(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE164

PENCW_16.PE164       Location/Qualifiers
FT   CDS_pept        join(366479..366631,366747..368536,368588..370863,
FT                   370914..372300,372364..372700)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181045" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947765"
FT                   /orf_name="Pc20g01640"
FT                   /product="Pc20g01640 protein"
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /function="binding"
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85493.1"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR015403"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018313A7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDP9"
FT                   /transl_table=1
FT                   /translation="MDMYITLNVHALLYVCLQNQTMSILPGKRGAVRTLESPTPAGTRG
FT                   SIILAEITPPGVSLTMADTELGSEPTQSIEMPKKPVETPDISPTVPNSDEPALPEQTEP
FT                   QEPVQKGDEEVPKGQDDEEKPEVPPKDEPEQTEQEPQTDGPPTIQEPPQDDNDATESRL
FT                   RSDSRSTTATFMTQRSSPVSSTVFIVTALDNIAASRDARRDKKLEDATQVALANIRQPD
FT                   GQAIDPELIFRPLHLASKALSIPLQVTALDCIGKLITYSYFAFPSAETENNATREQPPL
FT                   IERAIDAICDCFENEATAVEIQQQIIKSLLAAVLNDKIVVHGAGLLKAVRQIYNIFIYS
FT                   KSSQNQQIAQGSLTQMVSTVFDRVRTRMDLKELRVRELEKPSSTLDASASDVGQTSETA
FT                   SMPVADQPVTKEPTTEKLTLQSFESPKEVTGVNDNAPTTVTRAKRSATRSMSGIPEEKD
FT                   DDSSAEDDVDEIYVKDAFLVFRALCKLSHKVLTHEQQQDVKSQNMRSKLLSLHLIHYLI
FT                   NNHTATFISPLAAIKNSSSSADGMNLLLAVRPHLCLSLSRNGSSAVPHIFKVCCEIFWL
FT                   MLKDMRVMMKKELEVFLKEIYLAILEKRGAPAFQKQYFMEILERLGGDPRALVEIYLNY
FT                   DCDRTALENIFQNIIEQLSRYSSVPVVTTPSQQHQYQEQHTKMSAIGSEWHHRGTLPPS
FT                   LTSAHIVPTPPPSMPHIPSEYGLKQQALECLVEILRSLDNWATHRIDEQPEAAMPSKSM
FT                   DNSRESLDTSVLVSPHPETLEGGTGRSTPMPEDDPNQIEKVKQRKIALTNAIQQFNFKP
FT                   KRGIKALLKEGFIQSESPEDIASFMLRTDRIDKAVLGEYLGEGDPENIAIMHAFVDLME
FT                   FTKRRFVESLRSFLQHFRLPGEAQKIDRFMLKFAERYTTQNPNAFANADTAYVLAYSVI
FT                   LLNTDQHSSKMKGRRMTKEDFIKNNRGINDNQDLPTDYLGAIYEDIGSNEIVLYTEQEH
FT                   AANLNPQPAAPTGLATRAGQVFATVGRDIQGEKYAQASEEMANKTEQLYRSLIRAQRKT
FT                   AVKDALSHFIPATSERHVGSMFNVTWMSFLSGLSAPMQDTSNLETIRLCMEGLKLSIRI
FT                   SCAFDLETPRVAFVTALAKFTNLGNVREMMAKNVEALKALLDVAFTEGNHLQGSWRDVL
FT                   TCVSQLDRLQLLSDGVDEGSLPDVSRAPSSADTSRRSMQSTRRARPRSVNGPTAFRPEI
FT                   AMESRSADMIRGVDRIFTNTANLSHEAIIDFVRALSEVSWQEIQSSGHTDSPRTYSLQK
FT                   LVEISYYNMTRVRIEWSKIWDVLGQHFNQVGCHSNTMVVFFALDSLRQLSMRFMEIEEL
FT                   PGFKFQKDFLKPFEHVMANSTTAAVKDMILRCLIQMIQARGDNIRSGWKTMFGVFTVAA
FT                   REPYEGIVNMAFDHVTQVYNTRFGVVITQGAFADLIVCLTEFSKNSKFQKKSLQAIETL
FT                   RSTVTKMLRTPECPLSHRGASAATFQDNGTNLAKQLTRQSQEEQFWYPILIAFQDVLMT
