLEKKKFGPRFKKDAKTVEAAIEALSQDLREKLSLDLE
FT                   KDGKIEVDVEGVGSGKVEIEKDLIKIEKRTRVENVREYTPNVIEPSFGIGRILYSVIEH
FT                   SYWYRAGDETRGVLSFPPAIAPTKVLLVPLSTHASFKPLTQRLTSKLRKAGVSNRVDDS
FT                   SASIGKRYSRNDELGTPFGVTVDFQSVQDNTFTLRDRDTTKQVRASEDEILQAVKSLVE
FT                   GDETWEDIRKRLPEIRGTSVIDLSSFHSPLSTTMAPTVHSAKLTLSCPLFAADFDPRNN
FT                   GRLLVGGGGGEGRSGITEAVELNLSRDEDSVTSLAAAPLAGDEAGSLVALAGINSSVEQ
FT                   QKKNNNQHLRAFRFEAPRKTTEDRKQDEKAKKDAKSEEEVIPGRAIALSQASLFRTKNG
FT                   PGSSDTYQRVTRLSPWPKGKDGTEKHTRIGAVATGLAQSGEIVFFRATETPSEKDIIGR
FT                   IQLSSNEEAEDMDFVSLEHDLEKTDDGHGRFLVAYTNGTDVMVGEISCSSSSNSSPDVR
FT                   SVYNIPLPASGARTARPKFRALRFLSPRTLLLLQNAPNRGGSELVLLQLPSAKSSKSKV
FT                   LQRRKLPRTVKIGLGLDICQLGTNPQGQQQTVIAASGSDNSIPLFTLEYGPNRGYSNFR
FT                   PYTTLRDVHPFSMTKLTFSTFIAPPHPVTPDVGPQNIKLASVSMGNTVVVHTFPLSPFP
FT                   TSSRTPRYVLVTPGPAEIWELIYSIIVLLFSISAICVAMLAFAEIRGGTPPVLGATEWL
FT                   PESIRGAIAREYVIPPRDKLTYFDTLLAPRGSGGDTDTPVATIVPTESQIESLREILDR
FT                   VHRAGAAPADLETVAPQSLSVIVRCGAGQNAEQSVIVETAVSASGEAEQSEEEKLQAWK
FT                   DLSASEQSVWKQRLADAGRWTASEGESVLLGVLFGEACGGLGRAVRDELP"
     atggccaccg tcaacaccaa gaccggccag gccgtcgacc gcacggtgct ggactccatg        60
     ctccgtcgcc gcatgttcta caccccctcc ttcgaaattt atggtggtgt gtctggtctg       120
     tatgactatg gcccacctgg aaccgccctg atcgccaaca tgaccgacct gtggcgcaag       180
     cacttcgtgc tcgaggagga catgctcgag gtcgacacta ccatgttgac cccccacgaa       240
     attctcaaga ccagcgggca cgtggacaag ttcgccgact ggatgtgcaa ggaccccaag       300
     actggcgaga tcttccgtgc cgaccacttg gttgaggagg tgctcgaggc ccgcctcaag       360
     ggagacaagc aggcgcgcgg cgagaaaatt gaggtggatg aggagaagga ggccaagaag       420
     aagagaaagg ccaagagcac cgaggctaag aagctggatg atgcgctggt caaggagtac       480
     gaggagaccc tcgcacaaat tgacaactac ggtggccccg agctggagca actcatcaag       540
     aagcatgaca tccgcaaccc cgtcaccggc ggcgaggtgc tgcctcccgt ctctttcaac       600
     ctcatgttcc agacctctat tggccctagc tccaacatgc ccggctacct gcgtcccgag       660
     accgcccagg gtcagttcct gaacttcgct aagctcctgg agttcaacca gcagtcgatg       720
     ccgttcgcct ctgcctccat tggcaagtcg ttccgtaacg agatttcccc gcgtgcgggt       780
     ctcctgcgtg tgcgtgagtt cctcatggcc gagattgagc actacgtcga cccggagggt       840
     ggcaagaagc actctcgctt tgacgaggtc aaggatactg agctgtcctt gctcgaccgg       900
     aacgtgcagc tgtccggaag cacaaatctg accaagatga ctgtcggcaa ggccgttgag       960
     accggactgg tcgacaacga gactctgggc tatttcttgg cccgcattca gtccttcctg      1020
     ttgaagctgg gtgttgaccc tgccaagctg cgtttccgcc agcatatggc caatgaaatg      1080
     gctcactacg ccactgattg ctgggatgcc gagttgcaga ccagctatgg ctggatcgag      1140
     tgtgtcggct gtgctgaccg ctccgcttac gacctgactg tccacaagga caagaccggt      1200
     gctcctctcg tcgtgcgcca gacccgtgct gagcctctcc gtatcgagga gtaccagatt      1260
     gatcttgaga agaagaagtt cggtccccgt ttcaagaagg acgccaagac cgtcgaagca      1320
     gctattgagg ctctgtccca ggacctgcgc gagaagctgt ctcttgacct tgagaaggac      1380
     ggcaagattg aggtcgatgt tgagggggtt gggtctggca aggttgagat cgagaaggac      1440
     ttgatcaaga ttgagaagcg cactcgtgtt gaaaatgtcc gcgagtacac ccccaacgtt      1500
     attgaaccgt ccttcggtat tggacgtatc ctgtacagtg tcattgagca ctcctactgg      1560
