(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE163

PENCW_16.PE163       Location/Qualifiers
FT   CDS_pept        join(complement(365916..366025),complement(365808..365857),
FT                   complement(365524..365747),complement(364396..365462),
FT                   complement(363737..363859),complement(363252..363663))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000281566" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947764"
FT                   /orf_name="Pc20g01630"
FT                   /product="Pc20g01630 protein"
FT                   /function="dihydrolipoyllysine-residue acetyltransferase
FT                   activity"
FT                   /biological_process="pyruvate metabolic process "
FT                   /cellular_component="pyruvate dehydrogenase complex "
FT                   /protein_id="CAP85492.1"
FT                   /db_xref="GO:0004742"
FT                   /db_xref="GO:0006090"
FT                   /db_xref="GO:0045254"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI00018312D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH0"
FT                   /transl_table=1
FT                   /translation="MVASAIRMRTPSAMFMSRGAAAMRRPQVSSKLQEVIQTQVPALSA
FT                   LSRFYASKSFPPHTLISMPALSPTMTAGNIGVWQKKAGDALQPGDVLVEIETDKAQMDF
FT                   EFQDEGVLAKVLKESGEKDVSVGSPIAVLVEEGSDVSAFESFTLADAGGDKPAPTEQKE
FT                   EPKSAEPSTPAPAEEAPAAQEPETSGEKLQPSLDREPSISPAAKVLALEKGVSIKGLKG
FT                   TGRGGVITKEDVEKAKPATTAVSGEATFEEIPVSSMRKTIANRLKQSMTENPHYFVSTT
FT                   LSVTKLLKLRQALNASADGQYKLSVNDFLVKACAVALLKVPQVNSSWREENGQAVIRQH
FT                   KTADISVAVSTPTGLITPVVKNVQGLGLSSISKQVKDLGKRARENKLKPEEYQGGTFTI
FT                   SNMGMNAAVERFTAVINPPQAGILAVGTTRKVAIPVETEEGTVTEWDDQIIVTGSFDHK
FT                   VVDGAVGGEWIKELKKVVENPLELLLISPDYVLIPSRTNMSYADAAAKGPKQSPEDVRI
FT                   QTRIFTLRRAPPVGGIYRDESESTASLIDVDGPHVQTVESDFLKHDVQTTTQAERIDRE
FT                   AEEKEKREDEEKKKARSQKAKSSGICGNTSNPVFIANAAIATVVGAGLGFGVYKQHARG
FT                   NLSWELVGLSAGAVGIFGAVDYFVSK"
     atggttgcgt cagctattcg gatgcgcacc ccgagtgcca tgttcatgtc tagaggtgcc        60
     gccgctatgc gccggcccca ggtctcctcc aagctccagg aggtgattca gacccaagtg       120
     cctgcgctct ctgccctttc ccgcttctat gcctccaagt ccttccctcc ccacacactt       180
     attagcatgc cggcactttc gccgaccatg accgccggaa acatcggcgt gtggcagaag       240
     aaggccggag atgccctcca gcccggtgat gtcctggtgg agatcgaaac cgacaaggct       300
     cagatggatt tcgagttcca ggatgagggt gtcctggcca aggttctgaa ggagagcggc       360
     gagaaggatg tctctgttgg ctcgcccatt gccgtccttg ttgaggaggg ttccgatgta       420
     tccgccttcg agtccttcac cctggctgat gctggtggtg acaagcctgc ccccactgag       480
     cagaaggagg agcctaagag cgctgagcct tcgaccccgg ccccagccga agaggcaccc       540
     gccgcgcagg agcccgagac gtcaggcgag aagctccagc ccagtcttga ccgtgagccc       600
     tctatcagcc ccgccgctaa ggtcttggcc cttgagaagg gtgtgtccat caaggggctt       660
     aagggtaccg gccgtggtgg tgtcatcacg aaggaggatg ttgagaaggc caagcccgcc       720
     accaccgctg tttccggcga ggctaccttc gaggaaatcc ccgtcagctc gatgcgcaag       780
     accatcgcca accgcctgaa gcagtccatg accgagaacc ctcactactt cgtctccacc       840
     actctctcgg ttaccaagct cctgaagctc cgccaggccc tcaacgcttc cgctgacggt       900
     cagtacaagc tttccgtcaa cgacttcttg gtcaaggcat gcgctgttgc ccttctgaag       960
     gtcccccagg ttaactccag ctggcgcgag gagaacggcc aggccgtgat ccgtcagcac      1020
     aagaccgctg acatcagcgt cgctgtgtct acccccactg gtttgatcac ccccgttgtc      1080
     aagaacgttc agggtctcgg actctccagc atctccaagc aggtcaagga ccttggcaag      1140
     cgtgcgcgcg agaacaagct taagcccgag gagtaccagg gcggcacttt caccatctcc      1200
     aacatgggta tgaacgccgc tgtcgagcgc ttcaccgctg tcatcaaccc cccgcaggcc      1260
     ggtatcctgg ctgttggcac cacccgtaag gttgctatcc ccgtcgagac cgaagagggc      1320
     accgttaccg agtgggacga ccagatcatc gtcactggta gcttcgacca caaggtggtt      1380
     gatggcgccg ttggtggtga atggattaag gagctgaaga aggtcgtcga gaaccctctg      1440
     gagcttctgc tgatttcccc agattacgtt ctaataccat cacgcacaaa catgtcttac      1500
     gccgacgcag ctgcaaaggg ccctaagcag tcccccgagg atgtacgtat tcaaactcgt      1560
     atattcacat tacgccgcgc tccccctgtg ggcggaatct accgcgatga atccgagagc      1620
     acagcctcgt tgatcgacgt cgatggccct catgttcaga ctgtggaatc cgacttcctg      1680
     aagcacgatg tccaaaccac cacccaggcg gagcggatag accgcgaagc cgaggagaag      1740
     gagaagcgtg aggacgagga aaagaagaag gcaaggagcc aaaaggcgaa gagcagtggc      1800
     atctgtggaa acaccagcaa ccctgtcttt atcgccaatg ccgctatcgc aaccgtcgtc      1860
     ggcgcaggcc tcggctttgg tgtctacaag caacacgcgc ggggcaacct ctcctgggag      1920
     ctggtcggac tctctgccgg tgctgtcgga atctttggtg ctgtggacta ctttgtcagc      1980
     aagtaa                                                                 1986
//

If you have problems or comments...

PBIL Back to PBIL home page