FT                   GDDLEVRSRALTYLFDTLIRHGGDFPRDFWDVLWRQLLYPIFVVLQSKSEMSKVPNHED
FT                   LSVWLSTTMIQALRNMITLFTHYFDALEYMLSRFLELLTLCICQENDTIARIGSNCLQQ
FT                   LILQNVAKFKQEHWSQIVGAFVELFSKTTAYELFTAAVSMSKPAEAVNGDLTQSPDAAV
FT                   ATSDLPDALQPNGSQSTSSIHDGGDPPVQSEARAELEDYRPQSDQQQPAAVTAARRRYF
FT                   NRIITNCVLQLLMIETVHELFSNENVYAQIPSGELLRLMGLLKKSYQFAKKFNEDKDLR
FT                   MQLWRQGFMKQPPNLLKQESGSASTYVRILFRMYHDEREERQSSRAETEAALIPLCADI
FT                   IRSFVRLEEDTQHRNIVAWRPVVVDVIDGYTNFPQDDFNNHIETFYPLGVELLSRDLNP
FT                   EIRVALQSLLRRIGEVRLGIAPPNPLDVPISPRSSVSQKVPRRDSQV"
     atggatatgt acataacatt gaacgtacat gcgttgttgt atgtatgttt acagaaccaa        60
     actatgagca ttctgcctgg caaaagaggg gcggtgagaa ccttggaatc tccaactcca       120
     gctggaaccc gcgggtcaat aatattagct gagatcactc cgcccggagt ctccttgacc       180
     atggcggaca ctgaactcgg ctctgagccg acccaatcca ttgagatgcc taagaaaccc       240
     gtcgagaccc ccgacatatc tcctacagta ccaaactccg acgagccagc cctgcccgag       300
     cagacagaac cacaagaacc ggtccagaag ggcgacgagg aagtacccaa gggccaggat       360
     gacgaagaaa aaccagaggt gccgcccaaa gacgagcctg aacagactga gcaagaaccc       420
     caaacagacg gtccgcctac gattcaggaa cccccccagg atgacaacga tgcgacagaa       480
     agccggttgc gatccgattc gcggtcaaca acggctacat tcatgacaca gcgatctagc       540
     ccggttagct cgacagtctt cattgtgacg gctctggaca atatcgctgc ctcgcgggac       600
     gcccggaggg acaaaaagct ggaggatgcc acacaggtgg ccctggccaa tatcagacaa       660
     cccgatgggc aagcgattga tcccgagctt atcttccgtc ctctgcattt ggcaagcaaa       720
     gccctcagca ttcctctgca ggtaactgca ttggattgca ttggaaagct gatcacatac       780
     tcctatttcg cattcccatc tgccgagaca gagaacaatg ccacccgtga acaacctcca       840
     ctcatcgagc gtgccatcga tgcgatctgc gactgcttcg agaacgaagc cacggcggtt       900
     gaaatccaac agcagatcat caaatcgctg ttggcagcgg tcctgaatga taagatcgtg       960
     gtacatggag ctggtctcct gaaagctgtc cgccaaattt acaacatctt tatctactcc      1020
     aaatccagtc agaaccaaca gatcgctcag gggtcgctca cacaaatggt cagcacggtc      1080
     tttgatcgag tgcggacacg gatggatctc aaagagctcc gagtgcgaga gctggaaaag      1140
     ccatcctcga ccctcgatgc atcggcgagc gacgtgggcc agacttcgga gacggcttcc      1200
     atgcctgtgg ctgatcagcc cgttaccaaa gagcccacta cggagaagct cacattacag      1260
     agttttgagt cccctaagga ggttaccggt gtcaacgata atgcgccgac tacagtcacg      1320
     cgcgctaagc ggtcagcgac gaggtcgatg tcgggcattc ctgaggaaaa agatgatgat      1380
     agctcggccg aggacgatgt ggacgagatt tatgttaagg atgccttcct ggttttccgt      1440
     gcgctctgca aattgagcca taaagtcctg actcatgagc agcagcaaga cgtcaagtcc      1500
     caaaacatga ggtctaagct actttcgttg cacttgattc actatctcat caacaaccac      1560
     accgcaacct ttatatcccc tctggcagca atcaagaaca gctcatccag cgcggatgga      1620
     atgaatctcc ttctagccgt acgacctcat ttgtgcctaa gtctgagtcg caatggttct      1680
     agcgccgtgc ctcatatctt caaagtttgc tgtgaaattt tctggctgat gctgaaggac      1740
