(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE135

PENCW_16.PE135       Location/Qualifiers
FT   CDS_pept        join(304907..305032,305093..305185,305233..305505,
FT                   305557..305647,305713..307953,308005..308093)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181190" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824356"
FT                   /orf_name="Pc20g01350"
FT                   /product="Pc20g01350 protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAP85464.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001831114"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD72"
FT                   /transl_table=1
FT                   /translation="MASKEAGQAFAPVLAAVATMQGNVSRTEKTQAHEFLEKFQKSIEA
FT                   WTTTHALLQSPDVPVEAKLFAATTLKGKIIFDLDQLPPDSVLALRDSVLNLLVAFAPGP
FT                   RPIQTQLCVCLASLAIQMVTWKDVLATVGAALGGSAGDCVLEFLKILPEEVTEGRKINL
FT                   SEDELVDRTKELLEDNAEQVMQLMIQYAQSSPAAATNPRLLDCITSWLREIPAAKVVES
FT                   PLMDVIFKALDNDASFDAGVDCVCTLYRDTKDVDESLPVIQALYPRLMALRPKIAETAE
FT                   AEDLEAFKGITRMFAEAGEAWVVLVARLPGEFQGLVEALLECCARDWERDAVSLTFIFW
FT                   YELKQYITLDRYTDARVAFQPVFAQLVDIMVKHLEFPTPEEGEGEDLFSGDREQEEKFR
FT                   QFRHAMGDVLKDCCAVVGVNDCLAKIYQLIQEWVAKYASQASNEHVPHWQELEAPLFGL
FT                   RAMGRMVDPEESTILGQLIPLIVQIPDQEKVRFQAIMALARYTEWTALHPETLEAQLNY
FT                   VISGFHHSSQEVVQASALAFKFLGTDCQKLLGGHIAQLHTFFESVLDKLKPTSQEEVTE
FT                   GVAAVVSVQPHEKIYDSYKMFCDPIMARIMNLANNAQTEEDQRAVADHLQLITIFVQVV
FT                   TPILAPGEENPAVKYCGEVLPIMTTIVMNFTSSTPILERVCRCWRYMIISYRTGMIPLL
FT                   PTLAQSIANGFQASREGCFLWATDAVVREFSDGAEYVDQATSDAVFQFYEQQAIAFLRI
FT                   LNDLPPQNLPDVIEDFFRLSSNAVRYYPKKYITSSLAVPIFSAALSALTLQQLDPLIAT
FT                   LHYYRDLFSFAFDKPMVSQFTSPEGQPYVTPPEVREAVKTLIISQGQPLAQRVLTGMMF
FT                   TFPGDCFPDASGVLMTMFELLPQETGAWLQTTLQMLPSGTMKHGEAERLLKNVSDKVQS
FT                   GETRKIRVLLQDFTNSYRRRNVAPRDGLGRLEAARFRFSG"
     atggccagca aggaagccgg gcaggcattc gccccggtcc tggcggccgt cgcgacaatg        60
     caaggaaatg tgtctcggac tgagaagact caggcacatg aattccttga gaagttccag       120
     aaatcgattg aggcctggac aacgacccat gctctattac agtcacccga tgtgcccgtc       180
     gaagccaaac tattcgccgc gactacactg aaaggaaaaa ttatattcga tctcgatcaa       240
     ctccctccgg actcagtttt ggcccttcga gattcggttc taaacctatt ggttgcattt       300
     gcgccgggcc cgcgccctat tcagacccag ctatgcgtgt gcttggccag tttggcgatt       360
     cagatggtca catggaagga cgtcctagcg actgtcggag cagctctagg aggcagcgcg       420
     ggggattgtg ttctggagtt cctaaagatc ttgcccgagg aggtcactga gggtcgcaaa       480
     atcaatctca gcgaagacga attggtcgac agaaccaaag agctgctaga agacaatgca       540
     gagcaggtca tgcagctgat gatccaatat gcccaatcgt cacctgctgc cgcaacaaac       600
     ccccgtcttc tcgactgcat tacttcgtgg ctacgtgaaa tccccgccgc caaggtcgtt       660
     gagtcacctc tcatggacgt catcttcaaa gccttggaca acgatgcgtc ttttgacgcc       720
