(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE107

PENCW_16.PE107       Location/Qualifiers
FT   CDS_pept        join(complement(243833..243869),complement(243572..243770),
FT                   complement(243345..243490),complement(243175..243278))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824096"
FT                   /orf_name="Pc20g01070"
FT                   /product="Pc20g01070 protein"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /cellular_component="cis-Golgi network"
FT                   /protein_id="CAP85436.1"
FT                   /db_xref="GO:0005801"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="InterPro:IPR007233"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI0001831E3E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS1"
FT                   /transl_table=1
FT                   /translation="MVVYSFYIFDRHAECIYKRRWLPRPTSTVGKSRSDTVSGAAPTGL
FT                   GQTVRSTDDDSKLVFGTVFSLRNMVRKLGGEDDNFVSFTTSQYKLHYYETPTNTKFVML
FT                   TDLKSPSMRIALQQIYINLFVEYVVKNPLSPTEHPGGVGVNNELFEESLEQFVVRAL"
     atggtcgtct actcgttcta catctttgat cggcacgcgg aatgcattta caagcgtcgg        60
     tggcttccgc gtccgacctc caccgtgggg aagtcgcggt ctgatactgt ctccggcgca       120
     gcaccgaccg gtctcggcca gacagtgcga tcgacagacg acgattcgaa gctggtattc       180
     ggcactgtct tctcgctgcg gaatatggtg cgcaagctag gaggcgaaga tgacaacttc       240
     gtgtcattca ccaccagcca gtacaagctt cactactacg agacgccaac gaataccaag       300
     ttcgtcatgc tgacggacct caagagtcct agcatgcgta tcgcgctgca acagatctat       360
     atcaatctgt ttgtggaata cgtggttaag aacccccttt ctccgaccga gcatcccggc       420
     ggtgtgggcg tgaacaacga gctattcgag gaatcgttgg agcagtttgt ggtgcgtgca       480
     ttatag                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page