(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE15

PENCW_16.PE15        Location/Qualifiers
FT   CDS_pept        join(42568..42585,42688..45747)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000187708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946676"
FT                   /orf_name="Pc20g00150"
FT                   /product="Pc20g00150 protein"
FT                   /protein_id="CAP85344.1"
FT                   /db_xref="UniParc:UPI0001831907"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF26"
FT                   /transl_table=1
FT                   /translation="MDHISTLCALSTVGIAPTGLALGRAERTQRPSLFRRKTHAQGIPE
FT                   PLSVNTEPTADVARPKTAIPSRSPAAEWLAAKEEESFQGSQGSDLSKAPLSFSGARRRR
FT                   RGQTLTNPPLRIPEHESTDSSVGTHTRRPSTGWLRRLSMASFPAETPTASSPATPSFNG
FT                   STSPLISHSPRQRRPANKLVKRPTSQHTTTYALTLNPICGPSPAALRRPATSHQRSESM
FT                   ILRTPLTTDFDTYFPKAPVEGPTIEEFELDKQKRWTPFFVPKGGKLAERLSRRFSTSTA
FT                   PKVQSVRQIVSDQGALPALVMANVISPTTAAPRDDRSVPHTPIEFHNPFQTAPSEFGPK
FT                   QPVAPEQPAERSLHRQSYSVNDVEPKIEPKIVMANTVTAHGTPIMGLVRGGSLKRVKGR
FT                   TFSVPPSELSQEENNVAIPSSPEPEPRRNITDPSVFRAPYPISQPGWADSALERRSQVG
FT                   PRSVSQDYNVGLGSRAGSRQMTSDAVALSAWQQASRPGGQTYGSLRRRPKGFSISGSDP
FT                   ASTLIGSDATRVFTSSDGYETDMMSDYWDSVRTRETNRSGAKGLRIETMFDKAGTSLAN
FT                   EEATTLESLLPRGSFAARSLDKDPQLFTDPLLSAPPLVQTSMGENPSIPDDDALSMIGA
FT                   LPSDDRDCFPSSLTRSLAKYAEEPELRVGADNDMPGSFMGELDSDINKKTNIFDWSEQT
FT                   HPNRETSDSGTRPRTMQGKHEGVIDRNSRAVCRKAPSTVHLRSQSVPVASELPINESRQ
FT                   TSGKFGTWGLGSKGVSEDWDSDFDFDESEDTPVAENKPLVEPDINRQSMTVPKAILERQ
FT                   ASLRGQFGQVQELTLLVEELKRLRHQANVLGVVNGPSSELWAEAEQIVNLATIDDEEER
FT                   RSPPGSPQSLTFSFDESDDDGLNASSKRNSDVLWDIPRGENSEPTLPLAQLARDSPKSK
FT                   SVLDILQPRQQEPSSAFNGLELASRAKKLPFDTSSLKNLVVRAGVVTRALKEVIRKADG
FT                   VATSPQDFQDPPFRRIFDKPSHDDIASFEAALADMS"
     atggatcaca tatcaactct ctgtgcatta agcaccgtcg gaatagctcc taccggcctc        60
     gcgctcggtc gcgcagaacg gactcaaagg cctagcctct ttcgacggaa gactcacgct       120
     caaggtattc ccgagccgct ctctgtcaac actgaaccga ccgcggatgt tgcccggccg       180
     aagactgcca ttccatctcg aagtccggcc gccgagtggc ttgccgcaaa ggaagaggaa       240
     agctttcagg gaagtcaagg atcagatctg tcgaaagcgc ccttgtcttt cagcggtgcg       300
     cgacggcgcc gtcggggtca aacactcaca aatccacctc tgcgaattcc ggaacatgag       360
     tcgacagact cgtcggtcgg aacacatacc cggcggccat ccaccggttg gctgcgacgg       420
     ctgtcgatgg cctccttccc agctgaaacc ccgaccgcaa gtagcccagc aacgccctcg       480
     ttcaatgggt caacaagtcc actcatttct cactcgcccc gtcagcgaag acctgccaac       540
     aaattggtga agcgaccgac ttcgcagcat acaaccacgt atgctctcac cctgaacccc       600
     atttgtggac catcgccggc tgcgctgcgc aggcctgcca ctagtcacca gaggtcggag       660
     tcgatgatcc tccggacccc tttaacaacc gatttcgata cgtattttcc gaaggctcct       720
     gtcgaaggtc caacgatcga ggaattcgag ctcgataaac agaagcgttg gacgccgttc       780
     tttgttccca agggcggcaa attagcagag agactttcgc gcagattctc gacctccact       840
