(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE11

PENCW_16.PE11        Location/Qualifiers
FT   CDS_pept        join(30653..30655,30728..30772,30856..30971,31034..31064,
FT                   31136..31545,31611..31935)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216895" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946675"
FT                   /orf_name="Pc20g00110"
FT                   /product="Pc20g00110 protein"
FT                   /protein_id="CAP85340.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0001831830"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER9"
FT                   /transl_table=1
FT                   /translation="MATPQVISNSGHEEMIHDAGLDYYGRRLATCSSDKTIKIFEIEGE
FT                   SHRLVETLKGHEGAVWCVAWAHPKFGTILASSSYDGKVLIWREQPQNATSPSGGSTWTK
FT                   VFDFSLHTASVNMVSWAPHESGCLLACASSDGHISVLEFRDNNWTHQTFHAHGMGVNSI
FT                   SWAPAAFAGSLISSNPGPGQQRRFVTGGSDNLVKIWEYNAESKSYNLTQTLEGHSDWVR
FT                   DVAWSPSILSKSYIASAAQDKTVRIWTSDASNPGQWSSQTLEFDTVLWRVSWSLSGNIL
FT                   AVSGGDNKVSLWKENLKGEWEKVKDIEE"
     atggcgaccc ctcaggttat ctcgaattcc gggcacgagg agatgattca cgatgctggc        60
     ttggactatt acggccgccg gttggccaca tgttcatctg acaaaacgat aaagatcttt       120
     gagattgaag gagaatcaca ccggctagtc gagacgctga agggccacga gggcgctgtg       180
     tggtgtgtcg catgggccca cccgaaattc gggacaattc tagcctcatc ttcctacgac       240
     ggcaaggttc tgatctggcg ggaacaaccc cagaatgcga cctcgccctc cggtggtagc       300
     acatggacca aggtcttcga tttctccctt cacacggcct ccgtgaacat ggtctcctgg       360
     gctccccatg agagcggatg tcttcttgcc tgcgcttctt ccgacggcca cattagcgtg       420
     ctcgagttcc gtgacaacaa ctggacccac cagaccttcc atgcccacgg aatgggcgtc       480
     aactctatca gctgggcccc cgcggccttt gctggtagcc tcattagctc taaccctgga       540
     cccggccaac agcgtcggtt tgttaccggt ggcagcgaca acctggtcaa gatctgggag       600
     tataacgcgg agtccaaatc ttacaacctc actcaaaccc tcgagggaca ctccgactgg       660
     gtccgcgatg tggcctggtc cccgagcatc ctctccaagt cctacatcgc ctccgccgcg       720
     caagacaaga ccgttcgcat ctggacctct gatgcttcca acccgggcca gtggtccagc       780
     caaacactgg agtttgacac tgttctgtgg cgtgttagct ggagtctcag cggcaacatc       840
     cttgccgtca gcggaggtga taacaaggtc agtttgtgga aggagaacct caagggggag       900
     tgggagaagg tcaaggatat cgaagagtag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page