(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE154

PENCW_16.PE154       Location/Qualifiers
FT   CDS_pept        join(340636..340675,340738..341011,341080..341427,
FT                   341485..341674)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181113" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947757"
FT                   /orf_name="Pc20g01540"
FT                   /product="Pc20g01540 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP85483.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00018311F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG1"
FT                   /transl_table=1
FT                   /translation="MDDAESPRLEEQQTPTKSPFTNVRTDGRAFNSPNWRMKAESPATP
FT                   SRTNASPSANPNTSRAAFSRPGAHVPQAINDGRRLYVGNMPYTAKMEDVEALFIAAEFP
FT                   IERIDIAIDPFTGRNPSYCFVDLQNKEHAERAMTELDGRDMLGRPVKIKPGVAKSQERI
FT                   QNPPEPFRIDCWRQQERPSFAKVNSDSSSRVYVGGLPRLTDHGAVQTNIEMFFKGFKVE
FT                   HVSKLFTPHPAKRFEPGEHYYLFVDVGSPEQALKAMDTLNGREGPWGGPLRVQFARGTK
FT                   DT"
     atggatgatg cagagagccc cagactggag gagcaacaga ctcctaccaa gtctcccttt        60
     acaaatgtcc gcactgacgg ccgagccttc aactctccca attggcgcat gaaggctgaa       120
     agcccagcaa caccatcgcg taccaatgcc agcccaagcg cgaaccccaa tacctctcgt       180
     gcagccttca gtcggcctgg agcgcacgtg ccccaagcga ttaacgatgg ccgccgccta       240
     tacgttggca acatgccata cacggcgaag atggaggatg tggaggcgct gttcatagcg       300
     gccgagttcc ctatcgagcg catagatatt gccattgacc ctttcaccgg ccggaaccct       360
     tcttactgct tcgtcgactt gcagaacaag gagcatgccg agcgcgccat gactgagctc       420
     gatggccgcg atatgttggg tcgcccggtc aagatcaagc ccggtgtggc caagtctcag       480
     gagcgcattc agaatccgcc tgagccgttc cgcatcgatt gctggcgtca gcaagagaga       540
     cctagctttg ccaaggtcaa cagtgactct agcagccgcg tatacgttgg tggactgccg       600
     cgattgaccg accacggggc tgtgcagacc aacatagaga tgttcttcaa gggattcaag       660
     gttgaacatg tcagcaagct cttcacccct caccccgcta agcggttcga acccggcgag       720
     cactactatc tgttcgtcga cgtgggttct cccgagcaag ccctgaaagc catggataca       780
     ctgaatggtc gggaaggacc atggggtggt ccgctacgtg tacagtttgc tcgtggtacc       840
     aaggatacct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page