(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE134

PENCW_16.PE134       Location/Qualifiers
FT   CDS_pept        join(complement(304818..304863),complement(304556..304671),
FT                   complement(304408..304498),complement(304304..304353))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223543" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947745"
FT                   /orf_name="Pc20g01340"
FT                   /product="Pc20g01340 protein"
FT                   /protein_id="CAP85463.1"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI0001831113"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD71"
FT                   /transl_table=1
FT                   /translation="MYQHLTAETGSKRGSSRKTLLAPIHFIFSLLQKRSTVSIWLYEQL
FT                   AFRIEGKIRGFDEFMNLVIDDAVEVRLATKTEEEKRRPLGQILLKGDNVSLIQAV"
     atgtatcagc atctgactgc ggaaacgggt tcgaagaggg ggagcagccg caagacattg        60
     ttggctccaa tccacttcat tttcagtctc ctgcagaaac gcagcactgt ctccatctgg       120
     ctatatgagc agctcgcttt ccggatagaa gggaagatcc gaggatttga tgaattcatg       180
     aacctggtca ttgacgacgc cgtcgaagtg cgcctggcca ccaagacaga ggaagagaag       240
     cgcagaccac taggccagat cctcctcaag ggagacaatg tctctctgat ccaggccgtt       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page