(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE161

PENCW_16.PE161       Location/Qualifiers
FT   CDS_pept        join(complement(360795..360860),complement(360624..360741),
FT                   complement(360323..360567),complement(359670..360263))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213792" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947762"
FT                   /orf_name="Pc20g01610"
FT                   /product="Pc20g01610 protein"
FT                   /function="L-malate dehydrogenase activity"
FT                   /function="binding"
FT                   /biological_process="glycolysis"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85490.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0030060"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniParc:UPI00018312D5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG8"
FT                   /transl_table=1
FT                   /translation="MFAARRTVNLFQKRAFSASAINASKVSVLGAAGGIGQPLSLLLKL
FT                   NPRVSELALYDIRGGPGVAADLSHINTNSTVTGYNPDASGLRDCLEGSEIILIPAGVPR
FT                   KPGMTRDDLFNTNASIVRDLAKAAAEAAPKAHVLVIANPVNSTVPIVAEVYKARNVYDP
FT                   KRLFGVTTLDVVRASRFISQVQNTNPAGEAVPVVGGHSGVTIVPLLSQSNHSSIAGQAR
FT                   DALVNRIQFGGDEVVKAKDGAGSATLSMAMAGARFAESLLRAAQGEKGVIEPTFVDSPL
FT                   YKDQGIDFFASRVELGPNGVEKINSVGEVNEYEQGLLDACLTDLKKNIQKGVDFVKANP
FT                   "
     atgttcgccg ctcgtcgcac tgtcaacctc ttccagaagc gtgccttctc ggcctccgct        60
     atcaatgcct ccaaggtctc cgttctcggt gccgccggtg gtattggcca gcctctctcc       120
     ctgctgctga agcttaaccc ccgtgtttcc gagctcgctc tctacgatat ccgcggtgga       180
     cccggtgtcg ctgctgacct gagccacatc aacaccaaca gcaccgttac cggctacaac       240
     cccgatgctt ccggtctccg tgactgcctc gagggctccg agatcatcct catccccgct       300
     ggtgttcccc gcaagcccgg tatgacccgt gatgacctct tcaacaccaa cgcctccatc       360
     gtccgcgacc ttgccaaggc cgccgctgag gccgccccca aggcccacgt cctggtcatt       420
     gccaaccccg tcaactccac cgtccccatc gttgccgagg tctacaaggc ccgcaacgtc       480
     tacgacccca agcgtctgtt tggtgtcacc acccttgacg tcgtccgtgc ctcgcgcttc       540
     atctcccagg tccagaacac caaccccgcc ggcgaggctg tccccgtcgt tggtggccac       600
     tccggtgtga ccatcgtccc cctgctttcc cagtccaacc actcctccat cgccggtcag       660
     gcccgcgatg cccttgtcaa ccgcatccag ttcggtggtg acgaggttgt caaggccaag       720
     gacggtgccg gttccgccac cctctccatg gccatggccg gtgctcgctt cgccgagtct       780
     ctcctccgcg ccgcccaggg cgagaagggt gtcatcgagc ccaccttcgt cgactcccct       840
     ctgtacaagg accagggcat cgacttcttc gcttcccgcg tcgagctcgg ccccaacggt       900
     gttgagaaga tcaactccgt cggcgaggtc aacgagtacg agcagggtct cctcgatgcc       960
     tgcctgactg acctcaagaa gaacatccag aagggtgttg acttcgtcaa ggccaaccct      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page