(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE140

PENCW_16.PE140       Location/Qualifiers
FT   CDS_pept        join(complement(317693..317930),complement(316506..317635))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000270353" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947749"
FT                   /orf_name="Pc20g01400"
FT                   /product="Pc20g01400 protein"
FT                   /EC_number="1.14.19.1"
FT                   /function="heme binding"
FT                   /function="stearoyl-CoA 9-desaturase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85469.1"
FT                   /db_xref="GO:0004768"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001522"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR009160"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI00018311EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD77"
FT                   /transl_table=1
FT                   /translation="MSSKPDATRPRAADTKKVHIADTQMTRQNWYKHVNWLNVTFIIGV
FT                   PISGCIQAFFVPLQLKTAIWAVIYYFFTGLGITAGYHRLWAHCSYSATLPMRIWLALVG
FT                   GGAVEGSIRWWARDHRAHHRYTDTDKDPYSVRKGLLYSHLGWMVMKQNPKRIGRTDITD
FT                   LNEDPVVVWQHRNYIKVVITMGLIVPMLVAGLGWGDWYGGFVYAGILRIFFVQQATFCV
FT                   NSLAHWLGDQPFDDRNSPRDHIITALVTLGEGYHNFHHEFPSDYRNAIEWHQYDPTKWT
FT                   IWTCKQLGLAYDLKQFRSNEIEKGRVQQLQKKIDQKRAKLDWGTPLDQLPVMEWDDYVE
FT                   QAKNGRGLISIAGVVHDVTDFIKDHPGGKAMIKSGLGKDATAMFNGGVYYHSNGAHNLL
FT                   STMRVGVIRGGGEVEIWKRAQKENSEYVRDETGQRIIRAGQQVTKMPEPIPTADAA"
     atgtcgtcca agccggatgc tacacgccct cgggcggctg acaccaagaa ggtgcacatt        60
     gccgataccc agatgactcg ccagaactgg tacaagcatg tcaactggct caacgtcacc       120
     ttcatcatcg gcgttcccat ctccggatgt atccaggctt tcttcgtgcc tctgcagctg       180
     aagaccgcca tttgggcagt catctactac ttcttcactg gactgggaat cacagctgga       240
     taccatcgtc tctgggctca ctgctcctat tccgccactt tgcctatgcg tatctggctc       300
     gctctggtcg gcggcggtgc tgtcgagggc tccatccgct ggtgggctcg tgatcaccgt       360
     gcgcaccacc gttacaccga caccgacaag gacccttact ccgtgcgtaa gggtttgctg       420
     tactcgcacc taggatggat ggtcatgaaa cagaacccca agcggattgg tcgtactgat       480
     attaccgatc tgaacgaaga ccccgttgtt gtctggcagc accgcaacta catcaaggtc       540
     gtgatcacta tgggtcttat cgtccctatg ctcgtcgctg gtctcggctg gggtgactgg       600
     tacggcggat tcgtgtacgc cggtattctg cgtatcttct tcgtgcaaca ggctaccttc       660
     tgcgttaact cgctggccca ctggctcggt gaccagccct tcgatgaccg caactctccc       720
     cgtgaccaca tcatcaccgc cctagtcact ctcggcgagg gctaccacaa cttccaccac       780
     gagttcccct cggactaccg caatgccatt gagtggcacc agtacgaccc caccaagtgg       840
     accatctgga cctgcaagca gctcggcctg gcctacgact tgaagcagtt ccgctccaac       900
     gagatcgaga agggccgcgt ccagcagctg cagaagaaga tcgaccagaa gcgcgccaag       960
     ctcgactggg gtactcccct ggaccagctt cccgtcatgg agtgggatga ctatgttgag      1020
     caggccaaga acggccgtgg cctgatctcc attgccggtg ttgttcacga cgtgaccgat      1080
     ttcatcaagg accaccccgg tggcaaggcc atgatcaagt ccggccttgg caaggacgcc      1140
     acggccatgt tcaacggtgg tgtttactac cactccaacg gtgcccacaa cttgctttcc      1200
     accatgcgtg tcggagtcat ccgcggcggt ggtgaggttg agatctggaa gcgcgctcag      1260
     aaggagaact ccgagtatgt gcgtgatgag acaggccagc ggattatccg ggccggccag      1320
     caggtcacta agatgcctga gccgatccca actgcagatg cagcttaa                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page