(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE152

PENCW_16.PE152       Location/Qualifiers
FT   CDS_pept        join(complement(335222..335599),complement(335084..335168),
FT                   complement(334943..335031),complement(334589..334879),
FT                   complement(334482..334530),complement(333826..334424))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128695"
FT                   /orf_name="Pc20g01520"
FT                   /product="Pc20g01520 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85481.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI00018311F6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF9"
FT                   /transl_table=1
FT                   /translation="MLQSTLTLALASCNDFPTLRDVGSLTSVILLLLALLYKVLYVPVA
FT                   SPPRKDSPPCLRLPSWKVTQLFFEKRFDFIKDGFKATSSSIYQTSLFRHNAIVLSGDEG
FT                   RQLFFKEKGLCLYDTFSIMMGSGAAKFDPHQVGGVVRRMASIQRPDNLQKLIPLILLES
FT                   QQKMNAWGRERILDPCSSLHEVAFQLVMRIASFDIANDPVLSARLKSLVDTVDSITNPY
FT                   STWLPWLPGPALFHKFFASVQIYRIVQAAINARKRSGIKRDDMLQQMIDEGDGTIQIFG
FT                   CMLGLSLAGARATGTIVTWLIMQITSDPVWSSNVQEEVKTFVSTHTLSPSLSGDALIQA
FT                   LSEIPLTAWESQTPNLDLCIRETLRTSQPYTAVRKNIGPDVTIGPYVIPSGSLVVYPFS
FT                   DTALNPNYYPDATRWDPSRGIDKETPFIGWGGGKHACKGQRLATLSMKLMVVYALMRFD
FT                   ITMVDGQGKKINRLPLPDWNDSATCRPKERCGIKFVEK"
     atgcttcaga gcactttgac tctggcactt gcctcatgca acgacttccc tactcttcga        60
     gatgtgggta gtctaacctc agtgatcctt ctactcttgg ccttgctcta caaagtacta       120
     tacgtgcccg tggcatctcc gccccgaaaa gattctcctc catgcttgcg tttgcctagc       180
     tggaaggtta cccagttgtt ctttgagaag aggtttgatt tcatcaaaga tggcttcaag       240
     gctacctcgt cttccatcta ccagaccagt ctgttccggc ataacgccat cgttctatcc       300
     ggagacgaag gtcgacagct cttcttcaag gagaagggtc tgtgtctgta tgacacattc       360
     tcaattatga tgggcagcgg cgctgctaaa tttgaccccc accaagtcgg tggtgtagtc       420
     agacgaatgg cttcgattca acggcctgac aatctccaga aattgattcc attgattctg       480
     ttggaatccc agcagaaaat gaatgcatgg ggtcgcgagc gtattctcga cccctgctct       540
     tcccttcacg aggtcgcttt ccagttggtc atgcgcattg cttcctttga tatcgccaat       600
     gacccagtgc tttcagctcg tctcaagtca cttgtcgaca ctgtcgactc gatcaccaac       660
     ccatactcaa cttggctccc ttggttacct ggcccggcct tgtttcacaa gttcttcgct       720
     tctgttcaga tttacagaat tgttcaagcg gccattaatg ccagaaagag gagcggaatc       780
     aagagggatg acatgctaca gcagatgatt gacgagggag atggtacaat tcaaatcttt       840
     gggtgcatgc tagggctctc actggctgga gctcgtgcca ccggaacaat cgtgacatgg       900
     ttgatcatgc aaattacctc ggacccagtc tggtcctcga atgttcaaga ggaggtcaag       960
     accttcgtat ctactcacac attatcaccc tctctctccg gggacgctct catccaagcc      1020
     ctctcagaga tcccactcac agcctgggaa tctcaaacac ccaatctcga tctctgcata      1080
     cgtgaaacac tgcgcacctc acagccatac acagcagtgc ggaagaacat cggcccagat      1140
     gttacaatcg ggccatacgt tatcccctcg gggtctctcg ttgtgtaccc attttcggac      1200
     acagcactca acccaaatta ctacccggac gcaactcgct gggatccgtc tcgaggaatt      1260
     gataaggaaa cgccgtttat cggctggggc gggggaaagc atgcttgcaa aggccagcga      1320
     cttgctacgt tgagcatgaa actgatggtt gtttatgctc tgatgcggtt tgatattacg      1380
     atggttgatg ggcagggcaa aaagatcaac cgtcttcccc ttcctgattg gaatgattct      1440
     gcgacttgtc gcccaaagga gcgatgcgga atcaagttcg ttgagaagta g               1491
//

If you have problems or comments...

PBIL Back to PBIL home page