(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE148

PENCW_16.PE148       Location/Qualifiers
FT   CDS_pept        join(328803..328985,329059..329673,329724..329864)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181124" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977585"
FT                   /orf_name="Pc20g01480"
FT                   /product="Pc20g01480 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP85477.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00018311F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD85"
FT                   /transl_table=1
FT                   /translation="MERSKEGELCCRQRWVTFGAVELTKGGDQIGISRGVWDTFGFSAF
FT                   LLLVVLFFFNPSKKETHYPPRVCRICLESVLPTFQPSEFLQKPRVVYESSDPECGRLLS
FT                   PCQCKGSSRYVHEGCLQSWRHADPKYGTRNFWQCPTCGFQYRLERLTWARWISSATTQL
FT                   ILTLGILFLTVFLLGFIADPIIDFYLGPVDVYAELVEEDVSWLGHFLKGLASLGLLSFL
FT                   KAIFALSPFPWNLRSVASGRNSGRNRAAQLNWLVVMVGIGTFLWAVYKGVRSWSRRTLE
FT                   KAGERVMDVPLPDDESDTDVPIPDDAGMKEE"
     atggaaagat cgaaagaagg ggagctgtgt tgtaggcaga gatgggtgac gtttggcgcg        60
     gtagagctca ccaaaggcgg tgaccagatt gggattagcc gtggggtttg ggacaccttc       120
     ggcttttctg cttttcttct tctcgtcgtt ctcttctttt tcaacccctc aaaaaaagaa       180
     acacattacc ctccacgggt ctgtcgcatc tgcctagaaa gcgtgctgcc cactttccaa       240
     ccctcagaat tcctccagaa gcctcgtgtg gtttatgaat cttccgatcc agaatgtggc       300
     cgtttattga gcccttgtca atgcaaaggc tcctcgcgtt atgtccacga gggctgcctg       360
     cagtcatggc gccatgccga ccccaaatat gggacgagaa acttctggca atgtcccacc       420
     tgcggcttcc agtatcgcct ggagcgcctg acttgggctc ggtggattag tagcgctact       480
     acccagctaa ttctcacact cggcattctt tttttaaccg tattcctgct tggattcatt       540
     gctgacccca tcattgattt ttacttgggc cccgtggatg tttacgccga attggtcgag       600
     gaagatgtct cctggttggg gcacttcctt aaaggtcttg cgtctttggg cctgttgtcg       660
     ttcctcaagg ccatatttgc actatcgcct ttcccttgga accttcggtc tgttgcatca       720
     ggacgcaatt ccggccgtaa ccgggccgcc cagttgaact ggttagtggt catggttggc       780
     atcggtactt tcctttgggc tgtctacaaa ggtgttcggt catggagtag acgaacgcta       840
     gaaaaggccg gtgaacgagt catggatgtc ccactaccag atgacgagag tgatacggac       900
     gtcccaatac cggacgacgc tggaatgaag gaagaatag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page