(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE120

PENCW_16.PE120       Location/Qualifiers
FT   CDS_pept        join(complement(275355..275438),complement(274462..275301))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048593" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947737"
FT                   /orf_name="Pc20g01200"
FT                   /product="Pc20g01200 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85449.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001831E4A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH45"
FT                   /transl_table=1
FT                   /translation="MEIQQSLPLSNPSIYKIDPMAWMRPLSDPHSRDLEGDFPLDGKDF
FT                   DSVTDKTLAILLESAPVLHEFGAIKVVRLSRDLVMKGGGTVLPCEAKTLNLVASRTGIR
FT                   APRVHRSFQVEDDTQYFGTKGYIVMDFIPGQPLDKCWADLTSDNQRQIAIQIAEMIKEM
FT                   QSVVISQPGPPGGGPFRGRFFTDYSAGPFKDSAEFQGWFNHKLDICKHVKQCPKDIPPF
FT                   QFTTFVLTHQDISPRNLILDQNGEVWLVDWAFAGAYPPAFESAALLAQQFFTGFNEAVL
FT                   SLIPRFPEEERQLDSIAYGLTTAALA"
     atggagattc aacaatcatt gccgctcagc aacccctcca tctataaaat agatccaatg        60
     gcctggatgc gtccactttc ggatccccac agccgggatc tagagggaga cttcccgcta       120
     gatggaaagg attttgactc cgtcacagac aagaccctgg caatccttct tgagtctgcc       180
     cctgttctcc acgagtttgg cgccataaaa gtcgtacggc tctcacgaga tctggtgatg       240
     aaaggcggcg gcaccgtcct gccttgcgaa gcaaagacac tcaatctcgt cgcctccaga       300
     accggcattc gagctccacg agtccaccgt tcattccaag tcgaagacga cacgcaatac       360
     tttggtacga agggatatat cgtgatggat tttatcccag gccaacctct cgataagtgt       420
     tgggccgacc taacatccga caaccaaaga caaatcgcta tacagatcgc ggaaatgatc       480
     aaagaaatgc aatctgttgt aatctcgcag ccaggtcctc ctggtggcgg gccatttcgt       540
     ggccgattct tcacagatta cagcgccggt ccgtttaaag acagtgccga atttcaaggt       600
     tggttcaacc acaagcttga tatctgtaag catgtgaaac aatgtcccaa agatatcccg       660
     ccatttcaat ttaccacctt tgttctcacc catcaggaca taagtcctcg aaacttgatc       720
     ttagaccaga atggggaggt atggttggtt gactgggcgt ttgccggtgc atatccccct       780
     gcctttgaaa gtgctgcgtt attggctcag cagttcttta ctggctttaa tgaagctgtc       840
     ttgtctctta tcccacgctt ccctgaggaa gaacgacaac ttgattccat tgcatatggg       900
     ttgactactg cggcattggc ctaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page