(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE123

PENCW_16.PE123       Location/Qualifiers
FT   CDS_pept        join(complement(282940..282987),complement(282785..282870),
FT                   complement(282536..282695))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977582"
FT                   /orf_name="Pc20g01230"
FT                   /product="Pc20g01230 protein"
FT                   /protein_id="CAP85452.1"
FT                   /db_xref="InterPro:IPR010760"
FT                   /db_xref="UniParc:UPI0001831E4C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH47"
FT                   /transl_table=1
FT                   /translation="MDQAKETRSFRDQERVDNLRASIASLEAKYARLEADLASVTAQLK
FT                   DDYNTTCVRYTQLLHEYNDIRDVGQGLMELIADARGVRQVEVVREFGFSEED"
     atggatcaag ccaaagaaac caggtccttc cgagaccagg aacgagtgga caacctccgc        60
     gcttcgattg caagtctaga agctaaatat gcgaggctcg aagccgactt agcttcagtg       120
     accgcccaac tcaaggacga ttacaatacc acatgcgtac gctataccca gctcttgcat       180
     gagtacaatg acatcaggga tgttgggcag ggattgatgg agcttattgc tgatgccagg       240
     ggggtgaggc aggtcgaggt ggtgagggag tttgggtttt cggaggagga ttga             294
//

If you have problems or comments...

PBIL Back to PBIL home page