     atgagagtta tgatgaaaaa ggaactcgag gtgttcttga aagaaattta tctggccatc      1800
     ctcgagaaac gcggggctcc tgcgttccaa aagcagtact tcatggagat tctagagagg      1860
     ctaggtggtg atccacgggc tctagttgaa atctatctca actacgactg tgacagaacc      1920
     gcgttggaga atatattcca aaatatcatc gagcaattgt cccggtactc cagtgtgccg      1980
     gttgtaacaa caccttctca gcaacatcag taccaagagc agcacactaa aatgtcagct      2040
     attggttctg aatggcacca ccgaggaact cttccccctt cgttgacaag cgcgcacatt      2100
     gttcctactc cgccgccctc aatgcctcac atcccatcag agtacgggtt gaaacagcag      2160
     gctctggagt gccttgtgga gatactgcgc tcactggaca actgggccac ccatcgcatt      2220
     gatgaacaac ccgaggcagc tatgccctcc aaatctatgg ataactcccg tgagtccttg      2280
     gatacaagcg ttcttgtgtc accgcatccc gagaccctcg agggtgggac gggccggtcc      2340
     acacctatgc cggaagacga cccgaaccag attgaaaaag tcaagcaacg aaaaattgcc      2400
     ctcacaaatg ccatccaaca attcaatttc aaacccaagc gcggcatcaa ggcccttctg      2460
     aaagaaggct tcatccaatc cgagtcccct gaagacattg ccagcttcat gcttcgcaca      2520
     gaccgcattg acaaggccgt gctgggagag tatcttggcg agggagatcc ggaaaacatc      2580
     gccatcatgc atgctttcgt cgatctgatg gaatttacca agcgtcgctt tgttgaatcc      2640
     ctgcgctcat ttttgcagca tttccgcctc cctggtgaag cacaaaagat cgatcgtttc      2700
     atgctgaagt ttgctgaaag gtatacaact cagaatccta atgccttcgc caacgccgac      2760
     accgcgtatg tgcttgcgta ctcggtgatt ctacttaaca ccgatcagca cagttcaaaa      2820
     atgaaggggc gccgtatgac gaaggaggac ttcatcaaga acaaccgcgg aatcaatgac      2880
     aaccaagacc tgccaaccga ttatcttggg gccatttatg aggatattgg aagcaacgaa      2940
     atcgtcctat acaccgagca ggaacatgct gccaacctca accctcaacc cgccgctccc      3000
     actggccttg ccaccagagc tggacaggta tttgctaccg ttggacgaga catccagggt      3060
     gagaaatacg cacaggcttc tgaggaaatg gcgaacaaga cagaacagct ctatcgctcc      3120
     ctcattcgag cccaacgcaa aacggcagtt aaagatgcgc tttcgcactt cattcccgca      3180
     acatcagagc gtcatgtcgg gtcgatgttc aacgtcacat ggatgtcttt cctatctggt      3240
     ctgtctgcgc cgatgcagga cacctcgaat ctggaaacta tccggctctg catggaggga      3300
     ctcaaattgt ccatccggat cagttgtgcc ttcgacctag agactcctcg tgtggcattt      3360
     gtcactgctt tggcgaagtt cactaatctc ggaaacgtga gggaaatgat ggccaagaat      3420
     gtcgaggccc tgaaagcctt gctagatgtt gccttcaccg agggaaacca tctccagggc      3480
     tcgtggaggg atgtcttgac atgtgtcagt caacttgatc ggctccaact cttgagtgat      3540
     ggcgtcgatg agggatcgct gcccgatgtt tcgagggcac cctcatcggc agatacttcc      3600
     cgcaggtcta tgcaaagtac gcgacgcgct cgccctcgtt ctgtgaatgg gccaactgct      3660
     ttccgtccgg aaattgcaat ggagagtcgt tcggcagata tgattcgtgg cgtggaccgc      3720
     atcttcacta acactgccaa tctttcgcat gaggccatta tcgatttcgt tagggccttg      3780
     agcgaggtca gctggcaaga aattcaatct tccggtcaca ccgattcgcc ccggacctac      3840
     agtttacaga agctcgtcga gatcagttac tacaacatga ctcgtgtcag gattgagtgg      3900