     ggtgttgact gcgtttgcac gctttaccgc gacacaaagg acgtggacga gtcgttgccc       780
     gtcattcaag ccctttatcc gcgattgatg gcacttcgcc caaaaattgc cgaaactgcc       840
     gaggccgaag atttggaggc tttcaagggt atcacaagaa tgtttgcgga ggcaggtgaa       900
     gcatgggttg tccttgttgc ccgcctgccg ggtgagttcc agggactcgt ggaggcgctt       960
     ctcgaatgtt gcgcacggga ctgggagcgc gacgcagtgt ctctgacttt cattttctgg      1020
     tacgaactga agcaatatat tactctcgac cggtacaccg atgctcgagt cgcgttccag      1080
     cccgtctttg cccagttggt ggacatcatg gtgaaacacc tcgagttccc tactccggaa      1140
     gagggcgagg gggaggatct gttttctgga gaccgcgagc aggaggaaaa attccgccaa      1200
     ttccgccatg caatgggcga tgtccttaag gactgctgtg ctgttgtggg cgtgaatgat      1260
     tgtcttgcta aaatctacca actgatccag gagtgggttg ccaagtatgc atcgcaggca      1320
     agcaacgagc atgttcccca ttggcaggaa ctggaggccc ctctgttcgg cctccgcgcg      1380
     atgggccgta tggtcgatcc cgaagaaagc accattcttg ggcaattgat tcctctgatc      1440
     gttcagattc ctgatcagga gaaagtgcgg ttccaggcga tcatggcgtt ggcacgctac      1500
     actgaatgga cagccctcca tcccgaaaca ttggaggctc agctcaacta tgtgatttcc      1560
     ggtttccacc attcctccca agaagttgtg caggcttctg ctcttgcctt caagttcttg      1620
     ggaaccgact gccagaagtt gcttggtggt catatcgcgc agctccatac cttcttcgaa      1680
     tcggttcttg acaagctcaa gcccaccagc caggaggaag ttactgaagg tgttgccgca      1740
     gtggtttcgg tgcagcccca tgagaagatc tatgattcat acaagatgtt ctgcgacccg      1800
     atcatggccc gaattatgaa ccttgccaat aatgcgcaga ctgaagagga ccagcgagcc      1860
     gtggctgacc atctacagct gatcactatt tttgtgcaag tggtgactcc gattcttgca      1920
     ccgggagaag aaaaccctgc cgtcaaatac tgcggtgagg ttctacccat tatgaccacg      1980
     attgtcatga acttcacgtc ttctacgcct attctcgagc gagtgtgccg atgctggcga      2040
     tacatgatca tctcttaccg cactggcatg atccctcttt tgccgactct ggcccagagt      2100
     atcgcgaacg gattccaggc ctcgcgcgag ggttgcttcc tttgggccac ggacgcggtg      2160
     gtgcgcgaat tctccgatgg tgccgagtac gtcgaccagg ccaccagtga tgccgttttc      2220
     cagttctatg agcagcaggc cattgctttc ctacggatct tgaacgacct ccccccacaa      2280
     aatctgccag acgtgattga agacttcttc cgtctctcct ctaacgccgt tcgatactac      2340
     cccaagaagt atatcacttc gtcccttgcc gtccccatct tctccgccgc cctcagtgct      2400
     ctcactcttc aacaacttga ccctctaatc gctacgctgc attattaccg tgatttgttc      2460
     agctttgcat tcgacaagcc tatggtctcc caattcacca gccccgaagg ccagccttac      2520
     gttacccctc ctgaggttcg cgaggccgtt aagacgttga ttatctcgca aggccagcct      2580
     ttggcgcagc gtgtgttgac gggcatgatg ttcactttcc caggcgactg cttccctgac      2640
     gcgtcgggag ttctgatgac gatgttcgaa ctactccccc aggaaactgg ggcatggctg      2700
     cagaccaccc tccagatgct gccgagtggc actatgaagc acggcgaagc cgagcgactg      2760
     ctgaagaatg tctctgacaa agtccagtca ggagagaccc gcaaaatccg tgttctcctc      2820
     caagacttta ccaactcgta tcgccgccgc aatgtagcgc cacgcgacgg ccttggccgt      2880
     ctggaggccg cccgattccg tttcagtgga tga                                   2913
//

If you have problems or comments...

PBIL Back to PBIL home page