(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE106

PENCW_16.PE106       Location/Qualifiers
FT   CDS_pept        join(complement(236757..238220),complement(236568..236699))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172097" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946719"
FT                   /orf_name="Pc20g01060"
FT                   /product="Pc20g01060 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85435.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015729"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0001831D5B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS0"
FT                   /transl_table=1
FT                   /translation="MTPPSPSPVPSAVSSAAASQHSHDPRDGDASVTRAIAGMNLAAHA
FT                   NGEALPPPASPAAKPTRSTMAARLTRMFSSTGKNTPPRENNEVPRDLSDSSLESIQPLN
FT                   GRTSKPSSRPASRPPSRPPSRGENSRTPSRNPSLKSEPLEKYDKKKMDDKKKDGASVHK
FT                   RFEVLTEALGNHSHNLRSARRQEKLTDLLRDMMGGRKKDDQVDEQQLSLMSTWIDQFKT
FT                   ERDKLAADKKGGPNATASLVDKYGKCQEIVGRGAFGIVRISHKVDPQDSKCEQLYAVKE
FT                   FRRRPQETTKKYQKRLTSEFCISSSLRHPNVIHTLDLLQDAKGDYCEVMEYCAGGDLYT
FT                   LVLAAGKLEVAEADCFFKQLMRGVEYMHEMGVAHRDLKPENLLLTTHGALKITDFGNGE
FT                   CFRMAWEKEAHMTAGLCGSAPYIAPEEYVEREFDPRAVDLWATGVIYMAMRTGRHLWRV
FT                   ARKDEDEFYQRYLDGRKHEDGYAPIETLHRARCRNVIYSILDPNPSRRINASQVLKSEW
FT                   VRQIKLCKAGEEGF"
     atgactccac cttccccttc acctgtgcct tccgcagtct cttccgccgc agcttcacaa        60
     cactcacatg atcctcgtga tggagatgct tcggtaacac gagccattgc gggcatgaat       120
     ctggctgccc acgcaaacgg ggaggccctt cctcccccgg catctcccgc cgccaaaccg       180
     actagatcta ctatggccgc gcgcctcacg cgcatgttct ccagcacggg gaaaaacaca       240
     ccacccagag agaataacga agttcctcgt gacctatccg acagtagctt ggagagtatc       300
     cagcccctca acggcaggac ctcgaagcca tcatctcgac ccgcctccag accaccttct       360
     agacctccct caagaggaga aaattctcga acaccatcac gaaacccatc actcaagagc       420
     gaacccctgg agaagtacga caagaagaag atggatgata aaaagaaaga tggagcttcc       480
     gtccacaagc gattcgaagt actgacggaa gctctcggca accactcaca taacctcaga       540
     agtgctagac ggcaagagaa gctcaccgat ctattgcggg acatgatggg tggccggaaa       600
     aaggacgacc aggtggatga gcaacagcta tcgctgatgt cgacttggat tgatcagttc       660
     aagacggagc gtgataagct ggctgctgat aagaagggtg gcccgaatgc cactgcttct       720
     ctggttgaca agtacggcaa gtgtcaggag attgtgggtc gcggtgcttt cggtatcgtg       780
     cgcatctcgc acaaggtcga ccctcaagat tccaaatgtg aacagctgta tgctgtcaag       840
     gagttccgcc gccggcctca agaaacgacc aagaagtatc aaaaacgact gacttctgaa       900
     ttttgtatct catcgtcact tcgtcacccc aacgtcattc acactttgga cctcttgcaa       960
     gatgccaagg gagattactg tgaagtcatg gaatactgtg ctggtggcga tttgtacacc      1020
     ctggtccttg ctgccggcaa gttagaagtc gccgaagccg actgcttttt caagcagttg      1080
     atgcggggtg tcgagtatat gcacgaaatg ggtgtcgcac accgcgacct taagcccgag      1140
     aatttgctct tgacgactca tggtgcactc aagatcaccg attttggtaa cggtgaatgc      1200
     ttccgtatgg cctgggagaa ggaagcccat atgaccgcgg gactctgcgg ttccgcaccc      1260
     tatatcgccc cggaggaata cgtggagagg gaatttgacc cccgagcggt tgatctctgg      1320
     gcgactggag tgatctacat ggccatgcgc accgggcggc atctttggcg cgtggcgcgc      1380
     aaggacgaag atgaatttta ccagcgctac ctagatggtc gcaaacatga ggatggatac      1440
     gctcccattg agacgttaca tcgggctcgt tgtcgcaacg tgatctactc catccttgat      1500
     cccaatcctt ctcgccgcat caatgcctca caggtcctca aatccgaatg ggttcgccag      1560
     atcaagctgt gtaaggctgg cgaggaaggg ttctga                                1596
//

If you have problems or comments...

PBIL Back to PBIL home page