(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE108

PENCW_16.PE108       Location/Qualifiers
FT   CDS_pept        join(244217..244296,244364..244448,244505..244654,
FT                   244733..245527,245578..245715,245767..246966)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172119" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671395"
FT                   /orf_name="Pc20g01080"
FT                   /product="Pc20g01080 protein"
FT                   /EC_number="2.7.11.17"
FT                   /function="ATP binding"
FT                   /function="calmodulin-dependent protein kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85437.1"
FT                   /db_xref="GO:0004683"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020657"
FT                   /db_xref="UniParc:UPI0001831E3F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS2"
FT                   /transl_table=1
FT                   /translation="MSDISAEPSTSSLEGMSDARPQASRFPQSPPRSTASHDSYARHRR
FT                   RNPRSRRPVKETLNARSSYYTSQDDGTAEHRINQYIIKQEIGRGSFGAVHLAADQYGNE
FT                   YAVKEFSKSRLRKRAQSHMLRRPRGPIRGGTDFNSPLHRHPSGDDTETAKNPLYLIKEE
FT                   IAIMKKLNHNNLVSLIEVLDDPTEDSLYMVMEMCKKGVVMKVGLEEKADPYDDEQCRCW
FT                   FRDLILGIEYLHSQGIVHRDIKPDNCLVTNDDILKVVDFGVSEMFEKDSNMFTGKSAGS
FT                   PAFLPPELCVAKHGDVSGRATDIWSMGVTLYCLRYGRLPFEKQSIFELYDSIRGDTLVY
FT                   EDESDEVFKDLIGRILEKDPEKRIDMFALREHPWVTKNGTDPLLSFEENTSQIIEPPTE
FT                   EEMNSAITRKMGHLVTVMKAVQRFKRLTDPMKPQSPIQSTFGSILGGDHDAFLVEPPME
FT                   MDPDEPFPTVGAALQTHDSNGPDVRKNFPRRPFAGFRENAGCIGSTDSASFSSQPEHSP
FT                   SNSKIPSGVTEPERRDSGSIRSWGSTAQPDVGHEAQPHSQSASPHIPLSRASSSRTKRS
FT                   MEGTRGHARDPLEEEFPYLFIGPSTYNGSSQQDTVPGDEPASILQEPGHSMDPSDQMED
FT                   EEPVQFVSESPGAADFNIYETAYRKELDRIKNNLKDRDTGRKVYLTRFVEENSAEVLKL
FT                   SKEKELDLQMGDDFTPSPLSRTPSGFGTAVSALRSQILQKRQAEEPEEQGGDARKDKDY
FT                   SQNREPHPHPPKRLSVPSQSIPEPESSSLEATGVSSTEGNGDSKAQLRRILDRVRGKSD
FT                   GAE"
     atgtcggata tctccgcaga gccatctacc tcctcactgg agggtatgag cgatgcgcgg        60
     ccccaggcga gcagatttcc ccaatctcca cctagatcta ctgcatccca tgacagttat       120
     gcgaggcatc gacgacgaaa cccaagatca aggcgtccgg tgaaggaaac actgaacgcc       180
     cgctcctcct attatacgag ccaagatgac ggtaccgcgg aacatcgcat caaccaatat       240
     ataatcaagc aggagatcgg acgtggatcg tttggggctg ttcatctggc tgcagatcag       300
     tatggcaatg aatatgcagt caaagaattc tccaagtcta gactaaggaa acgtgcgcag       360
     tcgcatatgt tgcgaagacc gcgaggcccg attcggggag gaacggattt caactcgcca       420
     ttacatcggc atccttccgg tgacgatact gagacagcaa agaatccttt atatctgatc       480
     aaggaggaaa ttgcaatcat gaagaaactg aaccataaca atctggtgtc attgatcgag       540
     gtcttggatg atccaacgga ggactcgttg tacatggtga tggaaatgtg caagaagggt       600
     gttgtcatga aggtcgggct ggaagagaaa gcagatccgt atgatgacga gcaatgtcga       660
     tgttggttcc gtgatctgat cttgggaatc gagtacctgc attcacaggg tattgtccat       720
     cgagatataa aaccggacaa ctgtttggtg accaacgacg acattctgaa agtggtcgac       780
     tttggtgtat cggaaatgtt tgaaaaagat tcaaacatgt tcactggtaa gtcagctggg       840
     tcaccagcat ttctcccgcc agagctgtgc gtggccaaac atggcgatgt atccggaagg       900
     gcgacagata tctggtccat gggagtaact ctatactgtc tccgatatgg aaggctgccc       960
     tttgagaagc agagcatctt cgagctgtac gatagtatca ggggagatac cctggtgtac      1020
     gaagatgagt cagatgaggt attcaaagat ctgataggac ggatcctcga gaaagatcca      1080
     gagaaacgaa tcgacatgtt tgctttacgg gaacacccct gggtaacgaa gaatgggacg      1140
     gatcctttac tgtcatttga ggagaacaca tcgcaaatca ttgagccacc gacagaggag      1200
     gagatgaact cggccattac aagaaaaatg ggacatctcg tgactgtgat gaaagccgtt      1260
     caaagattca agcgactaac ggatcccatg aaaccacaat ctccgattca aagtacgttc      1320
     ggtagcattc tgggcggaga ccacgatgcc ttccttgtcg agccaccaat ggaaatggac      1380
     ccagacgaac ccttcccaac agtcggagcg gctctacaga cacacgactc caatggccca      1440
     gacgtgcgta agaacttccc ccggcgccct ttcgccggat tccgagaaaa tgccggatgt      1500
     atcgggtcta ccgattcagc cagcttttca tcccagcccg agcacagccc gagcaacagc      1560
     aaaataccca gcggcgtgac cgagcccgaa cgaagagact ccggctccat ccgcagctgg      1620
     gggtccacag ctcaaccgga tgtcggccac gaagctcaac cccactccca gtcggcatca      1680
     ccccatatcc ccctttcgcg agcgagctca agtagaacta agcgcagcat ggaggggacg      1740
     agagggcatg ctcgtgatcc gctggaggag gagtttccct acctcttcat tggaccatct      1800
     acctacaacg gctcctcgca gcaggacact gttcccggtg acgagccggc gtccatcttg      1860
     caagagccgg ggcattcaat ggatccatct gaccagatgg aggacgagga gcccgtacag      1920
     ttcgttagtg aatcacccgg cgctgcggat ttcaatatct acgagacggc gtacaggaag      1980
     gagctagacc gcatcaagaa caacctgaaa gaccgcgata ccggccggaa ggtgtacctg      2040
     acccgcttcg ttgaggaaaa cagcgccgaa gtgctgaaac tatccaaaga gaaggagttg      2100
     gatcttcaaa tgggggatga cttcactcct tcccctctgt cgagaacacc atcaggcttc      2160
     ggcactgcgg tcagtgctct gcgttcgcag attctgcaga aaaggcaggc tgaggagcca      2220
     gaggaacagg gtggtgatgc aaggaaagat aaagattatt cgcagaaccg tgagcctcat      2280
     cctcatcctc cgaaacgctt gtcggttcca tcccagtcta tacccgagcc tgaatcctct      2340
     tctctagagg cgacgggggt gtcgtctacg gaggggaatg gtgattccaa agcacagctg      2400
     cggcgaattc ttgatcgagt tcgtggaaag tctgatggcg cagagtga                   2448
//

If you have problems or comments...

PBIL Back to PBIL home page