(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE142

PENCW_16.PE142       Location/Qualifiers
FT   CDS_pept        join(319847..319938,319990..320156,320206..320385,
FT                   320447..321741)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181157" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947751"
FT                   /orf_name="Pc20g01420"
FT                   /product="Pc20g01420 protein"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85471.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniParc:UPI00018311EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD79"
FT                   /transl_table=1
FT                   /translation="MDGPDQIGPDHTPKRTISDKVRYAVRTFTTREGLLGDYDYGYLFI
FT                   PRLPFAKRARKSAPFFGLDDRVPVVLALILGLQHALAMLAGVISPPILLGGSGGANFGD
FT                   DLYQYLVSTSLIVSGLLSVVQMFRFHIKGTKYYIGTGLLSVVGTSFSTITVAQGAFSQM
FT                   YKSGYCPTLEDGTKLPCPKGYGALLGTSCLCSLLEIGMSFMSSKILARVFPPLVTGPTV
FT                   LLIGASLIKSAMQDWAGGASCGADPSARAMCPSANAPHPLPWGSPEFIGLGFLVFVTII
FT                   VCERWGPPILKSCSVIVGLLVGSIVAAACNYFDSSGIAAAPVASFAWVHTFPLSVYPPL
FT                   ILPLLALYIVIMMESIGDITATCDVSRLQVEGDTFDSRIQGGVLGNGITCLLAGLMTIS
FT                   PMSVFAQNNGVIALTKCANRTAGYCCCFFLVIMGIFSKFAAALVAIPSSVLGGMTAFLF
FT                   SSVAVSGLRIIGSVPPTRRNRFILTASFSIGMGVTLLPEWFSYFFTYKGDNHALEGLIN
FT                   AVDLVMENGFAISAILGIFLNLFIPDEPDDVPAIFESTNSNDAPVQTDIPEQSSTTTKI
FT                   A"
     atggacggtc cagatcagat cggtcccgat catacgccca agcgaacaat tagcgacaaa        60
     gtccgatacg ccgttagaac tttcactaca cgggagggcc tactaggaga ctacgactat       120
     ggatatctct ttatcccacg actgcccttc gccaagcgag ctcgcaaatc cgccccgttt       180
     ttcggcctcg atgatcgcgt gccagtcgtg ctcgcattga ttctggggtt acaacatgca       240
     cttgcaatgc tggctggtgt gatttcacca cccatcttgc tcggcggttc aggcggtgcc       300
     aactttggcg atgacctcta ccagtacttg gtttcgactt cgttgattgt gtcgggcctg       360
     ttgagtgttg ttcaaatgtt ccggttccat atcaagggaa caaaatacta tattggaact       420
     ggactactat cagtcgttgg tacatcgttc tcaacgatca cagtcgctca aggcgcattc       480
     tcccaaatgt ataaatcggg ctactgccca accctcgaag atggaactaa gctcccttgt       540
     ccaaaaggct acggcgccct ccttggcacc tcatgtctct gctccctcct cgaaatcggc       600
     atgtccttca tgagcagcaa gatcctcgcc cgcgtcttcc ccccactcgt caccggcccg       660
     acggttctcc tgatcggcgc ctcgctcatc aagtccgcca tgcaggactg ggccggtggc       720
     gcgtcgtgcg gcgctgaccc ttctgcccgc gcaatgtgcc ccagcgccaa cgccccgcac       780
     cctctaccct ggggaagccc tgagttcatt ggactgggat tcctggtatt cgtgacgatc       840
     attgtttgcg agcgctgggg tcctcccatt ctgaagagtt gctccgttat tgttggcctc       900
     ttggttggct ccatcgtcgc tgccgcgtgc aactacttcg attcttccgg tatcgccgct       960
     gccccggtgg cttccttcgc ttgggtccac accttcccgc tatcggtgta cccaccactc      1020
     atcctgccct tgctcgcact gtatatcgtt atcatgatgg agtctattgg ggacatcacg      1080
     gcgacatgtg acgtctcccg gctccaagtg gagggtgata ccttcgattc ccgcatccaa      1140
     ggcggcgtct tgggtaacgg gatcacatgt cttttggccg gcttgatgac tattagccct      1200
     atgtctgtct tcgcgcagaa caacggtgtg attgcgctga cgaaatgcgc taaccgcacc      1260
     gccggctact gctgctgctt cttcctggtt atcatgggca ttttctccaa gttcgccgct      1320
     gcgctggttg caatccctag ctccgtcctt ggtggtatga ccgctttcct cttcagctcg      1380
     gtggcagtta gtggtctgcg cattattggg tctgttcctc ccacccgtcg caaccggttc      1440
     atcctcacgg caagtttctc gattggaatg ggtgttacac tgctgccgga atggttcagc      1500
     tacttcttca cctacaaggg tgacaaccat gcccttgagg gtctgatcaa tgctgtcgat      1560
     ctggtcatgg agaacggatt cgctatctca gcgattctcg gcatcttcct taacctcttt      1620
     attcccgacg agcctgatga tgtccctgcc atctttgagt cgaccaactc taatgatgcc      1680
     cctgtacaga ccgatattcc tgagcagtcg tcgacaacta ctaagattgc ttga            1734
//

If you have problems or comments...

PBIL Back to PBIL home page