(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE162

PENCW_16.PE162       Location/Qualifiers
FT   CDS_pept        join(complement(362604..362606),complement(362457..362556),
FT                   complement(362219..362400),complement(361720..362163))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217458" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947763"
FT                   /orf_name="Pc20g01620"
FT                   /product="Pc20g01620 protein"
FT                   /protein_id="CAP85491.1"
FT                   /db_xref="UniParc:UPI00018312D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG9"
FT                   /transl_table=1
FT                   /translation="MNSLFNSALKQSSSIRRDLDTFSQSPTTSSPALQGQLAASLASLS
FT                   RTVDDYSALSKKELIPEKQQKAFDRVKNFRNELMDYRTQFDRLRKEREDAQSVTNHNEL
FT                   LGRRPHHTATPENPYAQSSLPQSTSAFTPSSSDLGFGASPADYNRETNALREQSFFSNT
FT                   HNQLDDFLDRGRAVLADLGQQREVLKGTQRRLYSVANTLGVSGDTIRMVERRARQDKWI
FT                   FWGGVVIFFLFCWAVLHFLR"
     atgaattcgc tatttaactc tgctttaaag caatcgtcgt ccatccgccg tgatctggac        60
     accttttcac aatcaccaac cacctcctca cctgcgttac aaggccagct tgcagcctcc       120
     ttagcatcgc tttcccgcac cgttgatgac tactcagcgc tctccaagaa ggaactgatt       180
     cccgagaaac aacaaaaggc attcgaccgt gtcaagaact tccgaaatga gctcatggac       240
     taccggacac aattcgatcg acttcgcaaa gaacgcgagg atgcacaatc ggttaccaac       300
     cataatgaac tcctaggtcg tcgcccacac cacaccgcaa caccagagaa cccttatgcg       360
     cagtcctccc ttccacagag cacctcagcc tttacaccct catcctcaga cctcggtttt       420
     ggcgccagtc cagcagacta caaccgcgaa accaatgcgc tgcgcgagca gtcgttcttc       480
     tccaacacac acaaccaact cgatgatttc ctggaccgag gaagagcggt tctcgctgac       540
     ctcgggcagc agcgtgaggt acttaaagga acgcagcgtc gactatacag cgttgcgaac       600
     acacttggtg tcagcgggga taccattcgg atggtggagc gacgggcgcg tcaggataag       660
     tggatattct ggggtggggt agtgattttc ttcttgttct gctgggcagt gctgcacttc       720
     ttgcggtag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page