     gcaccaaagg ttcagagcgt acgccagatt gtgtctgacc agggcgctct tcctgcgttg       900
     gttatggcta atgtgatctc acccacgact gctgcacccc gggacgacag atcagtgcct       960
     catactccaa ttgaattcca caatccgttc caaacggccc cctctgagtt tggtcccaag      1020
     cagccagtcg ccccggaaca gccagcagaa agatctctcc ataggcagtc atactcggtg      1080
     aacgatgttg agccgaaaat tgagccgaaa attgtcatgg caaacacagt taccgcacac      1140
     gggacaccga ttatgggact cgttcgcggc ggctctctga agcgagtgaa agggaggacc      1200
     ttctcagtcc ctccttcgga actctcccag gaagaaaata atgtcgctat tccgagttcc      1260
     ccggagcccg aaccgcggcg caacattact gatcctagcg tgtttcgcgc tccttatccc      1320
     atttcgcaac ctggttgggc tgattcggct ttggaaagac ggtctcaagt tggtccccga      1380
     tcggtatcgc aggactataa cgttggcttg ggatctcgag ccggttcacg tcaaatgacc      1440
     tcggatgcag tcgccctgtc ggcctggcag caagcatctc gtcctggtgg tcaaacttat      1500
     ggttctcttc gccgtcgtcc caagggattt tcgatctcag gttccgatcc ggcttcaacc      1560
     ctcattggct ccgatgccac gcgagtgttt acatcgagcg atggctatga gacggacatg      1620
     atgtcggact attgggactc tgtccgcaca cgtgagacca atcgcagtgg agcgaagggg      1680
     ctgcgaattg agacgatgtt tgacaaagca ggtacgagct tggcgaatga agaagccacg      1740
     accttggagt ctctcctccc gcggggttcc ttcgccgccc ggtctctgga caaggatccc      1800
     caattgttca ctgatccgct tctgtcggcc cctcctttgg ttcaaacatc catgggtgag      1860
     aatccgtcta ttcctgacga tgatgctctc agcatgattg gagcgcttcc gagcgatgac      1920
     cgtgattgtt ttccatcttc tttgacccgt tcattggcga aatatgctga ggagcccgag      1980
     ttgcgtgttg gtgcagataa tgatatgcct ggatcgttta tgggcgagtt ggattcggat      2040
     atcaacaaaa aaacaaacat ctttgactgg tctgaacaaa cgcaccctaa ccgtgaaact      2100
     tcggactccg ggacacgtcc caggaccatg caggggaagc acgagggcgt tattgataga      2160
     aacagtcggg ctgtttgccg gaaagcacca tccaccgtcc atcttaggag ccagagtgtt      2220
     ccagtcgcta gtgagcttcc catcaacgag tcgcgtcaaa cttccggcaa gtttggtact      2280
     tggggcttgg gcagtaaggg tgtcagtgaa gattgggata gtgattttga ctttgacgag      2340
     tcggaggaca cacctgtcgc cgaaaacaaa ccgcttgttg aacctgatat caatcgccag      2400
     agcatgactg ttcccaaggc aattctagag cgtcaagcaa gtcttcgtgg tcagtttggg      2460
     caggttcaag aactgacgct gctggtggag gaattgaaac gccttcggca tcaagcaaac      2520
     gtcctagggg ttgtcaacgg accatccagt gaactgtggg cagaagcgga gcagatcgtg      2580
     aaccttgcta ccattgatga tgaagaggag cgtcgctcgc cgccaggatc tccacagtct      2640
     ctcactttca gttttgatga atctgacgat gacggcctta atgcgtcgtc aaagcgaaac      2700
     agcgatgttt tatgggacat accccgtggt gaaaattccg aacccacgtt gcccctcgct      2760
     cagcttgcaa gggactcccc aaagtccaaa tccgtacttg atatcctcca gcctcgccaa      2820
     caggagccct cttcagcttt taatgggtta gaattagcat cacgtgcaaa gaagcttccg      2880
     tttgatactt cctctctgaa aaatttggtg gttcgtgcgg gtgtggtgac gcgtgcgttg      2940
     aaggaagtta ttcgcaaagc agacggggta gcaaccagcc cgcaggattt ccaagacccg      3000
     ccattccgac gcattttcga taaaccatct cacgatgata ttgccagctt tgaggcagcg      3060
     ctggctgaca tgtcctaa                                                    3078
//

If you have problems or comments...

PBIL Back to PBIL home page