(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE109

PENCW_16.PE109       Location/Qualifiers
FT   CDS_pept        join(complement(249825..249866),complement(249658..249772),
FT                   complement(248711..249558))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216941" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946720"
FT                   /orf_name="Pc20g01090"
FT                   /product="Pc20g01090 protein"
FT                   /function="DNA binding"
FT                   /protein_id="CAP85438.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI0001831E40"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS3"
FT                   /transl_table=1
FT                   /translation="MSNPSDRPWTEEDKYTLLTEILKKAGFPSSYLVRMIKEYGITPSW
FT                   EHIPLPQGRSLSSCKTAYLNMVQQPVHPPHPVAPFPPRSDITGPPASMDPSTMRKRPLY
FT                   PSDKPIPRAIQPRPPASTASYSSESGASAQLSPRLDTGPGEPPRKRGRPSKAETERRKL
FT                   LAEARGETYPAPRRSGSGRLKVPPSPTSPAAGPSSTPFPPAPQAFHGPKPGPVPMLYDT
FT                   SAMRSAIPPGPGPASNDERRDMPARGMGTNMRELPRPTEMGHPLPSPHALQLGPPDAFP
FT                   RLSNPVERPYSFSADRFSPPDSGRRDSVTSRSDQPGPYSEGRMSTTPAEQAPR"
     atgtcgaatc catctgatag gccatggacc gaggaggaca agtacactct actcaccgag        60
     atcctcaaga aagctggatt tccttccagc tatctagtgc gcatgattaa agaatatgga       120
     attactccaa gctgggagca tattcccctt ccacaaggtc gttcactcag ctcgtgcaaa       180
     acggcctatc tcaatatggt tcagcagcct gtgcaccctc cacatccagt ggcaccgttt       240
     ccaccgcgat ccgatatcac cggcccgcca gcctcaatgg accctagcac tatgcgcaag       300
     cggccattgt atccttccga caaaccaatc cctcgtgcaa ttcagccaag gccaccagcg       360
     agcaccgcct cctacagcag cgaaagcgga gcatccgccc agctctcccc aagactagat       420
     accggccccg gcgagccacc ccgtaaacga ggacgcccaa gcaaagcaga gaccgagcga       480
     cgcaagcttc tagccgaggc ccgcggtgaa acttacccag cccctcgacg gtcagggtct       540
     ggcagactta aagtccctcc ttcaccaacc agccccgcgg caggcccatc gtctacacca       600
     tttccgccgg caccccaagc attccatgga cccaagccgg gcccagtccc aatgctctac       660
     gacacttcag ccatgcgctc ggcaattcca ccaggccctg gtcccgcgtc aaacgatgag       720
     cgccgcgata tgccagcccg tggcatgggc accaacatgc gtgaactacc ccggccaaca       780
     gagatgggcc atcccctccc ttcaccacat gccttgcaac tagggccccc agacgcattc       840
     cctagactca gcaacccagt cgagcggcct tacagcttct cagcagatcg gttctccccg       900
     ccagacagtg gtcggcgcga ctcggtcact agtcgatccg accagccagg accgtactcg       960
     gaaggacgaa tgagcacgac accagccgag caagctccac gatga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page