(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE110

PENCW_16.PE110       Location/Qualifiers
FT   CDS_pept        join(252120..252516,252636..254252,254305..254357)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172130" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946721"
FT                   /orf_name="Pc20g01100"
FT                   /product="Pc20g01100 protein"
FT                   /function="DNA binding"
FT                   /function="histone-lysine N-methyltransferase activity "
FT                   /function="transcription regulator activity"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85439.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0018024"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR006560"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="UniParc:UPI0001831E41"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS4"
FT                   /transl_table=1
FT                   /translation="MSAHDYADSEEPAKMERDSPVNGNHLKNGDSRTSSRSPLPPKKES
FT                   SPNSDAPDPMKENIGEIVLKQEPGQPPKLSRSSSQKVASRPPPLYTHLPDSTQDALATF
FT                   EQIPGCIYANKYMGYTEHAMECDCAEEWDPKIGRNIACGEDSDCINRATKIECAGECGC
FT                   GPDCQNQRFQKRQFAPVSVIKTEKKGFGLRAEKNLDPGELIYEYVGEVVGEQQFRKRMR
FT                   QYDEEGIKHFYFMSLNKGEFVDATKRGNLGRFCNHSCNPNCYVDKWVVGEKLRMGIFAE
FT                   RAVQAGEELVFNYNVDRYGADPQPCYCGEPMCTGFIGGRTQTERATKLSNATIEALGID
FT                   EADGWDTVVAKRPKKKKMEEDDEEYVDSVQPKSLDEDGVTKVMAALVQCQEKWIAVKLL
FT                   GRIQRCDDERVRNRVVRMHGYQILNSQLAQWKEDQNVVLQILNILDGFPRLTRNKIQDS
FT                   KIETNIRPLTTCDDERVPKKAVALLESWAGLEVAYRIPRMKRGKDAKQAINQFERRETG
FT                   QEQRQRSLTRSPSPVYDAPRGPAQQRRDRGPQRSRQPNRRGPRPLPEGWYTAEAEGRVY
FT                   YYSASGKTTWERPTLPATPATPAPGQPAKNQQNLALQSIIDGIMNTQEDTPSENRTATP
FT                   VTPQPSADQPERRHKDGEKWRKLPLEKQKRIYENTVTFPAYQARGGSVQTQDP"
     atgtctgccc atgactacgc ggactctgaa gagcctgcca aaatggagcg ggactctccg        60
     gtaaacggca atcatttgaa aaacggcgat tcgcgtacct cctctcgatc tcctcttcct       120
     ccgaaaaagg agtcctcccc caactccgat gcacccgacc caatgaagga aaatatcggc       180
     gagatcgtcc ttaagcagga accgggccaa ccgcccaagc tgtcacgcag ctcgtcgcag       240
     aaggtcgcgt cgcgacctcc gccgctgtac acgcacctgc cggatagcac ccaggatgcg       300
     ctcgccacct ttgaacagat ccccggctgt atctacgcca acaaatacat gggatacacc       360
     gaacatgcca tggaatgtga ttgcgctgaa gagtgggacc cgaagattgg tcgaaatatc       420
     gcatgtggtg aggattcaga ctgtatcaac cgcgcgacca agatcgagtg tgcgggcgaa       480
     tgcggctgtg gtcccgactg tcaaaaccag cggtttcaaa aaagacagtt tgccccggtg       540
     tccgttatca aaacagaaaa aaagggattc ggattgcgcg cggaaaagaa tctcgacccg       600
     ggcgaattga tttacgaata tgttggtgag gtcgtgggag agcagcaatt ccgaaagcgc       660
     atgagacagt atgatgagga gggcatcaag cacttctact ttatgtcctt gaacaagggc       720
     gagtttgtcg atgcgaccaa gcgaggcaac ctgggacgat tctgcaatca ctcgtgcaat       780
     cccaactgct atgttgacaa atgggtcgtg ggcgagaagc tacgtatggg aattttcgct       840
     gaacgcgctg ttcaggccgg cgaggagctg gttttcaact acaatgttga ccgatacggt       900
     gccgaccccc agccctgcta ttgtggggag cccatgtgca caggattcat cggcggacgc       960
     actcagacag agcgtgcgac caagctatcg aatgcaacta tcgaggctct cggtattgat      1020
     gaggccgatg gctgggatac tgtggtggcg aagcgcccaa agaagaagaa gatggaagag      1080
     gacgacgagg agtatgtgga cagcgtgcag cccaagtcgc tggatgagga tggtgtgacc      1140
     aaggtcatgg cggctcttgt gcagtgccag gagaagtgga tcgcggtcaa actgctaggt      1200
     cgtatccagc gctgtgacga tgaacgcgtt cgcaatcgcg tggtcaggat gcacggatac      1260
     cagatcctga actcccagct cgctcaatgg aaggaagacc agaacgtggt tttgcagatc      1320
     ctgaacatcc tcgacggctt cccgcgactc acccggaaca agatccagga ctccaagatt      1380
     gagacgaata ttcggccgtt gacgacctgt gatgatgagc gcgtcccgaa gaaagcagtc      1440
     gcccttcttg agagctgggc tggtctggaa gtcgcatacc gaatcccgcg catgaaacgc      1500
     ggcaaggacg cgaagcaggc aatcaaccag ttcgagcgcc gcgaaactgg acaggagcag      1560
     cgccagcgat ctctcacccg ctctccatct cctgtgtacg atgctcctcg tgggccggca      1620
     cagcaacgaa gagaccgagg tcctcagcgg tccagacaac ccaaccgtcg tggtccccgg      1680
     cccttgcctg agggatggta tactgcagag gcagagggcc gcgtttacta ctactccgca      1740
     tcaggcaaaa caacatggga acggccaact ttgcctgcta cccctgctac tcctgcgccg      1800
     ggtcaacccg ccaaaaacca acaaaatttg gcattgcaga gtatcattga cgggatcatg      1860
     aacacccagg aagacacacc ttccgagaac cgaactgcta cacccgtgac tcctcagcct      1920
     tccgccgatc aaccggaaag aagacacaaa gatggagaga aatggaggaa gcttccattg      1980
     gagaaacaga agagaatata cgagaacacg gtgacttttc ccgcttatca agcccgtggt      2040
     ggatcagtac aaacacaaga tccctga                                          2067
//

If you have problems or comments...

PBIL Back to PBIL home page