(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE118

PENCW_16.PE118       Location/Qualifiers
FT   CDS_pept        join(273241..273294,273385..273792)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128694"
FT                   /orf_name="Pc20g01180"
FT                   /product="Putative uncharacterized protein Pc20g01180 "
FT                   /protein_id="CAP85447.1"
FT                   /db_xref="UniParc:UPI0001831E48"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH43"
FT                   /transl_table=1
FT                   /translation="MAKACCSKFGCGRHIMKRNGRAEGANTEGPLRPSGSTYASGGAWR
FT                   CICFSSVSAIRSIQCNSRISFSPLLGSCGRRVDGYVRFPFLSRVSVSLFPQMANSDIKM
FT                   DFGSRKQRCDLPDGVVGAQTDPLGDGAVLTLSFGKLLLGAEGLVALCGK"
     atggccaagg catgttgttc gaaattcggt tgtgggcgtc acatcatgaa gaggaatggc        60
     cgggcggagg gtgcgaatac tgagggtccg cttagacctt cagggtcgac ttacgccagt       120
     ggcggcgctt ggcgttgtat ctgtttcagc agtgtatcag ccatacgttc gattcaatgt       180
     aattcccgta tctctttttc tccattgttg ggttcgtgcg gtcggcgggt ggatggttat       240
     gtgcgtttcc ctttcctctc tcgcgtttcc gtatcactct tcccacaaat ggcgaattcg       300
     gatataaaga tggattttgg atctcgaaaa caaaggtgcg atttacctga tggtgttgtt       360
     ggtgcgcaga cggatccact gggggatggg gcggttctga cgctgagctt tggcaagctt       420
     ttgcttggtg cggaaggtct tgtggctctg tgtggaaaat ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page