(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE136

PENCW_16.PE136       Location/Qualifiers
FT   CDS_pept        308776..311103
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181179" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947746"
FT                   /orf_name="Pc20g01360"
FT                   /product="Pc20g01360 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85465.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831115"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD73"
FT                   /transl_table=1
FT                   /translation="MEIDGQPSKRRRRSRKVQSDRKFECTFEGCGKSYSRAEHLSRHAL
FT                   NHTPKQIYRCDFPNCYRSFVRQDLCTRHRERHTTSGSQLQKRDHFTENGTKHSPPSSPA
FT                   ITAPEYFVGSEEPKPPVTTYPLTTGVDSNEIQVDQFSDFPAVLDQPDNLIDLDSMSYPI
FT                   FGGETYNRSPFAMADDFAAWLFSEPVAPLGYGMVPLVQNQFYMNEPAYSNHNFCSVIPQ
FT                   HPMSVTSILDSGAPPAVISEAKRQELLHLMSTRFNESAYAAGAKRKDALMDGDLNDDRH
FT                   ALSLRMMQTYIGSYWYHFHAQLPILHQPTFSADRIPNLLLLAIMAIGAATLDKIHGQSA
FT                   TEAAAELASFIAWHLRWEIFMDADFRPPAKLWVFQSLLLLEVYEKLFSTRALHERAHIH
FT                   HDTTLTLMRRGSSLIGSSSFATPESKEEDESWSTWIKTEATRRVAFAAFVLDSTHATMF
FT                   GHSAKMVAHELRLPLPCDEALWAATSAAEVARVQSSLQSHGVRPIMFLDGLKRTLNGQP
FT                   VRTNAFGRIIIMSGLLSVCWHLNQRDLQISSLGVGQTLGGRDKWRTALLRAFDNWRRDF
FT                   DEALGPSTTSESRNVLHGLAHMGSHVDIADLQIFAGAGRLMGRSITARDYSAAREKTEK
FT                   WATKASARDATFYALKFLSTCFLDSATQPGEYAARDDYLLNRPWVMYFAALVVWTYGFA
FT                   LDGPLRPPPILLTVADRERDMQGFLHRVGEIQEPNELEAMNGRNGCLGLLMILRDSFAK
FT                   PRWELLGEAARLLDSCIAKLQS"
     atggagatcg acggtcaacc ctccaaaaga cggcgacgca gtcgcaaagt tcagtcagat        60
     cgcaagtttg aatgcacatt tgaaggctgt gggaagagct attctcgcgc cgaacacctg       120
     agtcgtcatg cgctcaacca taccccgaaa caaatctacc gctgcgactt tcccaactgc       180
     taccgatcct tcgtgcgaca ggacctctgc acgcgccatc gtgaacgtca caccaccagc       240
     ggttcccagc tccagaaacg agatcatttc acggaaaatg gcacgaaaca ttctccgcct       300
     tcttcgcctg ctatcaccgc accggaatac tttgttggct cggaggagcc caaacctccg       360
     gtgaccacat accccctcac caccggagtg gatagcaatg agatacaagt ggaccaattc       420
     tcagatttcc cagcggtact ggaccagcct gataatctga tcgatctcga ctccatgtcc       480
     tacccgattt ttggcgggga aacctataac cgatcgccat tcgccatggc agacgatttt       540
     gcagcgtggt tattcagcga gccagtcgcg ccgttgggct atggaatggt accacttgtt       600
     cagaatcagt tctacatgaa cgagcctgca tatagcaacc acaatttttg ttccgtgatt       660
     ccacagcacc cgatgagcgt aacgagtatt ttggactcgg gagcaccacc ggctgtcatc       720
     tcggaagcga agcgccagga gctgctgcac ttgatgtcca cgcggttcaa tgaatcggcg       780
     tatgcggcag gtgctaaacg caaagatgcg ttgatggacg gggatttaaa tgacgaccga       840
     catgccttga gcttgcgcat gatgcagacg tacattgggt cctattggta ccacttccat       900
     gcacaacttc caatattgca tcagcccaca tttagcgctg atcgtatccc gaatctatta       960
     ctactagcga ttatggcgat tggagcggca acactggata agatccatgg gcagtctgcc      1020
     accgaagcag cggctgaatt ggctagtttc atcgcctggc atttacgttg ggaaatcttc      1080
     atggatgcgg attttcggcc gccagctaag ctttgggtgt tccaatcttt attactgctt      1140
     gaagtctacg agaagctctt ttctacacgc gcattacatg aacgcgctca tatccatcac      1200
     gacacaacac tcacgcttat gcgccgaggt agttcgctca tcggtagttc ttcatttgct      1260
     accccggaaa gcaaagaaga agacgagtca tggtcaacct ggatcaaaac cgaagcgact      1320
     cggcgcgtgg cattcgccgc ctttgtgttg gactcaacac atgctactat gttcggtcac      1380
     tcggccaaaa tggtggccca cgaactccgg ctgccattgc cgtgtgacga ggcgctgtgg      1440
     gctgcaacaa gcgccgccga ggtcgctcgc gtgcaatcca gtctgcagtc gcacggtgtg      1500
     cggccaatta tgttcctcga cggcctcaag cgcacactca atggccagcc cgtccggacc      1560
     aatgcgtttg ggcgaattat tatcatgtca ggcttgctga gcgtctgctg gcatctgaac      1620
     cagcgagacc tgcaaattag ctcgctcggt gtgggccaga ctctcggcgg acgggacaag      1680
     tggcggacag cacttctccg ggcatttgat aactggcgcc gcgatttcga cgaggccctg      1740
     gggccgtcga ccacatccga gtcgcgcaac gtgttgcatg ggctggccca tatggggtcc      1800
     catgtcgata tagccgattt gcagatcttc gcaggtgcgg gccggttaat gggtcggtct      1860
     atcacggcgc gtgactactc cgccgcacga gaaaagactg agaaatgggc gaccaaggct      1920
     tcggcgcggg atgccacgtt ctacgcgctc aagttcctat ctacgtgttt cttggattcg      1980
     gccacccagc ccggggagta tgctgcgcgt gatgactact tgctaaaccg gccgtgggtt      2040
     atgtacttcg cagcgctggt ggtatggacc tatggatttg cgttggatgg acccttgcgt      2100
     cctcccccta ttctcctcac tgtggccgac cgagagcgcg acatgcaagg gtttttgcat      2160
     cgtgtgggtg aaatccagga acccaacgaa ttggaggcta tgaacggacg caatggatgt      2220
     ctcggtctgc ttatgattct ccgagactcc tttgccaaac cgcggtggga gttgttggga      2280
     gaggcggcgc ggctgctgga cagctgcatt gcaaagctgc agtcgtag                   2328
//

If you have problems or comments...

PBIL Back to PBIL home page