(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE16

PENCW_16.PE16        Location/Qualifiers
FT   CDS_pept        48329..50347
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671388"
FT                   /orf_name="Pc20g00160"
FT                   /product="Pc20g00160 protein"
FT                   /protein_id="CAP85345.1"
FT                   /db_xref="UniParc:UPI0001831908"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF27"
FT                   /transl_table=1
FT                   /translation="MPHAHHAGLVMRNHVRRDVIPPHRLPFLVPSTSSIATELPSLVAR
FT                   AEASTTVTGEKPTSNLTTTVLPVVLGAGVPILCAIVVLIVLHRRHVKKLLREDAMDKHK
FT                   SLDFGMDTVGPATRRKGPGMPPMSEPTHTKGLSLDVGPYLMPPGLKNSPESLRSMSIDD
FT                   DKYRPATASIRSYPRGSRFEGADDGNSGLLQNAQRMSRSSPPLYSSPIESHGRSLDQHN
FT                   DYLGEVPGVTHPPAAQQPGMAIGSPNANRIPSPEPLPHLDSSLGLNFGLDNTHGNTYNN
FT                   QHEERLNFPLPEPSQSRDLDHNQAPASQLPRISLPDSVVTSSDYGDDRKSQYTLPTVNI
FT                   HGTEDVQQHNALSHDNKNPELPEEPQNLDAAYDNRRDTRRMTLGLRPLPPEDPADNPEQ
FT                   RANRIRSFYKEYFDESKNGQEPTYYEDFGPEFYEGGGNAGFIYDPITGDYYDATHGVAP
FT                   FAEPMTRRAMTPPPRAPPRFQGAARHMATNSAGYNGMPGPRAFSSASGRMPGPRGPKKP
FT                   IPPPSPLQILPTPHMLTDDSLMTAMDFAPANGFKDRRAGRPETPTGGVRHYIPGVRAHT
FT                   PLASAFDELAVMPSPHALRKSGTFTNLDFVPPPRFKNEGAGSDAGSIRSARTVVSAHHQ
FT                   NNIRMGNYRVSRLPAEAVGTKDDMMATLRPKWDMNNT"
     atgcctcatg ctcaccatgc cggcttggtg atgcgaaacc acgttcgtcg ggatgtcatc        60
     cctccacatc gattgccatt tttggtcccc agtacctcct ctatagccac cgagcttccc       120
     tcactcgtgg caagagccga agcatctacc acggtcacgg gtgaaaagcc caccagcaat       180
     ctgacaacaa cggtcttgcc tgtcgtccta ggtgcaggtg ttcccatcct gtgtgctatt       240
     gtcgtcctca tcgtgcttca ccggagacat gtgaagaaac ttctgcggga agatgcaatg       300
     gataaacata aatctctcga ttttggaatg gatacagtgg ggcctgcaac caggaggaaa       360
     ggtcctggaa tgcccccgat gtcggaacca acccatacca aaggcctgtc tcttgatgtg       420
     ggcccttatc tgatgccccc gggcctgaaa aattccccgg agtctctgcg ctccatgtca       480
     atagatgatg acaagtaccg cccggccact gcctccattc ggtcataccc caggggttcc       540
     cgattcgaag gtgccgatga cggcaattca ggtcttctcc agaatgcgca gaggatgtct       600
     cgttcatccc cgccgctgta ctcctcccct atcgaatcgc atggacgcag tctggatcag       660
     cacaatgact accttgggga agttcccgga gtcacgcatc cacctgctgc acagcaacct       720
     ggcatggcta ttggaagtcc caacgccaat cggattcctt cgccagagcc cctgccccat       780
     ctggattcct cgttgggcct aaatttcgga ctagataata cacacggcaa cacatataac       840
     aaccagcatg aagagcgcct caacttcccg ctgcctgagc cttcgcaatc acgagacttg       900
     gaccataacc aggctcctgc atcgcagctt cctcgtattt ccctgccgga cagtgttgtt       960
     accagtagtg attacggcga tgaccgcaag tcacaataca ctctccctac ggtcaacatc      1020
     catggcacgg aagatgtcca gcaacataat gccctcagcc acgataacaa gaatccggaa      1080
     ctcccggagg aacctcaaaa tctggatgcg gcatatgata accgtcgtga tacccgccgg      1140
     atgactctcg gattgcgccc gttgccccca gaggaccccg ccgacaaccc agaacagcgt      1200
     gccaatcgga ttcgctcctt ctacaaggag tacttcgatg agagcaagaa cggccaggag      1260
     cccacatact acgaggactt cgggcccgag ttctatgagg gtggtggtaa tgctggtttc      1320
     atctacgacc caattactgg cgactattat gatgccactc atggtgttgc tccattcgcc      1380
     gagccgatga cccgtcgcgc gatgacaccg ccgcctcgcg cacctccgcg cttccaggga      1440
     gccgctcgcc atatggccac caactctgct ggctataatg gtatgcccgg gccacgcgcc      1500
     ttctcatctg cctctggccg tatgcctggt ccacgcggtc ccaagaaacc gattccaccg      1560
     ccttcaccgc tgcaaatcct gcctactcct cacatgttga cggacgactc cctcatgact      1620
     gccatggact ttgccccggc caatggattc aaggaccgcc gtgcgggccg ccctgagaca      1680
     cccacgggtg gcgtacgcca ctatatccct ggtgtgcgag cccacacgcc actggcctct      1740
     gcctttgacg agctcgccgt gatgcccagc cctcacgcct tgcgcaagtc cggcacgttc      1800
     accaacctgg actttgtgcc cccgccccgt ttcaagaatg agggtgccgg tagtgatgcg      1860
     ggaagtattc gcagtgctcg gactgtcgtg tctgctcacc accagaataa tatccgcatg      1920
     ggcaactacc gtgtcagtcg tctgccggcc gaggcggtcg gcactaagga cgacatgatg      1980
     gccactctac gtccgaagtg ggatatgaac aacacataa                             2019
//

If you have problems or comments...

PBIL Back to PBIL home page