(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE159

PENCW_16.PE159       Location/Qualifiers
FT   CDS_pept        join(complement(354726..354911),complement(354275..354620),
FT                   complement(352500..354208),complement(352207..352395))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947760"
FT                   /orf_name="Pc20g01590"
FT                   /product="Pc20g01590 protein"
FT                   /protein_id="CAP85488.1"
FT                   /db_xref="UniParc:UPI00018312D3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG6"
FT                   /transl_table=1
FT                   /translation="MASDRTIRDLFPALVVGLERETSATPSVHDSDASFHPSQSPTPVN
FT                   KQTLPAQDSIEVKAPTPTADLLLLDPHEFSLLQLKRILRTTYLQLVTLCLTIPVGAFIP
FT                   ALDPQTTNTNSNTEGRPKDASHILTPRIRVVMRKGPREPTPDSDTVSESSKKQHPKDVT
FT                   PITPRRRIVITKKSRAEGRPNEATPTSTPRVRIVVRKRSREITEDSDTVSDPTSAKGTK
FT                   DVTPIPSHSSQDSIHSTAPSDPRNPSSYLESNLLNSAEEPPVDSNMDSPKPTAVSTSHE
FT                   SSSDYDETSISVNPTSELPATSMSPNSRSSSEEAPSRDAGHLSPTLDFVPSTPPHPSSD
FT                   SSMGPPTDPSMDPNMVSHRQPLDSAVIPGNPSFEDPDVLPSTFMYPEETFDQSNRAIDP
FT                   MGVYTPEEYARILASEQEVLREMADPHTDIATHLYSQTEDPYYTTINDLNRHTDTSTHL
FT                   YSQTEEPHHTAIDDLDRHTDISTHPYSQTEEPHYTTIDDMDRIFAEMEAATAGMDFLQP
FT                   EFWAAIGRDLSSPSQPGALESDQHAQAPTTSGTLQSVEGTDLGSVPKRARHSSPKTKSP
FT                   SPDLSSTLSVKTSVSMPSRSASSKAKSTTPPAMSASNRRRSKDQSVTPAPTASSSRRRS
FT                   KASTKTETATPEPRATVTVSPRRLRSSDVMPRPSTNTKKNPQGNATPDSWDTAPTADKM
FT                   MSQMKETESMSWFDITAAWNQNRSDLDDEMTWRALSKRWGRIKDRIGPWPGFDEALLDA
FT                   FSQFNSKPDDESFAQIAEDISIQLGWDVSGAACQGRYDVLEEAGKIDLKGKGRARK"
     atggcttctg atcgaactat cagagatctt tttccagccc ttgtcgtggg attggagaga        60
     gaaacgagtg caacgccgtc cgtccatgat tccgatgctt catttcatcc aagtcaaagc       120
     cctaccccag tcaacaagca gacgttgcca gcacaggata gtattgaggt taaggcaccc       180
     acgccgaccg cagacctgct cctgttagat ccacacgaat tcagtttgct ccagttgaag       240
     agaattctga gaactaccta cctgcaacta gtcacactgt gtcttacgat tcccgttggt       300
     gctttcatcc ccgctctcga tcctcagacc actaacacaa attccaatac agagggtcgc       360
     cccaaggatg caagtcacat cctcactcct agaataaggg ttgttatgag aaagggacct       420
     cgcgagccca cccccgactc ggacactgtt tcagagtcgt caaaaaagca acacccgaag       480
     gacgtgactc ccatcactcc tagaagaaga attgtcatca ccaaaaaatc tcgtgcagag       540
     ggacgcccta acgaggcaac tcccacttcc actcctagag taaggatcgt tgtcaggaag       600
     agatctcgcg agatcactga agactccgac actgtttcag acccgacgag tgcaaagggc       660
     accaaggacg tgactcccat tccttctcat tccagccagg actccatcca ctcgactgct       720
     ccatctgatc cccgaaatcc gtcatcttat ctcgagtcta atctgctaaa ctctgctgaa       780
     gaaccgcctg ttgattccaa tatggattct cccaagccca ctgctgtcag cacatcacat       840
     gaatcttctt ctgactacga cgagacatcg attagtgtca atcctacctc ggagctccct       900
     gctaccagta tgtcccccaa ttcccgttcg agctctgagg aagctccgtc ccgggacgct       960
     ggtcacctat ctcccacgct ggactttgtc ccttctacac ccccgcaccc ttctagtgac      1020
     tcttcaatgg gtccccccac ggatccttcc atggatccga atatggtttc acaccggcag      1080
     ccacttgatt cagcggtaat accaggaaac ccgtcctttg aagacccaga tgtcctcccc      1140
     tccacattca tgtaccccga ggagactttc gaccaaagca accgggccat tgaccccatg      1200
     ggtgtctaca ctcccgagga gtacgcacgc atcctggcgt ctgagcaaga ggtcctgcgt      1260
     gaaatggctg acccgcatac ggatattgca acgcatctgt attctcagac agaagatccg      1320
     tattacacta ccatcaatga cctgaaccgc catacggata cttcaacgca tctgtattct      1380
     cagacagaag agcctcatca cactgcaatt gatgatctgg accgccatac cgatatttca      1440
     acgcatccct attctcagac agaagagccg cattacacta cgatcgatga catggaccgt      1500
     atctttgctg agatggaagc tgccactgct gggatggatt tcctacagcc tgaattttgg      1560
     gccgctatcg gccgcgacct gtcaagtcca tctcaacctg gtgcacttga gtctgaccaa      1620
     cacgcccagg ctccaaccac ctctggaacc ttgcagtcag tggagggaac agacctaggc      1680
     tcagtcccaa agcgtgcccg acacagttca ccgaagacaa agagcccaag cccagatctc      1740
     tcgagcacac tttctgtcaa gacctcagtc tcgatgccgt cccgcagcgc ctcatccaag      1800
     gccaagagca cgactcctcc ggctatgtca gcctcgaacc gccgccgttc caaggaccag      1860
     tccgtgacac ctgctcctac cgcatcatca tcccgccgcc gttccaaagc cagcaccaag      1920
     actgagacag ctactccaga gccgcgcgcc accgtcaccg tctccccgcg ccgtctgcgc      1980
     agttccgatg tcatgccccg ccccagcacc aacacgaaga agaaccccca gggcaacgca      2040
     accccagact catgggacac agcacctacc gcagacaaga tgatgtcgca gatgaaggag      2100
     acggaatcga tgtcgtggtt tgacatcact gcggcatgga accagaatcg aagtgacttg      2160
     gacgacgaga tgacatggcg agcgctgagc aagagatggg gacggatcaa ggatagaatt      2220
     ggtccttggc ccggtttcga cgaggccctt ctagatgcct ttagccagtt caattcgaag      2280
     ccggatgacg agagcttcgc gcagattgcc gaggacattt cgattcagct tggctgggat      2340
     gtttctggcg ctgcatgcca gggtcgatac gatgtcctcg aggaggctgg caagatcgac      2400
     ttgaagggta agggcagggc tcgaaagtga                                       2430
//

If you have problems or comments...

PBIL Back to PBIL home page