(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE127

PENCW_16.PE127       Location/Qualifiers
FT   CDS_pept        join(291774..292383,292460..293166)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947741"
FT                   /orf_name="Pc20g01270"
FT                   /product="Pc20g01270 protein"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP85456.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019103"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000183110C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH51"
FT                   /transl_table=1
FT                   /translation="MRITVSVIRPEQADSDIINLEVGGDMSIELLKAIVESETSIPPEA
FT                   QQLVYNNQLLQNPSQTLDQAGITEGDMLGVHVTLRAPQPAPRPAASSSVAPRQNAQPRP
FT                   GMPDPETIRLHILGDPRVREAVRRQNPELSEAADNAQRFREVLLRQQQGEAQREAEKEA
FT                   RIAMLNADPFNHDNQKEIEEIIRQNAVTENLHNAMEHHPESFGRVTMLYIPVEVNGHRL
FT                   NAFVDSGAQVTIMSPECATSCNIMRLVDRRYGGIAKGVGTAPILGRVHSAQIKIGEMFL
FT                   PCSFTVMEGKQIDLLLGLDMLRRHQACIDLQRGALVIQDQAVPFLGESDIPKHFTEEFE
FT                   AEPTVKGADGAEVGARTGAVTHKAENNPNANATPNIASASGSGASGSQPRINIRPAPTS
FT                   RWPQDSIARITELGFSREEAVRALDMAHGDLEGAIGFLI"
     atgcgtatca ccgtcagcgt catccgccct gagcaggcgg actccgacat catcaaccta        60
     gaagtgggcg gtgatatgtc aatcgagctc ctcaaagcta ttgtcgaaag cgaaactagc       120
     atcccacccg aagcccaaca gcttgtctat aacaaccagc tcctccaaaa cccctcccaa       180
     accctagacc aagccggcat caccgagggc gacatgctcg gtgtgcacgt caccctccga       240
     gctccccaac cagcccctcg ccccgccgct tccagctccg tcgcgcccag gcagaacgct       300
     caaccccgcc ccggcatgcc ggaccccgaa actattcgtc tacatatcct gggtgatccc       360
     cgcgtgcgcg aggctgtccg caggcagaac ccagagctgt ctgaagccgc ggataatgct       420
     cagcgcttcc gtgaggtcct gcttaggcag cagcagggtg aggcgcagcg ggaggcggaa       480
     aaggaagccc gcattgcgat gctcaatgcc gatcctttta accacgataa ccagaaggaa       540
     atcgaggaga ttattcgcca gaatgctgtt acggaaaatc tacacaatgc catggagcat       600
     catcccgagt ccttcggtcg cgtgacaatg ctctacatcc ccgtggaagt aaacggccac       660
     cgtctaaacg ccttcgtcga ctccggcgct caggtgacta tcatgtcgcc cgagtgtgca       720
     acatcgtgta acataatgcg cctggtagac cgtcgctacg gcggcatcgc caagggcgtc       780
     gggaccgccc cgatcctggg ccgggttcac tctgcccaga tcaagatcgg cgagatgttc       840
     ctgccctgct ccttcaccgt catggaaggg aagcagatcg acctgctcct cggtttggac       900
     atgcttcgcc gacaccaggc ctgcatcgat ctccagcgtg gtgcgcttgt cattcaggac       960
     caggccgtcc ccttcctcgg tgagagtgat atccccaagc actttactga agagttcgag      1020
     gcggaaccta cggtcaaggg tgccgatggt gccgaagtgg gtgcccgcac cggcgcggtc      1080
     acgcataaag cggagaacaa tcctaatgcc aatgccaccc ccaatattgc atccgcctcc      1140
     gggtccggcg cgtcagggtc acagccaagg atcaatatcc gacctgcgcc tacttcgcgg      1200
     tggccgcagg actccatcgc caggatcacg gagctgggat tctcgcgcga ggaagccgtc      1260
     cgggctctgg atatggcaca tggagacctg gagggggcga tcgggttttt gatttga         1317
//

If you have problems or comments...

PBIL Back to PBIL home page