(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE133

PENCW_16.PE133       Location/Qualifiers
FT   CDS_pept        join(303541..303628,303678..304103,304155..304270)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000007299" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947744"
FT                   /orf_name="Pc20g01330"
FT                   /product="Pc20g01330 protein"
FT                   /function="5-formyltetrahydrofolate cyclo-ligase activity "
FT                   /function="ATP binding"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="CAP85462.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="GO:0030272"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="UniParc:UPI0001831112"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD70"
FT                   /transl_table=1
FT                   /translation="MAFQAAKRDLRKRMRSTLQGLSATSISQQSSAATTTFLSLPEYQT
FT                   AKSIAVYLSMPSGELSTTGIVKDALQRGKNVYIPYIHTQGKTSIMDMFALGSVSEFESL
FT                   QRDKWGIPSLLSTQIEGRPNGLAQGLDLIVMPGMAFDHGFRRLGHGKGYYDHFLTRYST
FT                   STHKMPFLVALSLQEQLLAEDIPVVEHDWLVDAIVVGDGQFLNRRA"
     atggcgttcc aggctgcaaa gcgcgacctc cgcaagagga tgcgctcgac tctgcagggt        60
     ctgtctgcaa cctcaataag tcaacaatcc agcgcggcaa cgaccacttt cttgtcactt       120
     cccgagtacc aaaccgccaa aagcatcgcc gtatacctgt caatgccaag cggggaactc       180
     tcaacgactg gaatcgtaaa ggatgctcta cagcgtggga agaacgtcta catcccttat       240
     attcacaccc agggtaagac atccatcatg gacatgttcg cgctcgggtc tgtatccgag       300
     ttcgagtcat tacagcgaga caaatgggga atcccatctc tcttatctac gcaaatcgaa       360
     ggtcgaccga acggattggc acagggcttg gatcttattg tcatgccggg catggccttt       420
     gaccacgggt tccgacgact tggtcatggc aaagggtatt atgatcattt tctaactcga       480
     tactcaacat cgacccacaa aatgccattc ctcgttgccc tttctctcca agaacagttg       540
     ctcgctgagg atattcctgt ggtggagcac gattggttgg ttgatgccat cgtggttggc       600
     gatggtcaat tcttgaatcg cagggcatag                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page