(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE138

PENCW_16.PE138       Location/Qualifiers
FT   CDS_pept        complement(312375..312908)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181168" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947747"
FT                   /orf_name="Pc20g01380"
FT                   /product="Pc20g01380 protein"
FT                   /protein_id="CAP85467.1"
FT                   /db_xref="UniParc:UPI00018311E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD75"
FT                   /transl_table=1
FT                   /translation="MTDQRLPIQTQHCRFCNHLLLATTRNINTLPRRGGESKDKALILP
FT                   LERKSSADGEVEVDLEEEARATETPSRKARHASNHTTLLLATTIPDRRATMIRREDGIE
FT                   KRILLRCGRCKVVVGYYLDRVHWAAGDRGAVRDGEEEDEERPPAVYLLPGAVVETEKLG
FT                   GEGVGEREWREWAV"
     atgacagacc aacgcctccc aatccaaacc caacactgcc gcttctgcaa ccacctccta        60
     ctagcaacaa cacgcaacat aaacacactc ccacgacgcg gcggcgaaag caaagacaaa       120
     gcgctgattc tgccactcga gcgcaagagc tcagcagacg gggaagtgga agtcgatctc       180
     gaagaagaag ctagggcaac agaaaccccg tcgcgcaaag caagacacgc ctctaaccat       240
     acgacgctcc ttctggccac tacgatcccg gaccggcggg cgacgatgat ccggcgcgaa       300
     gacgggattg agaagagaat ccttttgagg tgtgggcggt gcaaagttgt tgtggggtat       360
     tatttagacc gggtgcattg ggctgctgga gatcgcggag cggtgcgaga tggagaggag       420
     gaagacgagg agcggccgcc ggctgtttat cttcttcctg gggctgttgt ggagacggag       480
     aagttggggg gtgagggggt tggggagcgg gagtggagag agtgggctgt ttaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page