(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE102

PENCW_16.PE102       Location/Qualifiers
FT   CDS_pept        229921..231216
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172062" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946715"
FT                   /orf_name="Pc20g01020"
FT                   /product="Pc20g01020 protein"
FT                   /function="ATP binding"
FT                   /function="aminoacyl-tRNA ligase activity"
FT                   /biological_process="translation"
FT                   /protein_id="CAP85431.1"
FT                   /db_xref="GO:0004812"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI0001831D57"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR6"
FT                   /transl_table=1
FT                   /translation="MGVPGRSGPPPGVMGDIKTGNKLRRKMNHVKRKRAKDAARREERY
FT                   AFKKEEAKNPKLKEERLRRNIPLTLERKRVWNEADNDTEETGLGLSVDVERIKRAKKEE
FT                   EDELNRPLEEGEDDSEVPESDNESVDSMLESDNSEDEDEGEEKNEDQDASRGRKKTSLR
FT                   TATERATSPTQSTRSTNLSLAPEALAAKFPTLFTEGPPPTPKILITTGLNSTLHVQAET
FT                   LTDVFPNSVYIRRNAHRYSHKFSIREISKFASNRNFTAVVVLNEDQKRPSGLTIVHLPV
FT                   GPTFHFSISNWIDGKRLPGHGRATDHWPELILNNFRTPLGLLTAHLFRTLFPPQPEFEG
FT                   RQVVTLHNQRDYIFVRRHRYVFREKRETEKAVVGADGKEMAGAEGIRTGLQELGPRFTL
FT                   KLRRVDKGIQRASGQEWEWKGGMEKTRTLFQL"
     atgggtgtgc ctggccgatc tggaccgcct ccgggcgtca tgggcgatat taaaaccggc        60
     aacaagctgc gccggaagat gaaccatgtc aagcgcaaga gagccaaaga tgccgcgcgc       120
     cgagaggagc gctacgcttt caagaaagaa gaagccaaga accccaaatt gaaagaagaa       180
     cgactccgcc gcaacattcc tctgaccctc gagcggaaac gtgtttggaa cgaagccgac       240
     aatgacaccg aagaaactgg tctgggattg agcgttgacg ttgagcgcat caagcgtgct       300
     aagaaggaag aagaagacga gctcaatcgg ccattggaag agggcgagga tgacagcgag       360
     gttccagaat cagacaacga gtcagtcgac agtatgctcg aatcggacaa cagtgaagac       420
     gaagatgagg gtgaggaaaa gaacgaagac caagatgcca gccgcggccg gaagaagacc       480
     tctctccgaa ccgcgacaga gcgagccaca agtcctaccc agtccacacg cagcacaaac       540
     ctcagcctcg ctcctgaagc attggccgcc aaattcccta cactcttcac cgagggaccc       600
     ccacccaccc cgaaaatcct catcaccacc ggcctcaact ctacccttca cgtccaagct       660
     gaaaccctga ccgatgtgtt cccgaacagc gtgtatatcc ggcgcaatgc gcaccggtac       720
     tcgcacaaat tctcaatccg cgagatttcc aaattcgcct caaatcgtaa tttcacggcg       780
     gtcgtcgtgt tgaatgagga ccagaagcgg ccctctgggc taacgatagt gcatttgcca       840
     gttggcccga ctttccactt cagcatcagc aattggatcg atgggaagcg gcttcctgga       900
     cacggccgag ccaccgacca ctggcccgag ctgatcctca ataacttccg tactcctctc       960
     ggtcttttga ctgcccattt gttccgcaca ctcttcccgc ctcagccgga attcgagggc      1020
     cgacaagtcg tcactttgca caaccaacgt gattacattt tcgtccgtcg tcaccgctac      1080
     gtcttccgtg agaagcgcga gaccgaaaag gctgttgttg gtgctgatgg caaggaaatg      1140
     gccggtgccg agggtatccg taccggtcta caggaactag gacctcgctt caccttgaag      1200
     ctgcgtcgtg ttgataaggg tatccagcgt gccagtggcc aggagtggga atggaagggt      1260
     ggaatggaga agacgagaac cctgttccaa ctgtaa                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page