(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE112

PENCW_16.PE112       Location/Qualifiers
FT   CDS_pept        join(complement(256807..256841),complement(256675..256746),
FT                   complement(256416..256502),complement(256134..256322),
FT                   complement(255666..256026))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230605" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977581"
FT                   /orf_name="Pc20g01120"
FT                   /product="Pc20g01120 protein"
FT                   /function="ribosome binding"
FT                   /biological_process="mature ribosome assembly"
FT                   /protein_id="CAP85441.1"
FT                   /db_xref="GO:0042256"
FT                   /db_xref="GO:0043022"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniParc:UPI0001831E43"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH38"
FT                   /transl_table=1
FT                   /translation="MAVRAQFENSNEVGVFSCLTNAYAIVAVGASENFYSVFESELQDV
FT                   IPICHATIAGTRIVGRLIVGNRKGLLVPTTTTDQELQHLRNTLPAEVKIQRIEERLSAL
FT                   GNVICCNDHVAIVHPDLERETEEIIADVLGVEVFRQTVADNVLTGSYMALSNQGGIVHP
FT                   KTSIRDQDELSSLLQVPLVAGSVNRGSPVVGAGMVVNDWLAITGLDTTATELSVVESVF
FT                   RLGEMAPGGAGGAAVNKDSIVESFY"
     atggctgttc gcgcgcaatt cgagaactct aacgaggtcg gtgttttctc ttgcctgaca        60
     aatgcctacg ctatcgttgc ggttggtgct tcggagaact tctacagtgt cttcgaatct       120
     gaactccaag atgtcatccc catctgccac gcaaccatcg ccggaacccg cattgtcggt       180
     cgtctaatcg tcggtaaccg caaaggtctt ctcgtcccca caaccaccac agaccaagaa       240
     ttgcaacatc tgcgtaacac gcttccggcc gaagtcaaaa tccaacgcat agaagagcgc       300
     ctctccgcgc tcggcaatgt tatttgctgc aacgaccatg tcgcaatcgt gcaccctgat       360
     ctggagcgtg agaccgagga gatcatcgcc gacgtcctcg gtgtagaagt tttccgtcaa       420
     acagtagccg acaacgtcct cacaggctcg tacatggccc tctcgaacca aggtggaatc       480
     gtgcacccca agacctcaat ccgcgaccag gacgagctct cctcgctctt gcaagttcct       540
     ctcgtggcag gcagtgtgaa ccgcggctct ccagtcgtcg gcgccggcat ggtcgtcaac       600
     gactggctcg ccatcaccgg actggacacc acggccaccg agctgagcgt tgtcgagtct       660
     gtgttcagac ttggtgagat ggcgcccggt ggtgccggcg gtgctgctgt caataaggat       720
     agtattgtgg agagtttcta ctag                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page