     taccgcgccg gtgacgagac ccgtggtgtc ctttctttcc ctcccgccat tgcccccaca      1620
     aaggtcctgc tggttcccct ctccacccac gcctccttca agcctctgac ccagcgtctg      1680
     acctcgaagc tgcgcaaggc cggtgtctcc aaccgtgtcg atgactcttc cgccagtatc      1740
     ggtaagcgtt actcccgcaa cgacgagctg ggcacacctt tcggtgtcac tgtggatttc      1800
     cagtccgttc aggacaacac cttcaccctg cgcgatcgcg ataccactaa gcaggtccgt      1860
     gccagcgagg acgagattct acaggctgtc aagtcgcttg ttgagggcga cgagacatgg      1920
     gaggatatcc gcaagcgcct gcccgaaatc cggggcacct ccgtcatcga tctgtcctct      1980
     tttcattctc ctttgtcaac aactatggcg cccacagtac actccgccaa attgacactt      2040
     tcgtgtccgc tctttgctgc tgacttcgac ccgcgcaaca acggtcggct cctagtcggc      2100
     ggtggaggcg gcgaggggcg tagcggaatc actgaggccg ttgaattgaa cctatcgcgc      2160
     gatgaagact cagtaacttc gctggctgcg gccccactgg ctggcgacga ggcgggctcg      2220
     cttgttgctc tggctggtat caatagctct gtggagcaac agaaaaagaa taacaatcaa      2280
     catcttcgcg cattccggtt tgaggcgccg cggaagacca ccgaagaccg caagcaggac      2340
     gagaaggcga aaaaggacgc caagtctgag gaagaggtta ttcctggaag ggccatagct      2400
     ctatcgcaag catcactctt ccgaacgaag aacgggcctg gctcttcaga tacttaccag      2460
     cgagtgacga ggctctcgcc gtggccgaaa gggaaggatg gcaccgagaa acacacacgg      2520
     atcggagctg ttgcgacggg tctggcacaa tccggtgaga tcgtgttctt ccgcgccacg      2580
     gagactccca gcgagaagga tataattggc cgcattcaat taagcagtaa tgaagaggcc      2640
     gaggatatgg actttgtgag cctcgaacac gacttggaga agaccgacga tggacacggc      2700
     cggttccttg tggcctatac gaacggcaca gacgtcatgg ttggcgagat ctcgtgctct      2760
     agctcctcca atagctcccc cgacgtccgc tccgtttata atattcctct gcccgccagc      2820
     ggagcccgca cggcacggcc caagttccgc gcgctgcggt tcctctcgcc ccgaaccctg      2880
     ctcctcctcc agaatgcccc aaaccgcggt ggtagcgagc tcgtgcttct tcaactcccc      2940
     agcgccaaat caagcaagtc caaagttcta caacgtcgca agcttcctcg aaccgtgaag      3000
     atcggcctag gcctcgacat ctgccaactc gggacgaacc cgcaaggcca acaacagact      3060
     gtcatcgcag ccagtggcag cgacaactcc atccctctat tcaccctaga atacggacca      3120
     aaccgcggct acagcaactt ccgcccctac acaactctcc gcgacgtgca ccccttctca      3180
     atgacaaaac tcaccttctc caccttcatc gcgcccccgc accccgtaac cccagacgtc      3240
     ggcccgcaga acatcaagct cgcctccgtc agtatgggca acacagtcgt cgtgcacacg      3300
     ttcccactgt ctcccttccc aacctcctcc cgcaccccac gctacgtcct cgtcaccccg      3360
     ggccccgccg aaatttggga actaatctac agcatcatcg tccttctctt ctccatatcc      3420
     gcaatctgcg tggcgatgct cgccttcgcc gagatccgcg gcggaacccc gcctgtcctc      3480
     ggcgccacag agtggctccc agagagtatc cgcggagcta tcgcacggga atacgttatc      3540
     cctccacggg ataagctgac gtacttcgat accctgcttg cgcctcgtgg aagcgggggt      3600
     gataccgata cccccgtggc gacaattgtc cccacggagt cgcagatcga atccctccgc      3660
     gaaatcctgg accgcgtaca ccgtgccggc gctgcaccag ctgatctgga aactgtcgcg      3720
     ccgcagtccc tctctgtcat tgtacggtgc ggtgcagggc aaaatgccga acagagcgtg      3780
     attgtcgaga ctgctgtgtc tgcgtcgggc gaggccgagc agtctgagga ggagaagctg      3840
     caagcttgga aggatctttc tgcgtctgag cagagtgttt ggaaacagag gcttgcggat      3900
     gcgggtcgct ggacggcttc tgaaggggag agtgttcttc ttggggtttt gttcggtgag      3960
     gcttgtgggg gattggggag ggctgtgagg gatgagttgc cttga                      4005
//

If you have problems or comments...

PBIL Back to PBIL home page