(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE125

PENCW_16.PE125       Location/Qualifiers
FT   CDS_pept        join(complement(286663..286702),complement(286557..286614),
FT                   complement(286322..286508),complement(285377..286270))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172217" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947739"
FT                   /orf_name="Pc20g01250"
FT                   /product="Pc20g01250 protein"
FT                   /function="binding"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAP85454.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000183110A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH49"
FT                   /transl_table=1
FT                   /translation="MAEQQDNAQSISADEIALYDRQIRLWGVHAQEKIRSANILLITVK
FT                   ALANEVAKNLVLAGIGSLTIIDHQDVTEEDLGAQFFIAEAQSEKDVIGKNRAQVAGPQI
FT                   HKMNPRVKLNIDTSDVKTKQPDFFAQFDITIATELDFLTNTTVNAACRLANRPFYAAGL
FT                   HGLYGYVFADLISHDFVIERNKSNMPPATQETPTRSIIDITTKKEQNEANKEESKIIEL
FT                   VTKREVYSPLILANTSPLPEEYTRLPRRRKQVTPLLSCLRALWEFEKLRGHRPTFTHED
FT                   LELFTKLSRDRHQELKLEPLTLDSVFLRTFLQNLGSELSPVAAFLGGALAQDVINVLSA
FT                   REQPLQNMLLFDGEKSVGPIYSLHPFFPDDGADMAAVPPVRNPVTVPVAGDS"
     atggcggagc aacaagataa tgcacagtca atcagtgctg atgaaatcgc cctgtatgac        60
     cgacagatcc gcttgtgggg agtgcacgca caagaaaaaa tccgatctgc aaatatcctc       120
     ctcatcactg tgaaagctct cgcgaatgaa gtggccaaga acctcgtcct ggcgggcatc       180
     gggtcactca ccataatcga ccaccaggac gtcacagagg aggacctggg agcgcagttc       240
     ttcattgctg aagcacaaag tgagaaggat gtgattggga agaatcgcgc gcaagtcgca       300
     ggaccgcaaa tccacaaaat gaaccctcgg gttaagctca acatcgacac ttccgatgtc       360
     aaaactaaac aacccgactt cttcgcgcaa tttgacatca cgatcgccac agagctcgac       420
     tttctaacca acaccactgt gaatgccgcc tgccgattag ccaacaggcc cttctacgcc       480
     gctggtctac acggcctcta cggctacgtt ttcgccgacc taatcagcca cgacttcgtg       540
     atcgagcgca acaaatccaa catgcctccc gcaacccaag aaacacccac ccgcagcatc       600
     atcgacataa ccaccaagaa agaacaaaac gaggccaaca aggaagaaag caagatcatc       660
     gagctagtca ccaagcgcga ggtatactcg ccgctcatcc tcgcaaacac ctccccactg       720
     ccggaagaat acactcgact cccacggcgt cgcaagcaag taaccccgct actcagctgc       780
     ctgcgcgcac tgtgggaatt cgaaaaacta cgcggccacc gtccgacctt cactcacgaa       840
     gacctggaac tattcacgaa gctatcgcgc gaccgacacc aggaactgaa gctggagcca       900
     ctcacattgg attctgtgtt cttacggacg ttcctgcaaa acctgggtag cgagttgagt       960
     cccgttgcgg cgtttttggg cggtgcgctg gcgcaggatg ttattaacgt tctttcggcg      1020
     agggagcagc cgctacagaa tatgttgctg tttgatgggg agaagagcgt tggcccgatc      1080
     tattcactcc atcctttctt ccctgatgat ggtgcggata tggctgctgt gccgccggtc      1140
     aggaacccag ttacagttcc tgttgctggg gattcgtga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page