(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE153

PENCW_16.PE153       Location/Qualifiers
FT   CDS_pept        join(complement(338923..339298),complement(338114..338868),
FT                   complement(338003..338053),complement(337282..337944))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000158970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947756"
FT                   /orf_name="Pc20g01530"
FT                   /product="Pc20g01530 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85482.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018311F7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG0"
FT                   /transl_table=1
FT                   /translation="MTKREKIDTLSEKVVPQQPFGTAERARRDLNAKLSNPLAGFSHTE
FT                   LRDQGRTFAELHEMGDESDIRAFELGAVLAQSPERYDNVAGLTNKEKAVLRREVTHRWS
FT                   QPWKMYVVITLCSLSATVQGMDQTVVNGAQIFYKHQFGIGDGSSRSAWLVGLVNSAPYL
FT                   CCAFISSWLTVPFNHWFGRRGTIFIACCLSAITCLWQGFVSTWWAMFVARFMLGFGIGP
FT                   KSATVPIYAAETAPPSIRGALVMQWHVWTAFGIMVGYASDLIFYNVESSAIVGLNWRCM
FT                   MASAMFPALVVCCFVFACPESPHWYIRQKQYYRAYRSICTLRNHKIQAARDLYYMHTLL
FT                   EAENSIKLGRNKLLELIKVPRNRRAMLASQIVMFMQQFCGVNVISYYSSEIFLEANFSP
FT                   PAALAASLGWGLINWLLSIPAIYTIDTFGRRNLLLLTFPLMSMAMLFTGFSFWIPESSH
FT                   HARLACIALGTYLFGVVYSPGEGPVPFTYTAEVYPLYVRSYGMALGTATMWFCNFLLGV
FT                   TWPSLRAAFTTQGAFAWHASWCFVGWWMILLFMPETKGKTLEELDQVFSVPTRLHARYG
FT                   LRQIGYFFKRYLLRRDIRPEALYEREELVKAQDVGFNA"
     atgacaaaaa gggagaaaat tgacacgctg tccgagaagg tcgtgccgca acaaccattc        60
     gggactgctg agcgtgcacg gcgcgatctc aatgccaaac tctctaaccc gctggccggg       120
     ttcagccata ctgaactacg ggatcagggg cgcacatttg ctgaacttca cgagatgggc       180
     gacgagtccg atatccgtgc tttcgagctg ggtgctgtgc tggcacagtc tccggaacgg       240
     tatgacaatg tggctggtct aacaaacaag gagaaggcag tattgcgccg ggaggttacg       300
     catcgctggt cacagccgtg gaagatgtat gttgttatta cgttgtgctc tttatccgcc       360
     acagttcagg gaatggacca aacggttgtc aacggagccc aaatattcta caaacaccaa       420
     ttcggtatcg gcgatggatc ctctcggagt gcctggcttg tcggtctagt aaactcagca       480
     ccatacctct gttgcgcctt catcagctcc tggctgacag tcccattcaa tcattggttc       540
     gggcgccgcg gcacaatttt catagcatgc tgcttgtctg cgataacctg tctctggcag       600
     ggatttgtct cgacgtggtg ggcgatgttt gttgcacgat tcatgctagg cttcgggatt       660
     ggccccaaat cagccactgt gccgatatac gcagccgaaa cagcaccgcc gtctatccgt       720
     ggcgcattgg ttatgcagtg gcatgtgtgg accgcattcg ggattatggt cggctatgca       780
     tcggacctca tattctacaa tgtggagtcg agtgccattg tcggcctgaa ttggcgctgt       840
     atgatggcct cggcgatgtt cccggctcta gtcgtttgct gttttgtctt tgcttgtccc       900
     gagtcacctc attggtacat acgccagaag cagtattacc gtgcgtacag gtctatctgt       960
     acgctgcgaa accataagat ccaggcagct cgtgacttgt actacatgca taccctgctg      1020
     gaggctgaga atagcatcaa gcttgggcgt aacaagctgc tggaactgat taaagtcccg      1080
     cgaaatcggc gggcgatgtt ggcgtctcaa attgtgatgt ttatgcagca gttctgtggc      1140
     gtgaatgtca tatcatacta ttcttccgag atatttctcg aggccaactt ttctccgccg      1200
     gctgctctag ctgcctcact aggctggggc ctaatcaact ggctcctatc aatcccggca      1260
     atttacacaa tcgacacatt cggccgacgc aatctcctat tactcacctt cccactcatg      1320
     tccatggcaa tgctattcac agggttcagc ttctggatcc cagagagcag ccaccatgca      1380
     cgtctcgcct gcatcgcttt gggaacatat cttttcggcg tggtctactc accgggcgag      1440
     ggaccagtgc catttacata cacagccgaa gtgtacccgc tatacgtccg atcatatgga      1500
     atggcgctag gcacagcaac gatgtggttc tgtaatttcc ttctgggcgt gacgtggccg      1560
     tctctgcgtg ctgcatttac aacgcaggga gcatttgctt ggcatgcaag ctggtgcttt      1620
     gttggatggt ggatgatact cttgtttatg cctgagacaa aggggaagac gcttgaggag      1680
     ttggatcagg tcttttctgt gccgacaagg ctccatgcgc ggtatgggtt gaggcaaatt      1740
     gggtatttct ttaaacggta cttgttgaga agggatatta gaccggaagc tctttatgag      1800
     agggaggaat tggtcaaggc tcaggatgtg ggatttaatg cttag                      1845
//

If you have problems or comments...

PBIL Back to PBIL home page