(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE116

PENCW_16.PE116       Location/Qualifiers
FT   CDS_pept        join(complement(270614..270722),complement(269869..270447),
FT                   complement(268849..269705))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172163" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671672"
FT                   /orf_name="Pc20g01160"
FT                   /product="Pc20g01160 protein"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="CAP85445.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniParc:UPI0001831E46"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH41"
FT                   /transl_table=1
FT                   /translation="MWRRTYLLLLVIRVYFALSPSYLHPDENFQGPELFADHQNAGRIF
FT                   SFPSKLPWEFTVEHPIRSIFPLWATYELPMSLLKWFYTEIGSGSPPPHLVYYALRGGMF
FT                   LLSFVLEDWAIYELVPSPRHRRAIVVLVASSYVTWTYQTHTFSNSLETLLVAWGLVLIR
FT                   RIVENKVRRDKASKYTIHADLTPSDTRPSSPTPCSPSSPWWASSTASPSRLSFYSRVCN
FT                   CCLSSSATSLLSALRDPIITPLNNLLYNTDTSNLAQHGLHPRHQHFTANLLQLLGPVYI
FT                   TMLVSLFSWPLVPYWMRNVRALSALSATMLLSLFPHQEPRFLLPAVPLLLSCVPMRRSR
FT                   LLLAVWVIFNAAMGFLMGVYHQGGVVPTQLAMRDIVSSSTTHHIPSATVFWWKTYSPPL
FT                   WLLGGDNQTTEIQTLDLMGMSGAEMMLQLEKVVPACSTPSPVFLVAPTSAAFLDPYAVS
FT                   ARQSRDQNLQLHPLWSYRKHLNLDDMDFGEDGILPTLKRVVGRRGLGVWSVRRSCK"
     atgtggcgtc gaacatatct actgttatta gtgattcgcg tgtacttcgc actgtcacca        60
     agctatctac atcccgatga gaatttccaa ggcccagagc tctttgcaga tcaccaaaat       120
     gcaggtcgca tattctcatt tccgtcaaag ctaccatggg agtttaccgt tgagcatccc       180
     atccgcagca tattcccatt atgggcgacc tacgagcttc caatgagcct cttgaaatgg       240
     ttctatactg aaatcgggtc gggcagtccc ccaccccact tggtctacta tgcgctgcgc       300
     ggtggaatgt tcctgttgag ttttgtgctg gaggactggg cgatctatga gctagtgcct       360
     tccccgcgtc atcggcgcgc aatagtggtg ctggtggcct cgtcctatgt cacctggacg       420
     tatcagacgc acacattctc caacagcctc gagaccctgt tggttgcctg ggggctggtt       480
     ctgattcggc gcattgtcga gaataaggtg cgaagagata aagcttcgaa atacactatt       540
     cacgctgact taactcccag cgacactcgt ccttcttctc ccacgccgtg ctcgccttca       600
     tcgccgtggt gggcgtcttc aaccgcatca ccttcccggc tttccttcta ttcccgggtc       660
     tgcaattgct gcctcagttc cagcgcaacc tccctcctca gcgccctccg cgatcccata       720
     ataactcccc tcaacaacct cctctacaat accgacacgt ccaacctagc ccagcacggc       780
     ctccaccccc gccatcaaca cttcaccgca aacctcctcc aactcctcgg tccagtgtac       840
     ataaccatgc tagtctccct cttcagctgg ccactggtgc catactggat gcgcaatgtg       900
     cgggccctct ccgcgctctc cgcaaccatg ctcctctccc tcttccccca ccaagaacca       960
     cgcttcctcc tcccagccgt accccttctc ctcagctgcg tccccatgcg ccgctcccgt      1020
     ctcctcctcg ccgtgtgggt catcttcaac gcagccatgg gcttcctcat gggcgtgtac      1080
     caccaaggcg gcgtggtccc cacgcagtta gcaatgcggg acatcgtctc gtctagcaca      1140
     acacaccaca taccttccgc gacagttttc tggtggaaga catactcacc gccgctgtgg      1200
     cttctcggcg gggacaacca gaccacagag atccagactc tggatctcat ggggatgtcc      1260
     ggtgcggaga tgatgctgca gctggagaag gttgtacctg cctgctctac tccatcgcct      1320
     gtattcctgg tcgcgcctac atcggctgcg ttcctcgatc catacgctgt gtccgcgcgt      1380
     cagagccgag accagaactt gcaacttcat ccactttggt cgtaccgcaa acaccttaac      1440
     ctcgatgaca tggacttcgg cgaagacggg atcctgccga ctctgaaacg ggtcgttggg      1500
     cgtcgcgggc tgggtgtttg gtctgtgcgg agatcttgca aatag                      1545
//

If you have problems or comments...

PBIL Back to PBIL home page