(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE145

PENCW_16.PE145       Location/Qualifiers
FT   CDS_pept        join(324255..324306,324363..324555,324608..324657,
FT                   324708..325261,325315..325638)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181135" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947753"
FT                   /orf_name="Pc20g01450"
FT                   /product="Pc20g01450 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="DNA-dependent ATPase activity"
FT                   /biological_process="DNA metabolic process"
FT                   /protein_id="CAP85474.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006259"
FT                   /db_xref="GO:0008094"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="UniParc:UPI00018311EF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD82"
FT                   /transl_table=1
FT                   /translation="MDLLGLDGLEGFDDGDTPPVVSISASQSLNASAATRHPIATGLAR
FT                   LDEVLNDLPDQPDQGGILRGHVTEIFGPPGAGKTSLALNIACNALRDGKVVWIDTGCPL
FT                   PTPRLEEMSINLDDFIYFRAHTLAHLIALLARPPKGFPPSGTSLLVVDSVSNLFSAYFP
FT                   SAQELKDQLAEGKITDKAHLQWLINRRWNIASELGTHLARVAARNIAVVAINQSHTKVK
FT                   GQSHAVLQPLLSGGAWEASVQTRIAVYRDLPDERLAEVEKRAGKPLPEQAGELLVAFRI
FT                   EPDGLYEMERKDSVPSEPLTPLPKSPDFEYYDPPTPTPSPISSVLSSAPPSPKLESPKP
FT                   PSPKPTSPEKPVQIPNKKRKVEEVADSQDEDSEEEDVPWTNEITLNTNRS"
     atggaccttc tcggtctcga cggtcttgaa gggtttgacg acggagatac gccacccgtg        60
     gtctcgatct cagcatcgca gtccctcaac gcgtcggccg ccacccgcca cccaatcgcg       120
     acgggcctgg cgcgtctgga cgaggttctg aatgacctcc cagaccagcc cgatcaaggc       180
     ggcatcttgc gtggacatgt tacagagata tttggacctc caggagcggg gaagacctcg       240
     ctggcgttga atattgcctg taatgcacta cgcgacggca aagtagtctg gattgacacg       300
     ggatgtccct tgcccactcc ccggctcgag gagatgtcta tcaacctcga tgactttatc       360
     tatttccggg cgcatacgct ggcccatctt atagccctgc ttgcacgtcc accaaaaggg       420
     tttccaccgt cgggaacaag ccttcttgtt gtcgactcgg tatcgaattt attctcagct       480
     tacttcccca gcgcccaaga gctcaaggac cagctcgccg agggcaaaat cacagataaa       540
     gcacacctgc aatggctgat caatcgcaga tggaacattg ctagtgagct aggcacacat       600
     ctggccagag tcgccgcgag gaatatcgct gtggtggcta ttaaccaatc ccacacgaag       660
     gtcaagggtc agtctcacgc ggttctgcag ccgctcttgt cgggtggtgc gtgggaggcc       720
     agcgtgcaga ctcgcattgc ggtctaccgt gacctgccgg atgaacgatt agcggaggtc       780
     gagaagcgcg cgggtaagcc cctgcccgag caagccgggg agctgctcgt tgcctttcgc       840
     attgaaccgg atggtcttta tgaaatggag agaaaggatt ccgtgccctc cgagcctctg       900
     actcccttac caaagtctcc cgactttgag tactatgatc ctcctacccc gactccttcg       960
     cctatatcct ccgttctgtc ttctgcacca ccgtctccaa aattggagtc cccaaaacca      1020
     ccatcaccta agccgacgtc accagaaaag cctgtgcaga ttccaaataa gaaacggaag      1080
     gtggaggagg tagctgacag ccaggacgaa gactccgagg aagaagatgt cccatggaca      1140
     aatgagataa ccctgaatac gaatcgatca tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page