(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE126

PENCW_16.PE126       Location/Qualifiers
FT   CDS_pept        join(287846..287848,287904..288694,288756..289361,
FT                   289412..289518,289586..289645,289710..289777,2
FT                   89869..290102)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172218" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947740"
FT                   /orf_name="Pc20g01260"
FT                   /product="Pc20g01260 protein"
FT                   /protein_id="CAP85455.1"
FT                   /db_xref="UniParc:UPI000183110B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH50"
FT                   /transl_table=1
FT                   /translation="MSGNYDYPRASSSSSRRISRTIRPDERPEILRLQHLRNFVSERNR
FT                   SGAHNAYNATLALETLNREVAEHSLDRARDRTNFEQARADIDRQIQQLHSETAGPAERI
FT                   RSIWLDQIRSERARTSLSPESHSLRHRLPWQTLRPPSPDGSLSRSPPLMPPSGQSGRDG
FT                   QGRMKRRKLDTDDNREEFRGFNYGQYGQVVPGMLQMEIASCDGGSYDPDSGCSRPENVL
FT                   DNNTSVYSTKEARCNLVLCHRGEAPFCLKKIVIKAPQCGFDAPIQEGMVFVAMTSDELL
FT                   ARTAQYQIQYSSGRYRRRGRRSGMQPSQEYLTGFRPPLQNLERTVLMSPHSAAVPQTAE
FT                   DPQAQFHITTEYDENNEDSDDDEDWRSALLERTQAEQTEDPLSDTDESPSDEEDPSSRH
FT                   QRRRQIESERLSTLSRVSEQRLRHGPSLVYPNPPAEPAHPAAEVLKPHARFFIEREKSM
FT                   VTIKFDPPPSGRFILIKLWSPRAHGNIDIESIIAHGYAGPRFFPTFHFLFVYSISAATF
FT                   LLASTIDHTNYVVCGIVRYLVTSKAWQVRANNLNDTYNALLHPWMLPPSSTFAIPNLGT
FT                   YIGNLSGMTTAMTYSLYIQHSGDDREREPINPHGLDHIIARRHLAL"
     atgtctggga attacgatta tcctcgtgct tcttcctctt catcccgtcg catatcccgt        60
     actatcaggc ctgacgaacg ccctgagatt ctccgtctcc agcatctccg caatttcgta       120
     tcggaacgaa atcgctccgg tgcccacaac gcctacaacg ccacccttgc tttggaaaca       180
     ttaaaccgag aagtggctga gcattctctg gaccgagctc gcgatcgcac caactttgag       240
     caagcccggg ccgacatcga tcgccagatc caacaactgc actccgagac agctggcccc       300
     gcagagcgaa ttcggagcat ttggctcgac cagattcgct cagaacgggc ccgcacatcg       360
     ctctccccag agtcacattc ccttcgccat cgtttgccct ggcaaacgct tagaccacca       420
     agcccagacg gatctttatc caggtcgccg cccctaatgc caccatccgg ccagtcgggc       480
     cgtgatggcc aaggacggat gaagcgtcgc aagctggaca ctgatgataa ccgtgaggaa       540
     ttccgaggct tcaactatgg tcaatacgga caagtggtac cgggaatgct gcaaatggaa       600
     atcgctagct gcgacggggg aagctacgat ccggacagcg ggtgttcgcg cccagagaat       660
     gttttggaca acaatacaag tgtctactct accaaagagg cccgttgcaa cttggtcctc       720
     tgtcatcggg gcgaggcccc gttctgcttg aagaagatcg ttatcaaagc ccctcaatgc       780
     gggttcgatg ctccaataca agaaggtatg gtatttgttg cgatgacctc tgatgaactg       840
     cttgcccgca ccgctcagta ccaaattcaa tactccagcg gccgataccg ccgtcgaggc       900
     cgccgcagtg gcatgcaacc atcccaggaa tacctcactg gcttccgacc gccactccaa       960
     aatctcgaac gcacagtcct catgagccca cattcagccg ccgttccgca gaccgcagaa      1020
     gacccgcaag cgcagttcca catcaccacc gagtacgacg agaataacga agattcagac      1080
     gatgacgaag actggcgctc tgcattgctc gagagaaccc aggccgagca gacggaagat      1140
     cctttatcgg ataccgacga aagtccaagc gatgaggaag acccttcaag cagacatcag      1200
     cgtcgccgac aaattgaatc agaacgactg agtactctca gccgcgtcag cgagcagaga      1260
     ctgcgccatg gcccgagtct cgtgtatcca aaccccccag cggagcctgc tcacccagct      1320
     gccgaagtcc taaagccaca tgcgcgtttc tttatcgagc gagagaagag catggttacc      1380
     atcaaatttg atccgccgcc atctggtcgg ttcattctca ttaagctgtg gagcccgcga      1440
     gcccacggaa atattgatat cgaaagcatt attgcacatg ggtatgcagg cccgcgcttc      1500
     ttcccaactt ttcattttct tttcgtctat agtatttcgg ccgcaacttt cttactagcg      1560
     agcactatag accacactaa ctatgtagta tgtgggatcg taaggtatct agtaacgtcc      1620
     aaggcatggc aggtgcgtgc taataatttg aacgatacct acaacgcact gttacatcca      1680
     tggatgctac ccccgtcctc gacattcgct attcccaatc tgggcaccta cataggcaat      1740
     ctctccggca tgactacagc catgacctac tctctctaca tccagcacag tggcgacgac      1800
     agggagcgtg aacctataaa cccccatggc ctagaccaca tcattgcacg cagacatctc      1860
     gccctataa                                                              1869
//

If you have problems or comments...

PBIL Back to PBIL home page