(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE158

PENCW_16.PE158       Location/Qualifiers
FT   CDS_pept        349265..351778
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181068" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977586"
FT                   /orf_name="Pc20g01580"
FT                   /product="Pc20g01580 protein"
FT                   /protein_id="CAP85487.1"
FT                   /db_xref="InterPro:IPR013745"
FT                   /db_xref="UniParc:UPI00018312D2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG5"
FT                   /transl_table=1
FT                   /translation="MNPTFRSPNSPGRQAPAPRYPRPPSDDEEEDDSDEDELVRPGSSG
FT                   SDASSNVTTVSAAPVTPINTQQPGGYFPPQPRSATSPHHPMPNPSGRRPSGRGPSVELP
FT                   RHRSRHHSQGFFEPSLPTASSDQVPTVSASRIAAQAAMQQTKKQQNVTTPVEDGSRPRR
FT                   SGSSSPPLMPAPLRVNQPSPQPPPPSGNVATTAANVVFPRAGAAPAEQQPEKQKKKKLF
FT                   SKPKHIGISSHKDLGKDRGLPSPSKISGLSRMVSGSTTNLADLSSNNSSMYNLSNASVS
FT                   TVVPADRPPIQEKEKEKDKDKHKHHFLSRQKLKLKDRVEDHFNLPLSSASSNSRPADPN
FT                   APQSLYSFTPASPAPGATFGKSVSGLDLLHGGRALREKKKEEKALAESEQMEWLANNAG
FT                   GPTTPGGFPGPSSVGSSGTLPESMLRETLQGFGLNNMTPEDAWDFLKAKLLVIFDGEDV
FT                   RIAIEDLNKLVLVHLQRCVLKRAPTSIVVDLQELLETGFATLNHSSLIGLPDEKLVPHL
FT                   VQVWLLVFGTILPFIQAVFLPLDLEFKGCGSLMTSREAGEFWGALPVGGTLDVRSLVLI
FT                   AFRDCMILNRYDALKATFSRLSLDSINSGFPTLSVTAKSTGTGGRPGTAASLDAGFGSY
FT                   TSQSSTLLSTVTDSYSSDGISALANHPRPTSSDSRSRATSNTSSNADPLFFQSITSPPT
FT                   SNKRPTVIHRGNTSADSSHVITETVGRMLQCISVLASVQTDDASQERIEILSKALKHNW
FT                   LGRGRTGRDRRGFVGAKIRPVMVGGPPVIDDGDSLTTAGISIGASTSTGGSRGRGDSSS
FT                   SEWSSNVPGPGMSMRSGGRRELSVL"
     atgaatccta ccttccgatc ccccaactcc cctgggcgtc aagcgcctgc ccctcgttac        60
     ccccgacctc catctgatga cgaagaggaa gacgactccg atgaagacga attggttcgc       120
     cccggatcct ccggtagtga cgcctcttct aatgtgacca ccgtttccgc cgctcctgtc       180
     actccgatca atactcaaca gcccgggggc tacttccctc cacaaccacg ctcggcgact       240
     tcgcctcatc accctatgcc gaacccatca ggccgaaggc cgtccggccg gggcccctct       300
     gtcgagttac cccggcaccg atcacggcat cactcgcagg gcttctttga gccttccctg       360
     ccgaccgctt cctccgacca ggtccctacc gtgtcagcat cccgtatcgc cgcccaggca       420
     gcaatgcagc agacaaaaaa gcaacaaaat gtcacaaccc cggtagagga tggttctcgt       480
     cccaggcgca gtggaagcag ttcacctcct ctgatgcccg ccccattgcg tgtcaaccaa       540
     ccgtctcccc aaccgcctcc gccgtcaggg aacgtggcca cgacagctgc gaatgtggtc       600
     ttcccgcgag ccggtgctgc accggcagaa caacagcccg agaaacagaa gaagaagaaa       660
     ctcttctcaa agccaaagca catcgggatc agcagtcata aagatctggg caaagaccgt       720
     ggccttccat ccccgagcaa gatcagtggg ttatcccgca tggttagcgg ctcgactaca       780
     aacttggccg acctgtcctc gaacaactcg tcgatgtaca atttatccaa tgcctccgtg       840
     agcacagttg tccctgcaga tcgtccgcca attcaagaga aggaaaagga aaaggacaaa       900
     gacaagcaca agcatcattt cctgtcaagg cagaaactga agttaaaaga ccgtgtcgaa       960
     gaccacttca acctccctct atcatcggct tcgagtaatt ctcgcccggc agaccccaat      1020
     gccccacagt ctttatactc ctttacgcct gcgtctccgg ctcctggggc gacgtttggc      1080
     aagtcggtca gtgggttgga tctcctgcat ggcggtcgag cactgcgtga gaagaaaaag      1140
     gaggagaagg cgcttgctga gtcggagcag atggaatggc tggccaataa tgctgggggg      1200
     ccaacgacac ccggtggctt cccaggtccg tcctcagtcg gtagttcggg gacactcccc      1260
     gagtctatgc tccgggagac cttgcaaggg tttgggttga ataacatgac cccagaggat      1320
     gcgtgggact tcctcaaggc gaagctgctg gtcatcttcg acggtgaaga tgtgcgcatc      1380
     gccatcgaag atctcaacaa gctggtgctt gttcatttgc agcgttgtgt tcttaagagg      1440
     gctcctactt ctattgtagt ggacctgcaa gaactcctag agactggatt cgcgaccttg      1500
     aatcacagtt ccctgattgg actcccagat gaaaagctgg tcccgcatct ggttcaagtg      1560
     tggctgctgg tgtttggcac gattctgccc tttatccagg ctgtgtttct tcccttggat      1620
     ctcgagttca agggctgtgg atccttgatg actagccgag aagccggtga gttctggggt      1680
     gcactgcctg ttggtgggac actcgatgtg cgaagtctag tcttgatcgc cttccgtgat      1740
     tgcatgattc tgaatcgcta cgatgccctc aaagcaacct tctcccggct cagcctcgac      1800
     tccatcaact ccgggttccc aacactcagc gtcacagcca agagtaccgg cactggaggc      1860
     cgtcctggca ctgcagcctc gcttgatgcc ggcttcggta gctacacctc gcagtcatcc      1920
     acacttctca gcaccgtcac cgacagttac tcctccgacg gcattagtgc cctggccaac      1980
     cacccacgtc caacaagtag tgactctcgc agtcgcgcta cctcgaacac atcctccaac      2040
     gcagatcctc tctttttcca gtctatcaca tcgccaccaa cctccaacaa acggcccacc      2100
     gtcatccacc gcggcaacac ctccgccgac tcctcccacg tcatcacaga gaccgtcggc      2160
     cgcatgctac aatgcatcag cgtcctggcc agcgtgcaaa cagacgacgc ttcccaggag      2220
     cggatcgaga ttcttagcaa agctctcaaa cacaactggc tcggccgcgg ccgcaccggt      2280
     cgtgatcgtc gtggcttcgt cggcgccaag atccggcctg tgatggtcgg cggacctcct      2340
     gttatcgatg atggagattc cctcactacg gctggcatca gcatcggtgc tagtaccagt      2400
     actgggggct cccggggccg aggtgactcg tcctcgtcgg aatggagttc gaatgttcct      2460
     gggcctggta tgagtatgcg tagtggtggc agacgagaac tgagtgttct ctag            2514
//

If you have problems or comments...

PBIL Back to PBIL home page