(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE122

PENCW_16.PE122       Location/Qualifiers
FT   CDS_pept        278175..282176
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20671673"
FT                   /orf_name="Pc20g01220"
FT                   /product="Pc20g01220 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85451.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0001831E4B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH46"
FT                   /transl_table=1
FT                   /translation="MQQPQEGVTAVEKVADGPQLNEKPVDKRDSDSASTSTAKEHESKT
FT                   PVASDEDALYAHLPEHEKDILKQQLDAPPVNISYFGLYRYASRIDILIIVISTLCAIAA
FT                   GAALPLFTILFGSLATAFQKIMLRTIPYDEFYDQLTTNVLYFIYLGIGEFVTVYVSTVG
FT                   FIYTGEHVTQKIREHYLEAILRQNIAYFDKLGAGEVTTRITADTNLIQDGVSEKVGLTL
FT                   TAVATFVTAFIVAYIKYAPLAGICTSTMVALVLIMGGGSQLIIKFGKLSLESAGAGGTV
FT                   AEEVISSIRNATAFGTQDKLAKQYESHLLRAERWGMRLQMSLAVMVGIMFGLMFMNYGL
FT                   GFWMGSQFLVDGKVDVGQVLTILMAILIGSFSLGNVSPNASAFTNAVAAATKIFATIDR
FT                   DSPLDPTSDEGIILDHVEGHIEFRNVKHIYPSRPEVTVMNDVSLGIPAGNTTALVGPSG
FT                   SGKSTVVGLVERFYLPVGGQVFLDGHDIQTLNLRWLRQQISLVSQEPVLFGTTIYQNIR
FT                   HGLIGTRFEHESEEKIKELIENAAKMANAHEFITALPEGYETNVGQRGFLLSGGQKQRI
FT                   AIARAMVSDPKILLLDEATSALDTKSEGVVQAALDRAAEGRTTIVIAHRLSTIKSAHNI
FT                   VVFVQGSIVEQGTHSQLTEHDGPYFKLVEAQRINEEKDADALDADEDEDGLEEMTKSHI
FT                   ARVKSIASGSTCVKDEAETFQDAMHRQESRKSVSSVILSQKTAEGGRKHSLLTLIKFIG
FT                   SFNKEERWFMAIGLCFSILAGCGQPTQAFLYAKAISALSLPKTQYDKLRSDANFWSLMF
FT                   FIVGIVQIITFSVHGIAFAFSSERLIRKARGNAFRVMLRQDINFFDREENSTGALTSFL
FT                   STETKHLAGISGQTLGTILMTSTTLIASIVIALAFGWKLALVCMSVIPILLGCGFYRFY
FT                   MLAAFQARSKAAYEGSASYACEATSAIRTVASLTRETDVWSFYHGQLERQGRTSLISVF
FT                   KSSLLYAASQALVFFCVALGFWYGGTLLGHHEYDVFRFFVCFSEILFGAQSAGTVFSFS
FT                   PDMGKAKNAAAEFLRLFERRPTIDTWSEEGENLDHCEGTIEFKDVHFRYPTRPEQPVLR
FT                   GLNLTVKPGQYIALVGPSGCGKSTTIALLERFYDALSGGVYIDDKNIADLNVNSYRSHL
FT                   ALVSQEPTLYQGTIKENILLGSPNQDPTEEELVQVCKDANIYDFIMSLPEGFNTVVGSK
FT                   GGMLSGGQKQRVAIARALLRNPKVLLLDEATSALDSESEKVVQAALDAAARGRTTIAVA
FT                   HRLSTIQKADIIYVFDQGKIVESGTHTELLRNKGRYFELVNLQSLGRAG"
     atgcaacagc cccaggaggg cgtgacggcc gttgagaagg tggccgacgg tcctcagctt        60
     aacgagaagc ccgtcgacaa acgtgattcc gattccgctt ccacatcaac agcaaaggaa       120
     cacgaaagca agactccagt cgcgtcagac gaagatgcgc tctatgctca cttacctgag       180
     catgaaaagg acatcttgaa acaacagctg gatgcgcctc ctgtcaacat ctcttacttc       240
     ggtctctatc gatatgcctc ccgcatagac atactcatca ttgtcatcag cacactctgc       300
     gctatcgccg ccggtgctgc cttgcctctc ttcactattc tcttcggctc cttggccacg       360
     gctttccaaa agattatgct ccgcactatc ccctacgatg aattctatga tcaattgacc       420
     accaacgtgt tgtacttcat ctatctcggc atcggagaat tcgtcaccgt ctacgtcagc       480
     accgtcggtt tcatctacac cggagagcat gtcacccaga agattcgaga gcactacctc       540
     gaagccatcc tacgtcagaa catcgcctac ttcgacaagc ttggtgcagg tgaagtgact       600
     acccgcatca cggctgacac caaccttatt caggatggtg tctccgaaaa ggtcggttta       660
     acccttactg ccgtcgctac cttcgtgact gctttcatcg ttgcatacat caagtatgcc       720
     cccttggctg gcatatgtac ttcgactatg gtcgcgctgg tcctcatcat gggcggaggc       780
     tcccaactga tcatcaagtt tggcaagctt tccctggaaa gtgccggtgc cggtggaact       840
     gtggcggagg aagtcatcag ctcgatccgc aatgcgaccg cattcggtac tcaagacaag       900
     ctcgcaaagc agtacgagtc ccacttgctt cgcgcagagc gctggggcat gcgcctccaa       960
     atgagtcttg ccgtgatggt cggtatcatg tttggactca tgttcatgaa ctacggcctc      1020
     ggattctgga tgggatctca gttcctggtg gatggtaagg ttgatgtcgg gcaagttttg      1080
     accatcttga tggctattct tatcggttct ttctccctgg gcaatgtcag cccgaacgcg      1140
