(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE147

PENCW_16.PE147       Location/Qualifiers
FT   CDS_pept        join(complement(328726..328769),complement(328650..328669),
FT                   complement(328548..328598),complement(327895..328491),
FT                   complement(327687..327805))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977584"
FT                   /orf_name="Pc20g01470"
FT                   /product="Pc20g01470 protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="CAP85476.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI00018311F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD84"
FT                   /transl_table=1
FT                   /translation="MADRYSFSLTTFSPSGKLVQIEYALNAVNQGVTALGIKATNGIVL
FT                   ATEKKSSSPLIDPPSLSKISLITPDIGMVYAGMGPDYRVLVDKARKVSHTGYKRIYNEY
FT                   PPTRILVQDVARVVQEATQSGGVRPYGVSLLVAGWDEGVEPESEEAKKDDPEEKISSKT
FT                   GGIKKGGPSLYQVDPSGSYYPWKATAIGKHATSAKTFLEKRYTEGLELEDAIHIALLTL
FT                   KETIEGEMNGDTIEIGIVGPPADHLLGYEGVEGAQGPRFRKLTKEQIEDYLTNL"
     atggcggacc gatactcatt ctccttgact acattctcac ccagcggaaa gctggtgcaa        60
     attgaatatg ccttgaacgc ggtcaaccag ggtgtgactg cccttggtat caaagctacg       120
     aacggcattg tgctcgcgac tgagaagaag tcctcctcgc ctctcattga ccctccctcc       180
     ctatccaaga tctcactgat cacgccggat atcggtatgg tctatgccgg catgggcccc       240
     gactaccggg tgctggtcga caaggcccgc aaagtctcgc acacaggcta caagcgcatc       300
     tacaacgaat acccacctac tcgtatattg gttcaagacg tcgctcgagt agtgcaagaa       360
     gctacgcaat ccggtggtgt gcggccgtac ggtgtcagtc tgttggttgc aggctgggac       420
     gagggcgttg agcctgagtc ggaagaggct aagaaagatg accccgagga gaagatctcc       480
     agcaagactg gcggtatcaa gaagggtgga cccagtctgt accaagtcga ccccagtggc       540
     agctactacc catggaaggc gacagccatc ggcaaacacg caacaagtgc caagacgttc       600
     ctcgagaaac ggtacactga agggctggaa ttggaagacg ccatccatat cgcgctattg       660
     acactcaagg agacgattga gggcgagatg aatggtgaca caatagaaat cggcattgtt       720
     ggccccccag cggaccacct gttgggctat gagggagtgg agggtgctca gggaccacgg       780
     ttccgcaagt tgaccaagga acagatcgag gactacctga ccaacctatg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page