(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE160

PENCW_16.PE160       Location/Qualifiers
FT   CDS_pept        join(356424..357081,357152..359073,359137..359295)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181046" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947761"
FT                   /orf_name="Pc20g01600"
FT                   /product="Pc20g01600 protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAP85489.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI00018312D4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG7"
FT                   /transl_table=1
FT                   /translation="MDHTSTPTEAKDEVVPSENLNGSAQPAEVKDVREVKDAATAPAPE
FT                   TTPASAPKLCKKHKKKNKKKDESDSSSDSSSSSSSSDSDADSEDASDSTESDSDTEKRK
FT                   RHRLRKARARRALRDKKRRKKRKQRSRKAETSDSESDSEEESDSVSSTDSDDDIDDKAL
FT                   RKLVTKLKLSKKRAKKLRELAADDLAASDSLGETRREKRSKKKKPASKVAYKRVDQLWD
FT                   TTIHKYKLTETVDDPDADEWDQYIFNIRRKFNWENKYLETVVDIKSKPLRDALSKIMDG
FT                   VKGVSLVQEPAVVDPNMLFLYLEETRQYMKDLKKQSRSEKKRKVRKAAAVKAAHLKVLI
FT                   KYLDTDYADIKKTLYPLLEANTITFDLLWALYKPNTIAYTPTYGSTDEPRAFKIEYAIK
FT                   ESSFMKGQWYSVDGRYLEYDGKDYGFGTMSAEVDSFKGARKITSLACYPLKYHRDAEAL
FT                   RARLVERGKRFVALRGMNYRFHKGMAFYKKKRSLIIKVNINGRVMIDPAIHRRINPNYP
FT                   ISTVRPKDPDLIDPEDLGISGDEGEDSDGCCCGGSDSDSEHGGASDTPRTMYKVVEDTE
FT                   GCPRVVEVEVDENGTEIHKEKMDRIEGAASGSKDREFTEEELLIASPVVLGFAFSEKLW
FT                   LEFTISGISDIEWDKEAFGSLVLPSNQKSIVKALVESHTFHAAQNIDDVIQGKGKGLVA
FT                   VLHGPPGTGKTLTAEGIAELLRRPLYMVSAGELGTDSRTLEAELNKILDIAHSWGAVLL
FT                   LDEADVFLEKRTIHDIHRNALVSIFLRLLEYFQGILFLTTNRVETFDDAFQSRIHVALR
FT                   YGDLTSKAKRSIWKMFLERVRAIEGVNIASFSEEDYDMLSRHTLNGRQIKNSVRTAQAL
FT                   AVNEKAPLSMDHIKRVLEVAETFDQDLRGGTGYLDAMRSYT"
     atggatcaca cttctacccc gaccgaggcc aaagatgaag tcgttccatc agagaatctg        60
     aacggctctg ctcagcctgc agaggttaaa gacgtcagag aagtcaaaga cgctgctact       120
     gcccccgcac ccgagactac ccctgcctct gcccccaaac tgtgcaaaaa gcacaaaaag       180
     aagaacaaga aaaaggacga gagtgatagc tcctcagatt cttcttcttc ttcttcttct       240
     tctgacagcg atgccgactc tgaggatgca tccgattcca cagagagcga ctccgatacc       300
     gagaagcgca agcggcatcg cctacgaaag gcgcgtgcga ggcgtgcact cagggataag       360
     aagcgccgta agaagaggaa gcagcgctcg cgcaaggctg agacatcgga ttcggaatct       420
     gactcagagg aagagtcaga ttcggtgtct tctactgact ccgatgacga catagatgac       480
     aaggcgttgc ggaaattagt caccaagctc aagcttagca aaaagagagc caagaagctg       540
     cgtgaactgg ctgctgatga tttggccgcc agcgattcgt tgggcgaaac tcgccgcgag       600
     aagcggtcta agaagaagaa gcccgcttcc aaggtggcct ataagcgtgt agatcaatta       660
     tgggatacca ccatccacaa gtacaagctc actgaaactg tggatgaccc tgatgccgac       720
