(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE155

PENCW_16.PE155       Location/Qualifiers
FT   CDS_pept        join(343174..343273,343325..343911,343967..344632)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181112" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824359"
FT                   /orf_name="Pc20g01550"
FT                   /product="Pc20g01550 protein"
FT                   /function="6-phosphofructo-2-kinase activity"
FT                   /function="ATP binding"
FT                   /biological_process="fructose 2,6-bisphosphate metabolic
FT                   process"
FT                   /protein_id="CAP85484.1"
FT                   /db_xref="GO:0003873"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006003"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR016260"
FT                   /db_xref="UniParc:UPI00018312CF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG2"
FT                   /transl_table=1
FT                   /translation="MPIANFGTQSDDSKICVVMVGLPARGKSLIAGKAMRYLGWVGIPA
FT                   RVFNVGSYRRFSTPQPQAGFFDPHNEEGERMRRAAAEAAMSDMLQWFNTGKGVVAILDA
FT                   TNSTKDRRRWIYEKCTEAGIEALFVESICDDEDLIMTNIKEVKTTSPDYKGQDPEVAAL
FT                   DFRNRIRNYEKVYETIDDDEKSYTYVKLINVGSTVIINQIKDYLSSRLVYYIQNIHIKP
FT                   RSIWLSRHGESEFNLTGRIGGDSNISERGEAYARALPELMRKSGIPDNTKIVIWTSTLR
FT                   RTIQSARHLKAETGYETLEWKALDELDSGVCDGLTYEQIAEKYPEDFAARDEDKYNYRY
FT                   RGGESYRDVVIRLEPIIMELERSENVIIVTHQAVLRCIYAYFMNVPQEQSPWMEVPLHT
FT                   LIKLTPRAYGTEEQRFKADIPAVSTWRGKGTSAKHQEFPAEGKKEDTETKN"
     atgccaatcg ctaactttgg tacgcagtcc gacgactcaa agatatgtgt tgtcatggtg        60
     ggcctcccgg cccgaggcaa gagtctcatc gccggcaaag ccatgcgcta tctgggttgg       120
     gtgggtattc ctgcacgtgt ctttaacgtt ggcagttacc gccgcttcag cactccacag       180
     ccacaggcgg gattctttga tcctcacaat gaagaaggcg agcgtatgcg ccgagctgct       240
     gcagaggctg ccatgtctga catgctccag tggtttaata ccgggaaggg tgttgtggcc       300
     atcttggatg ccaccaattc cacaaaggac cgccgcaggt ggatctatga gaaatgcacc       360
     gaagccggta tcgaggctct ctttgttgag tcgatttgtg atgacgaaga tctcatcatg       420
     accaacatca aggaagtcaa gacgacatcc ccggactaca aaggccaaga tccggaagtg       480
     gctgcgcttg atttccgcaa ccgcattcgc aactatgaaa aggtgtacga gaccatcgat       540
     gatgacgaga agagctacac ttacgtcaag cttatcaacg tgggatcgac ggtcatcatc       600
     aaccagatca aagattatct gtccagtcgc ctagtctatt atatccagaa tattcacatc       660
     aagccccgtt caatctggct atcaagacac ggtgaatccg agttcaacct gaccgggcga       720
     attggaggcg actccaacat ctccgagcgc ggcgaggcat atgcccgcgc actccccgag       780
     ctaatgcgca agtccggtat tcccgacaac accaagattg tgatctggac ctcaaccttg       840
     cgccgcacta tccagagtgc ccgccacctt aaggcagaaa ctggctacga gacgctggag       900
     tggaaagccc tggatgagct ggactcgggc gtctgcgacg gtttgaccta cgagcaaatt       960
     gctgaaaagt acccagagga ctttgctgcc cgtgatgaag acaagtacaa ctatcgctac      1020
     cgcggtggcg agtcctaccg cgacgtcgtc atccgccttg agcccatcat catggagctg      1080
     gagcgcagtg agaatgttat cattgtcacc caccaagctg tcctccgctg catctacgct      1140
     tactttatga atgtacctca ggagcagagt ccctggatgg aggtgccttt gcatactctt      1200
     atcaaactca cgccccgcgc ttacggtacc gaagagcaac gcttcaaggc tgatatcccc      1260
     gctgtgtcga cctggcgcgg gaaggggaca tcggcgaagc atcaggagtt ccctgccgag      1320
     ggaaagaaag aggacacgga aaccaagaat tag                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page