     tcagcattta ccaatgctgt ggcggccgct accaaaatct ttgcgactat cgaccgggac      1200
     tccccgctgg accctacttc ggacgaaggc atcatccttg accacgtcga gggtcatatc      1260
     gagttccgca atgtgaaaca catttacccc tcccgtccgg aagttactgt catgaatgac      1320
     gtttccctcg gcattcctgc tgggaacacc accgcattgg tcggaccctc aggttctggc      1380
     aagagcaccg tcgtcggtct tgtcgagcgg ttctatctcc cagtcggtgg tcaagtattc      1440
     ttggacggcc acgacatcca gactctcaac ttgcgatggc tacggcagca gatctccctg      1500
     gtcagccagg aacctgttct gtttggcaca accatctatc aaaatattcg ccacggtctg      1560
     attggaacac gcttcgaaca tgagtccgag gaaaagatca aggagcttat tgagaatgcc      1620
     gccaagatgg ccaacgctca cgaatttatt actgctcttc cggaaggcta tgagacaaac      1680
     gtcggccagc gtggattctt gctgtctggc ggccagaagc aacgtattgc catcgctcgt      1740
     gctatggtca gcgaccccaa gattttactt ctggacgaag ccacttcagc cctggatacg      1800
     aagtccgagg gcgttgttca ggcagcactt gatcgcgctg ctgaaggccg caccaccatc      1860
     gtcatcgccc atcgtctgtc tactatcaag tctgctcata acattgtcgt cttcgttcaa      1920
     ggatccatcg ttgagcaggg cactcactcc cagctgactg aacacgacgg tccttacttc      1980
     aagcttgtcg aggcccagcg catcaatgag gagaaggatg cagatgcttt ggacgcggat      2040
     gaggatgagg atggcctcga ggagatgacc aagtctcaca tcgcacgtgt caagtcaatt      2100
     gccagtggct ccacctgtgt gaaggacgag gccgaaacat tccaggacgc catgcatcgc      2160
     caggagtctc gcaagtccgt ttccagcgtt attctatcac agaagactgc tgaaggcggc      2220
     agaaagcact cgctcttgac tctgattaag tttatcggct cgttcaacaa ggaagagcgg      2280
     tggttcatgg ccatcggtct ttgcttctcg attcttgccg gttgtggtca accaactcag      2340
     gctttcttgt atgccaaagc tatcagcgct ctttccttgc ccaaaaccca atatgacaag      2400
     ctgagatcgg atgccaactt ctggtcactg atgttcttta tcgtcggtat tgttcagatc      2460
     atcaccttct cagtccacgg tatcgccttc gcgttcagct ctgagagatt gattcgcaag      2520
     gctcgcggca atgccttccg tgtcatgctc cgacaggata tcaacttctt cgatcgtgag      2580
     gagaatagca ctggcgcttt gacttctttc ctttcaactg aaaccaagca cctggccggt      2640
     atcagtggtc aaactcttgg aacaattctc atgacttcaa caacactcat tgcttcaatt      2700
     gtgatcgcgc ttgctttcgg atggaagctt gctctcgttt gcatgtccgt catcccgatt      2760
     cttctcggct gcggcttcta ccgtttctac atgcttgccg cgttccaggc acgttccaag      2820
     gccgcttacg agggatcagc cagctacgcc tgcgaggcta catctgccat tcgcactgtg      2880
     gcttcgctta ctcgtgagac cgacgtttgg tcattctacc atggtcaact cgagcgtcag      2940
     ggccgcacaa gcctgatctc ggtattcaaa tcatcgctct tgtatgctgc ctcccaggcc      3000
     ttggtcttct tttgtgtcgc ccttggcttt tggtatggtg gaaccctgct cggtcaccat      3060
     gaatacgacg tgttccgctt cttcgtctgc ttcagtgaaa tcttgttcgg tgctcagtcc      3120
     gctggcacag tgttctcctt ctcccccgac atgggcaagg ccaagaacgc cgccgccgag      3180
     ttccttaggt tgttcgagcg tcggcctaca attgacacat ggtccgaaga gggcgagaat      3240
     ttggaccact gcgaaggaac cattgagttc aaggacgtgc acttccgcta ccccacccgt      3300
     cccgagcagc ctgtgctccg cggtctgaac ctcactgtca agcctggcca gtacattgcc      3360
     ctggtcggac ctagtggatg cggcaagagt acgaccattg ccctcctcga acgtttctac      3420
     gatgctcttt ccggaggtgt ctacatagat gacaagaata tcgccgacct caatgttaat      3480
     tcctaccgca gtcacctggc gctggtcagc caggagccca ccctctacca gggtaccatt      3540
     aaggagaaca tcctgctcgg tagccctaac caagatccaa ccgaggagga gcttgtccag      3600
     gtctgcaagg acgccaacat ctacgacttc atcatgtcgc tccccgaagg ctttaacacc      3660
     gtcgtcggaa gcaagggagg catgttgtcc ggtggccaaa agcagcgtgt cgccatcgcc      3720
     cgcgccctcc tgcgcaatcc taaggtccta cttctggatg aagctacctc ggctctcgac      3780
     tccgaatccg agaaggtcgt ccaagctgct ctggatgctg ctgctcgcgg tcgtactacc      3840
     atcgctgtgg ctcaccgtct cagtaccatt caaaaggccg atatcatcta tgtcttcgac      3900
     caaggcaaga ttgtcgagag cggtactcac actgagctct tgcgcaacaa gggtcgctac      3960
     ttcgagctgg tcaacctcca gtcccttggc agggccggct aa                         4002
//

If you have problems or comments...

PBIL Back to PBIL home page