(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE137

PENCW_16.PE137       Location/Qualifiers
FT   CDS_pept        join(311500..311671,311771..311911,311982..312074,
FT                   312140..312168)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824357"
FT                   /orf_name="Pc20g01370"
FT                   /product="Pc20g01370 protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAP85466.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0001831116"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD74"
FT                   /transl_table=1
FT                   /translation="MANNDQASTNYKEAFSLFDRRGTGRVAGDLLGDLLRACGQNPTLA
FT                   EISDLEKSVGGDFDFDSFLKVLNRPGGFREPGEPEEYCRGFQVFDKDMTGFIGVGQLRY
FT                   ILTNLGEKMSDDEVDELLKAVDTSSGEINYTDLVRTILAN"
     atggctaata acgaccaggc ctctacaaac tacaaggaag cgttctcgct cttcgatcgc        60
     cgtggcactg gccgtgtcgc tggtgacctc ctcggtgact tgctccgcgc ttgcggtcag       120
     aaccctacgc tggccgagat cagtgacttg gagaagtctg tcggtggtga ctttgacttc       180
     gactccttcc tgaaagtcct caaccgcccc ggtggtttcc gtgagcccgg cgagccggag       240
     gagtactgtc gtggattcca ggtctttgat aaggatatga ctgggtttat tggtgtcgga       300
     cagctgcgtt atattctcac gaatcttggc gagaagatgt ctgacgatga agtcgatgag       360
     ctgctcaagg ctgttgacac tagctccggc gagattaact acacggatct tgtccgtact       420
     atcctcgcca actga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page