(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE119

PENCW_16.PE119       Location/Qualifiers
FT   CDS_pept        join(273853..274014,274059..274124,274236..274358)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824353"
FT                   /orf_name="Pc20g01190"
FT                   /product="Putative uncharacterized protein Pc20g01190 "
FT                   /protein_id="CAP85448.1"
FT                   /db_xref="UniParc:UPI0001831E49"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH44"
FT                   /transl_table=1
FT                   /translation="MANVFFENGGNRSLTYRHLEGLIATASLLDGRMKLSTFECGWFVC
FT                   GRAWLRFGWAETISAKWVNFYECSVYAHTAQDRWKQSSYNAICVLQCQAVLYCRISKLA
FT                   LEALIRNLVSRE"
     atggcgaatg tatttttcga gaatggcggg aacaggagtc taacataccg gcatcttgaa        60
     gggttgatcg cgacggcgag cttgttggat ggacggatga agttatcgac cttcgagtgt       120
     ggatggtttg tgtgcggcag ggcttggctt cgcttcggtt gggcagaaac aatttccgca       180
     aagtgggtca acttctacga gtgttccgta tacgctcaca ctgcccagga tcgttggaaa       240
     cagtcgagct acaatgcaat ttgcgtcctg caatgtcagg ctgttttgta ctgccgcata       300
     agcaagctag ccctggaggc cttgattcgg aacctcgtaa gccgtgaata a                351
//

If you have problems or comments...

PBIL Back to PBIL home page