     tctaagattt gggatgtttt gggtcagcac ttcaaccaag ttggctgcca ctctaatacc      3960
     atggttgtct tcttcgcctt ggattcgctc aggcaacttt cgatgcgctt catggagatt      4020
     gaggagttgc ctggtttcaa attccaaaag gacttcctta agcctttcga acatgtgatg      4080
     gcaaacagca ccactgctgc tgtcaaggac atgattctgc ggtgtctgat ccagatgatt      4140
     caggcccgtg gcgacaacat ccgttcggga tggaagacca tgtttggtgt cttcacagtc      4200
     gcagcacggg aaccttatga gggaatcgta aacatggctt ttgaccatgt cacccaagtc      4260
     tacaacacca gatttggcgt agtgatcacc caaggtgcct ttgcagatct cattgtatgt      4320
     ctgactgaat tctcaaagaa ctccaagttc caaaagaaat cgctgcaggc aattgagacc      4380
     ctcaggtcca ccgtcaccaa aatgctacgg actccagaat gtcccttgtc acaccgtggt      4440
     gcctcggcgg ccaccttcca ggacaacgga accaatcttg ctaagcagct tacccgtcaa      4500
     tcacaagaag agcagttctg gtacccgatt ctcatcgcat tccaggatgt acttatgacg      4560
     ggagatgatc tcgaggtccg ctcacgagca ctcacatacc tcttcgatac gctaatccga      4620
     cacggtggcg atttccccag ggacttttgg gatgtcctct ggagacaact cctctacccg      4680
     atcttcgtgg tcctgcagtc taagtctgaa atgtccaagg ttccgaacca cgaggacctt      4740
     tcagtttggc tgtccacgac aatgatccag gcgctacgga acatgatcac cttgttcacg      4800
     cactatttcg atgccttgga gtatatgctg agccgcttct tggaactgct gacattgtgt      4860
     atttgtcaag aaaatgacac aattgcacga attggcagca actgcctaca acagctgatt      4920
     ctgcagaatg ttgcaaagtt caagcaggag cattggtctc agattgttgg ggcattcgtg      4980
     gagctcttca gcaaaacgac tgcttatgag cttttcacag ccgctgtatc catgtctaag      5040
     ccagcagagg cagttaacgg ggacctcacg cagtctccag atgctgctgt agcaacaagt      5100
     gatttgcctg atgcgttgca acctaacggt tcccaaagta catcttctat ccatgacggt      5160
     ggagatcctc ctgtccaaag tgaagcccgc gccgaattag aagactatcg cccccagtca      5220
     gaccagcagc aacctgcggc tgttactgca gctcggcgtc gctacttcaa ccgcattatc      5280
     acgaactgcg ttctgcagct gctcatgatt gaaaccgtcc acgaactttt ctcgaacgaa      5340
     aatgtctatg cacagattcc cagtggggag ctcctccgac tcatgggact gctgaaaaag      5400
     agttaccagt ttgcgaaaaa gtttaacgag gataaggact tgcggatgca actctggcgc      5460
     cagggattca tgaagcaacc tcctaattta ttgaagcagg agagcggcag tgcctccacc      5520
     tatgtgcgta ttctcttccg gatgtatcac gacgagcgag aggaaagaca gagcagtcgc      5580
     gcagaaaccg aggctgcact cattccactt tgtgcggaca ttattcgcag tttcgtccgc      5640
     cttgaagagg acacccagca ccgcaacatc gtcgcttggc gtccggtggt ggtcgatgtc      5700
     atcgatggat ataccaattt cccgcaagat gacttcaata atcatattga gactttttac      5760
     ccgctcggag ttgagctttt gagccgtgat ctcaacccgg agattcgcgt tgccctccag      5820
     tctctactgc gccgtatcgg cgaggtccga ctgggcattg ctccgcccaa tcccctggac      5880
     gtccccatca gcccgcggag ctccgtctcc caaaaggtcc cgcgccgcga tagccaggtc      5940
     tga                                                                    5943
//

If you have problems or comments...

PBIL Back to PBIL home page