(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE111

PENCW_16.PE111       Location/Qualifiers
FT   CDS_pept        join(254424..254430,254587..255023)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128441"
FT                   /orf_name="Pc20g01110"
FT                   /product="Putative uncharacterized protein Pc20g01110 "
FT                   /protein_id="CAP85440.1"
FT                   /db_xref="UniParc:UPI0001831E42"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS5"
FT                   /transl_table=1
FT                   /translation="MKSKYVDRGKHEAEKSQDATPNPGSEVHSTGDDEAVAGASASSPL
FT                   EDDDAASLKRKRNGTLNVDGAEDGASSPSKRQKSTPPPPPPPPPPADLPQDDADGDTSM
FT                   GNTGNDSSHPKDDSGAGVDVNMEIEAENNPQTERPQISVEGQV"
     atgaaatcca aatacgtgga tcgcgggaaa cacgaggccg agaagtcgca ggacgctact        60
     ccgaaccccg gaagcgaagt tcacagcacg ggtgacgatg aagccgttgc gggtgcatct       120
     gcgagttctc ccctggaaga cgatgacgct gcatcgctca aacgcaagcg gaacggaacg       180
     ctgaacgttg acggtgctga agatggagca tcctctccgt ctaagcgaca gaaatctaca       240
     cctccaccgc ctcctcctcc gccccctcca gcggatcttc ctcaagatga tgccgacggt       300
     gataccagca tgggaaacac tgggaatgac tcttcacatc cgaaagacga ctccggcgct       360
     ggagtcgacg tcaacatgga gatagaagcg gagaataacc cacaaacgga gcgacctcaa       420
     atcagtgtcg agggacaagt ctaa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page