(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE139

PENCW_16.PE139       Location/Qualifiers
FT   CDS_pept        join(complement(313732..315686),complement(313469..313661))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000245985" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947748"
FT                   /orf_name="Pc20g01390"
FT                   /product="Pc20g01390 protein"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP85468.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="UniParc:UPI00018311E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD76"
FT                   /transl_table=1
FT                   /translation="MAPAHLRAPPQAPPIFTATPQSVVADAERLIKNSRAIQDKVVAEI
FT                   KPDDATFANVVRPLAQDDNQMGLESHILGFYQAVSTDSKLRDASSKAEELMDEFFIEAV
FT                   MREDVFGLVDAVLRRNESLDPESRRLLEKEHKDFVRNGLGLPAGPQRLRFKEIKKRLSQ
FT                   LSIEFQKNLNEENGGIWFTPEQLAGVPKDVLDGLKKGEGENAGKLWLSFKYPDLFPTMK
FT                   YASDPETRRQVMIANENKCNQNVPLFRESIILRDEAARLIGYPNHAAFRIEDKMAKTPE
FT                   IVNKFLGDLRDRLTDGGKKEIQKLLELKNATDPKADGRYYLWDHRFYDRLMLEKDYSLD
FT                   QQLIAEWFPLQTTIDGMLKIFEELFGLEFVEIIGEDRAAIAPTGKGNDIVWHDDVQVFS
FT                   VWNDEGEGSGFVGYLYLDLFPREGKYGHAANFNLQPGFVDKDGNRRFPATALVCNFTKP
FT                   QPKKPSLLKHDEVVTLFHELGHGIHDLVSRTIYSRFHGTSTVRDFVEAPSQMLENWCWE
FT                   PSQLRSLSRHYSTLSPEYLATWQEAQEGKTATSQPSERIPDDVIENLIRTKHVNDSLFN
FT                   LRQLHFGIFDMTVHEPKTHADIEALPLSATYNRLRQEITQLDGPEVQGAGSEWGHGEAT
FT                   FGHLIGGYDAGYYGYLSSQVYSTDMFYTVFKDDPMNKAAGRRYRYQVLEKGGSQDEMKT
FT                   LTEFLGREPQTDAFYKDLGLA"
     atggcccccg ctcacctccg ggcgccaccc caggccccgc ctatcttcac tgcaaccccg        60
     cagtcagtcg tagctgatgc cgagcgcttg atcaagaact cgcgtgccat tcaagacaag       120
     gtggtggcgg aaatcaagcc cgacgacgca acctttgcca atgtcgttcg tcccctcgcc       180
     caagatgata accagatggg acttgagtca cacatcctgg gcttttacca ggccgtatct       240
     accgactcaa agctacggga cgcctcttcc aaggctgaag agctgatgga tgagttcttt       300
     attgaggcgg tcatgcgtga ggatgtattt ggtctggtcg atgctgtact acgccgcaac       360
     gagtctctcg atccggagtc acgccgtctg ttagagaagg aacacaagga cttcgtccgc       420
     aatggacttg gcctgcccgc tggcccccag cgactccgct tcaaggagat caagaagcgg       480
     ctgagccagc tgagcattga attccagaag aacctgaacg aggagaatgg cggcatttgg       540
     tttacccccg agcagttagc tggtgtgccc aaggacgttc tagatggtct gaagaagggc       600
     gagggcgaga acgccggcaa gctatggctg tcgttcaagt accccgacct cttccccact       660
     atgaaatacg ccagcgaccc cgagacccgc cgtcaagtca tgattgccaa tgagaacaag       720
     tgcaaccaga acgtgccact gttccgggaa tccattatac tccgtgatga ggcagcccgt       780
     ctgatcggct atcccaacca cgctgctttc cgcattgagg acaagatggc caagacccca       840
     gagatcgtta acaagttttt gggtgatctt cgggacagac tgaccgatgg cggtaagaag       900
     gagatacaga agttgttgga acttaagaac gccacggacc ccaaggccga tggccgctac       960
     tacctgtggg accaccggtt ctatgaccgt ctcatgctcg agaaggacta ctcgctggat      1020
     cagcagctga ttgctgagtg gttccccctg cagactacca ttgatggtat gctgaagatc      1080
     ttcgaggagc tgttcggtct ggagttcgtt gagatcattg gcgaggaccg ggcagccatt      1140
     gccccgactg gcaagggcaa tgacattgtc tggcacgatg acgttcaagt attcagtgtc      1200
     tggaacgatg aaggcgaagg cagtgggttc gttggatacc tgtacctaga cctcttccct      1260
     cgtgagggca agtatggcca tgcagccaac ttcaacctgc agccaggctt cgttgataag      1320
     gatggtaacc gccgattccc tgccaccgcg ttagtgtgca atttcaccaa gccccaaccc      1380
     aagaagccta gtctgctgaa gcatgacgag gtcgtgaccc tcttccacga actaggccac      1440
     ggtatccacg acctggtgtc ccgaaccatt tactcccgct tccacggtac cagcacagtg      1500
     cgcgactttg tcgaggcacc cagccaaatg ctggagaact ggtgctggga accctcgcag      1560
     ctgcgctctc tgagccgaca ctactcaacc ctctccccag agtaccttgc tacatggcag      1620
     gaggcccagg agggcaagac cgccaccagc cagccgtcag agcgcatccc cgacgatgtg      1680
     atcgagaacc tgatccgtac caagcacgtc aacgactccc tgttcaacct gcgccagctg      1740
     cacttcggca tcttcgacat gactgtgcac gagcccaaga cccacgccga cattgaggct      1800
     cttcctctgt ctgcgacata caaccgtctc cgccaggaga ttacccagtt ggacggaccg      1860
     gaagttcagg gtgctggcag cgagtggggc cacggcgagg cgaccttcgg acacttgatc      1920
     ggaggttacg acgctggata ctacggatac ctgagctccc aagtttactc caccgacatg      1980
     ttctacaccg tcttcaagga tgatcccatg aacaaggctg ctggccgtcg gtaccgctac      2040
     caggttcttg agaagggcgg tagccaggat gagatgaaga ctttgactga attcctgggc      2100
     cgtgagcctc agactgatgc attctataag gaccttggac tggcataa                   2148
//

If you have problems or comments...

PBIL Back to PBIL home page