(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE151

PENCW_16.PE151       Location/Qualifiers
FT   CDS_pept        join(complement(333212..333559),complement(332980..333138))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234778" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947755"
FT                   /orf_name="Pc20g01510"
FT                   /product="Pc20g01510 protein"
FT                   /protein_id="CAP85480.1"
FT                   /db_xref="UniParc:UPI00018311F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF8"
FT                   /transl_table=1
FT                   /translation="MATRTIYLISARNTSFQRAHFSIFVPSATNPDRGTKIHAVGAPMA
FT                   GYVLEFKRNYNPSLEPHDQTFPIGQVHSSDVVDSPDAAPSIDSTPRGKIELAATQVPTP
FT                   GINQNFMAPVNDTTNKRCQEWTMEYVRHLVAKGLVDKEAIEIVQSKRDPPTHGIGLRSV
FT                   TRPGT"
     atggccacaa gaacaatcta tcttatctct gctcgcaata catctttcca aagagcccac        60
     ttctcaatat ttgtcccatc agctaccaat cccgaccgag ggaccaaaat ccacgcagtt       120
     ggcgcaccga tggcaggcta tgtcctggag ttcaagcgaa attacaatcc cagtctcgaa       180
     cctcatgacc agacctttcc gatcggccag gttcactcgt ccgacgtcgt tgattcccca       240
     gatgcggctc catctatcga ctccaccccc cgagggaaga tcgaactagc ggcgacacaa       300
     gttccgactc cggggatcaa ccagaacttc atggcacctg tcaacgatac caccaacaag       360
     cggtgccaag aatggactat ggaatatgtc cgccatctgg ttgccaaagg gctagtcgat       420
     aaagaagcga ttgagatcgt tcaatctaaa cgtgatcccc ctactcatgg aattggactg       480
     cgatctgtga ccagacctgg gacgtag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page