     gaatgggacc agtatatctt caacatccgt cgcaagttca actgggagaa caagtacctc       780
     gagactgtcg tcgatatcaa gagcaaaccc ctccgcgacg ccctctccaa gatcatggat       840
     ggtgtcaagg gcgtcagtct cgtgcaggag cccgccgtcg tggaccccaa catgctgttc       900
     ctatatctgg aggaaacaag gcaatacatg aaggacctga aaaagcagtc gcgcagcgag       960
     aagaagagga aagtcagaaa ggctgctgct gtcaaagctg cccatctgaa agttctcatc      1020
     aaataccttg acaccgacta cgccgacatc aagaagactc tctacccgtt gctcgaggcc      1080
     aacactatca cgttcgatct gctgtgggcc ctgtacaagc ccaacaccat cgcttacact      1140
     ccgacctacg gtagcacaga tgaaccacgt gctttcaaaa tcgagtacgc catcaaagag      1200
     tcctccttca tgaagggtca gtggtacagt gtcgatggcc gctacctcga gtacgacggc      1260
     aaggactacg gcttcggcac tatgtctgct gaagtcgatt cctttaaggg cgctcgcaaa      1320
     atcaccagtc tcgcctgcta cccgctgaag taccaccgcg atgccgaggc tctgcgtgcc      1380
     cgtctcgtcg aacgcggcaa gcgcttcgtc gctctccgtg gtatgaacta ccgcttccac      1440
     aaaggtatgg ccttctacaa gaaaaagcgc tcgctcatca tcaaggtcaa tatcaatggc      1500
     cgtgtcatga tcgacccggc tatccaccgt cgcatcaacc ctaactatcc catctccact      1560
     gtccgtccca aggatccgga tctcatagat cccgaagatc ttgggatcag cggcgacgaa      1620
     ggtgaggata gcgacggctg ctgctgtggt gggtcagact cggactctga gcatggcggc      1680
     gcctctgata ccccacggac gatgtataag gtcgttgagg atacggaggg atgtcctcgc      1740
     gtcgtggagg tcgaagtcga cgagaacggt accgagatcc acaaggagaa gatggaccgc      1800
     attgaaggtg ccgcttctgg ttccaaggac cgcgagttta ctgaggagga gctcctcatt      1860
     gcctcgcctg tcgttctggg ctttgccttc agcgagaagc tctggctcga gttcaccatc      1920
     tccggtatca gcgatatcga gtgggataag gaagcctttg gttcgcttgt cctcccgtcg      1980
     aaccaaaagt ccatcgtcaa ggctctcgtc gagtcacata ccttccacgc cgcgcagaac      2040
     atcgacgatg tcatccaggg taagggtaag ggtcttgttg ctgtgctgca cggtccgccc      2100
     ggtacgggta agaccctgac ggcagagggc atcgccgagc tactccgtcg cccgctgtac      2160
     atggtcagcg ccggtgaact gggtactgac tcgcggaccc ttgaggcgga gctgaacaaa      2220
     atcctggata tcgcgcactc ctggggcgca gtgctcctcc tcgatgaggc agatgttttc      2280
     cttgagaagc ggactatcca cgatatccac cgcaatgctc ttgtcagcat cttcctccgt      2340
     ctgctggaat acttccaggg cattctgttc ttgactacca accgtgttga gaccttcgac      2400
     gatgccttcc agtcgcgtat ccacgtcgct ttacgctacg gcgatcttac ttccaaggcg      2460
     aagaggagta tttggaagat gttcttggag cgcgtgcgcg ctattgaggg tgtgaatatc      2520
     gcttctttct cggaggagga ttatgatatg ctttcccggc acacgttgaa tgggcgacag      2580
     atcaaaaact ccgtccgcac tgcacaagcc ctggctgtca acgagaaagc gcccctctct      2640
     atggaccata tcaagcgtgt gctagaggtg gccgagacat tcgatcaaga cctgcgcggc      2700
     ggaacaggat acctggacgc catgcgaagc tatacttga                             2739
//

If you have problems or comments...

PBIL Back to PBIL home page