(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE146

PENCW_16.PE146       Location/Qualifiers
FT   CDS_pept        326357..327337
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171725" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977583"
FT                   /orf_name="Pc20g01460"
FT                   /product="Pc20g01460 protein"
FT                   /protein_id="CAP85475.1"
FT                   /db_xref="UniParc:UPI00018311F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD83"
FT                   /transl_table=1
FT                   /translation="MSNVPQDLLDGISGALAKEGNTLQMILIAFIGLSCYNVAELVVLV
FT                   PATFRRWRGLYFWSLLISGVLGVVPYSIGFLMKFFTQTDSVLSVTVLTIGWWTMVTGQS
FT                   VVLYSRLHLVLRDERMLRHVLKLIIANVLLLHVPTTILTYGANIVHSGEVAWVNGYNIM
FT                   EKIQLTGFTFQESLLSTLYVIETVKLLRLGADVSSRPDARSIMYQLIGINCAIIAMDLL
FT                   LLSLEYADFYAVQITLKGFVYSLKLKLEFAVLGRLVDLIQGSRHPVSLAIADTLPLCSM
FT                   QRPPETPDRSEDAPYEQAEPKDFLVPPGGGRLVQRRMFMESGRAA"
     atgtccaacg ttccccagga cctgctggat gggatatcag gtgccctcgc aaaagagggt        60
     aatacgctac agatgatact tatcgctttc atcggattat catgttacaa cgttgctgag       120
     ctagttgtac tcgtccctgc caccttccgc cggtggcgtg gactctattt ctggtccctg       180
     cttatctcgg gagtgctcgg tgtcgtacca tactcaatag gcttcctgat gaagttcttt       240
     acgcaaactg actccgtgct gtcggtcact gtcctgacta tcggctggtg gaccatggtc       300
     actggccagt ccgtggtgtt gtattcacga ctccaccttg tgctacgaga tgagcgcatg       360
     ctgcgccatg tgctgaagct catcatcgca aatgtcttgc tcctgcatgt gcccacaacg       420
     atcctcactt acggcgcgaa catagtccac agcggcgagg tcgcctgggt gaatgggtac       480
     aatatcatgg agaagatcca gctgaccggg ttcacgtttc aagagagtct gctgtcaacg       540
     ttatatgtga ttgagaccgt caagctactg cgtctcgggg cggatgtctc ttcgcgcccg       600
     gatgcacgga gcatcatgta ccagctgatc gggataaact gcgcgatcat agcgatggat       660
     ctgctgcttt tgagtctcga atatgccgac ttttacgccg tgcaaatcac tctgaaggga       720
     tttgtttact cgctcaaact caagcttgaa tttgctgtgc ttggtcgtct agtagacctc       780
     attcaagggt ccagacatcc tgtttccctc gctattgccg atacgttgcc tctttgctcg       840
     atgcagaggc cgcctgagac gccggatcgc agtgaggatg cgccttatga gcaggccgaa       900
     ccgaaagact ttttggttcc gccgggcgga ggccgacttg tccagaggag gatgttcatg       960
     gagtctggga gggcggctta a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page