(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE149

PENCW_16.PE149       Location/Qualifiers
FT   CDS_pept        join(330355..330986,331053..331428)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671675"
FT                   /orf_name="Pc20g01490"
FT                   /product="Pc20g01490 protein"
FT                   /protein_id="CAP85478.1"
FT                   /db_xref="UniParc:UPI00018311F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF6"
FT                   /transl_table=1
FT                   /translation="MDDLPPGSRLAHVRSELAMDSESEESESATPTNADTAKTETEPFP
FT                   EYDESECEMLASSIAADKRREEAWIHALGKATQRENRMLHVDPNIIPYFQSDPSHRSQV
FT                   VLEQLRDLLADPQMRPKIRDQFITMINATLQFNLVIFHQSSEFLAPKEIEDAELHLESV
FT                   LNLVEWMEEDLRDQLETAEQVSYAIEGASLQPTSAYERLCKMASLFANAMKKPRYLERR
FT                   LLSLYMDMYEEWVHTPFLLLRNRQLVNEQDPSPERTKLSRRVIMIWDLMNSCIESYGTL
FT                   TWFTLEIKHQYFAPVMGYLCDSPEIWQYCWDQYQALEKDRAQASEKDLSQCATI"
     atggatgatc ttccaccagg ttctcgtctc gcgcatgtcc gctctgaact cgcaatggac        60
     tctgaatcag aggaatccga atctgctact cctaccaacg cagatactgc caaaaccgag       120
     actgagccat tccctgaata tgacgagtcc gagtgtgaaa tgcttgcgtc ttccatcgca       180
     gccgacaaac gccgcgagga agcatggatc cacgctctcg gcaaagccac ccaacgagag       240
     aaccgcatgc tccatgtcga ccctaacatc atcccatatt tccaaagtga cccgtctcac       300
     cgcagccagg tggtcctcga acagctgcga gaccttctcg ccgacccgca aatgcgtcct       360
     aagatccgcg atcaattcat taccatgatc aacgccactc ttcaattcaa cctcgtgatc       420
     tttcaccaaa gctcggagtt tctggctccc aaagaaatcg aagatgcaga acttcacctt       480
     gagtccgttc tcaatctcgt ggaatggatg gaagaggatc tcagagacca gctggagact       540
     gccgaacagg tttcttatgc catcgagggt gcctcgttgc agcctacttc ggcctatgag       600
     cgcctttgta aaatggcttc tcttttcgcc aacgccatga aaaagcctcg ttaccttgaa       660
     cggcgactgc tttctttgta catggatatg tacgaggaat gggtccacac tcctttcctt       720
     cttctgcgca accgacaact tgtgaacgag caagacccta gcccagaacg caccaagctt       780
     tcgcgtcgtg tcatcatgat ctgggacctg atgaacagct gcatcgaaag ctacggtacc       840
     ttgacctggt tcactcttga gatcaaacat cagtactttg ccccggtgat gggttatctt       900
     tgtgactcac cagaaatctg gcagtactgc tgggaccaat accaggcact ggagaaggat       960
     cgggctcagg caagcgagaa ggatttgtct caatgtgcca ccatctga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page